data_7S5B # _entry.id 7S5B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7S5B pdb_00007s5b 10.2210/pdb7s5b/pdb WWPDB D_1000259641 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-05-11 2 'Structure model' 1 1 2022-05-18 3 'Structure model' 1 2 2022-05-25 4 'Structure model' 1 3 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.title' 2 3 'Structure model' '_citation.journal_volume' 3 3 'Structure model' '_citation.page_first' 4 3 'Structure model' '_citation.page_last' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7S5B _pdbx_database_status.recvd_initial_deposition_date 2021-09-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Walsh, S.T.R.' 1 0000-0002-9288-8443 'Cao, L.' 2 0000-0002-7234-1459 'Baker, D.' 3 0000-0001-7896-6217 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 605 _citation.language ? _citation.page_first 551 _citation.page_last 560 _citation.title 'Design of protein-binding proteins from the target structure alone.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-022-04654-9 _citation.pdbx_database_id_PubMed 35332283 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cao, L.' 1 ? primary 'Coventry, B.' 2 ? primary 'Goreshnik, I.' 3 ? primary 'Huang, B.' 4 ? primary 'Sheffler, W.' 5 ? primary 'Park, J.S.' 6 0000-0002-1575-1849 primary 'Jude, K.M.' 7 0000-0002-3675-5136 primary 'Markovic, I.' 8 ? primary 'Kadam, R.U.' 9 ? primary 'Verschueren, K.H.G.' 10 ? primary 'Verstraete, K.' 11 ? primary 'Walsh, S.T.R.' 12 ? primary 'Bennett, N.' 13 ? primary 'Phal, A.' 14 0000-0001-8405-4150 primary 'Yang, A.' 15 0000-0002-8704-0288 primary 'Kozodoy, L.' 16 ? primary 'DeWitt, M.' 17 ? primary 'Picton, L.' 18 0000-0002-0482-5187 primary 'Miller, L.' 19 ? primary 'Strauch, E.M.' 20 0000-0001-7382-747X primary 'DeBouver, N.D.' 21 0000-0003-2545-6007 primary 'Pires, A.' 22 ? primary 'Bera, A.K.' 23 0000-0001-9473-2912 primary 'Halabiya, S.' 24 ? primary 'Hammerson, B.' 25 ? primary 'Yang, W.' 26 ? primary 'Bernard, S.' 27 ? primary 'Stewart, L.' 28 0000-0003-4264-5125 primary 'Wilson, I.A.' 29 0000-0002-6469-2419 primary 'Ruohola-Baker, H.' 30 0000-0002-5588-4531 primary 'Schlessinger, J.' 31 0000-0002-5085-5969 primary 'Lee, S.' 32 ? primary 'Savvides, S.N.' 33 0000-0003-3420-5947 primary 'Garcia, K.C.' 34 0000-0001-9273-0278 primary 'Baker, D.' 35 0000-0001-7896-6217 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Miniprotein Binder' 6443.422 2 ? ? ? ? 2 water nat water 18.015 75 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SVIEKLRKLEKQARKQGDEVLVMLARMVLEYLEKGWVSEEDADESADRIEEVLKK _entity_poly.pdbx_seq_one_letter_code_can SVIEKLRKLEKQARKQGDEVLVMLARMVLEYLEKGWVSEEDADESADRIEEVLKK _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 VAL n 1 3 ILE n 1 4 GLU n 1 5 LYS n 1 6 LEU n 1 7 ARG n 1 8 LYS n 1 9 LEU n 1 10 GLU n 1 11 LYS n 1 12 GLN n 1 13 ALA n 1 14 ARG n 1 15 LYS n 1 16 GLN n 1 17 GLY n 1 18 ASP n 1 19 GLU n 1 20 VAL n 1 21 LEU n 1 22 VAL n 1 23 MET n 1 24 LEU n 1 25 ALA n 1 26 ARG n 1 27 MET n 1 28 VAL n 1 29 LEU n 1 30 GLU n 1 31 TYR n 1 32 LEU n 1 33 GLU n 1 34 LYS n 1 35 GLY n 1 36 TRP n 1 37 VAL n 1 38 SER n 1 39 GLU n 1 40 GLU n 1 41 ASP n 1 42 ALA n 1 43 ASP n 1 44 GLU n 1 45 SER n 1 46 ALA n 1 47 ASP n 1 48 ARG n 1 49 ILE n 1 50 GLU n 1 51 GLU n 1 52 VAL n 1 53 LEU n 1 54 LYS n 1 55 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 55 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LYS 55 55 55 LYS LYS A . n B 1 1 SER 1 1 1 SER SER B . n B 1 2 VAL 2 2 2 VAL VAL B . n B 1 3 ILE 3 3 3 ILE ILE B . n B 1 4 GLU 4 4 4 GLU GLU B . n B 1 5 LYS 5 5 5 LYS LYS B . n B 1 6 LEU 6 6 6 LEU LEU B . n B 1 7 ARG 7 7 7 ARG ARG B . n B 1 8 LYS 8 8 8 LYS LYS B . n B 1 9 LEU 9 9 9 LEU LEU B . n B 1 10 GLU 10 10 10 GLU GLU B . n B 1 11 LYS 11 11 11 LYS LYS B . n B 1 12 GLN 12 12 12 GLN GLN B . n B 1 13 ALA 13 13 13 ALA ALA B . n B 1 14 ARG 14 14 14 ARG ARG B . n B 1 15 LYS 15 15 15 LYS LYS B . n B 1 16 GLN 16 16 16 GLN GLN B . n B 1 17 GLY 17 17 17 GLY GLY B . n B 1 18 ASP 18 18 18 ASP ASP B . n B 1 19 GLU 19 19 19 GLU GLU B . n B 1 20 VAL 20 20 20 VAL VAL B . n B 1 21 LEU 21 21 21 LEU LEU B . n B 1 22 VAL 22 22 22 VAL VAL B . n B 1 23 MET 23 23 23 MET MET B . n B 1 24 LEU 24 24 24 LEU LEU B . n B 1 25 ALA 25 25 25 ALA ALA B . n B 1 26 ARG 26 26 26 ARG ARG B . n B 1 27 MET 27 27 27 MET MET B . n B 1 28 VAL 28 28 28 VAL VAL B . n B 1 29 LEU 29 29 29 LEU LEU B . n B 1 30 GLU 30 30 30 GLU GLU B . n B 1 31 TYR 31 31 31 TYR TYR B . n B 1 32 LEU 32 32 32 LEU LEU B . n B 1 33 GLU 33 33 33 GLU GLU B . n B 1 34 LYS 34 34 34 LYS LYS B . n B 1 35 GLY 35 35 35 GLY GLY B . n B 1 36 TRP 36 36 36 TRP TRP B . n B 1 37 VAL 37 37 37 VAL VAL B . n B 1 38 SER 38 38 38 SER SER B . n B 1 39 GLU 39 39 39 GLU GLU B . n B 1 40 GLU 40 40 40 GLU GLU B . n B 1 41 ASP 41 41 41 ASP ASP B . n B 1 42 ALA 42 42 42 ALA ALA B . n B 1 43 ASP 43 43 43 ASP ASP B . n B 1 44 GLU 44 44 44 GLU GLU B . n B 1 45 SER 45 45 45 SER SER B . n B 1 46 ALA 46 46 46 ALA ALA B . n B 1 47 ASP 47 47 47 ASP ASP B . n B 1 48 ARG 48 48 48 ARG ARG B . n B 1 49 ILE 49 49 49 ILE ILE B . n B 1 50 GLU 50 50 50 GLU GLU B . n B 1 51 GLU 51 51 51 GLU GLU B . n B 1 52 VAL 52 52 52 VAL VAL B . n B 1 53 LEU 53 53 53 LEU LEU B . n B 1 54 LYS 54 54 54 LYS LYS B . n B 1 55 LYS 55 55 55 LYS LYS B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 101 73 HOH HOH A . C 2 HOH 2 102 21 HOH HOH A . C 2 HOH 3 103 31 HOH HOH A . C 2 HOH 4 104 35 HOH HOH A . C 2 HOH 5 105 10 HOH HOH A . C 2 HOH 6 106 4 HOH HOH A . C 2 HOH 7 107 8 HOH HOH A . C 2 HOH 8 108 13 HOH HOH A . C 2 HOH 9 109 40 HOH HOH A . C 2 HOH 10 110 18 HOH HOH A . C 2 HOH 11 111 7 HOH HOH A . C 2 HOH 12 112 47 HOH HOH A . C 2 HOH 13 113 32 HOH HOH A . C 2 HOH 14 114 48 HOH HOH A . C 2 HOH 15 115 27 HOH HOH A . C 2 HOH 16 116 16 HOH HOH A . C 2 HOH 17 117 84 HOH HOH A . C 2 HOH 18 118 83 HOH HOH A . C 2 HOH 19 119 22 HOH HOH A . C 2 HOH 20 120 26 HOH HOH A . C 2 HOH 21 121 66 HOH HOH A . C 2 HOH 22 122 12 HOH HOH A . C 2 HOH 23 123 58 HOH HOH A . C 2 HOH 24 124 20 HOH HOH A . C 2 HOH 25 125 62 HOH HOH A . C 2 HOH 26 126 63 HOH HOH A . C 2 HOH 27 127 46 HOH HOH A . C 2 HOH 28 128 61 HOH HOH A . C 2 HOH 29 129 86 HOH HOH A . C 2 HOH 30 130 45 HOH HOH A . C 2 HOH 31 131 71 HOH HOH A . D 2 HOH 1 101 25 HOH HOH B . D 2 HOH 2 102 36 HOH HOH B . D 2 HOH 3 103 34 HOH HOH B . D 2 HOH 4 104 17 HOH HOH B . D 2 HOH 5 105 37 HOH HOH B . D 2 HOH 6 106 33 HOH HOH B . D 2 HOH 7 107 28 HOH HOH B . D 2 HOH 8 108 30 HOH HOH B . D 2 HOH 9 109 39 HOH HOH B . D 2 HOH 10 110 29 HOH HOH B . D 2 HOH 11 111 11 HOH HOH B . D 2 HOH 12 112 6 HOH HOH B . D 2 HOH 13 113 67 HOH HOH B . D 2 HOH 14 114 3 HOH HOH B . D 2 HOH 15 115 76 HOH HOH B . D 2 HOH 16 116 2 HOH HOH B . D 2 HOH 17 117 68 HOH HOH B . D 2 HOH 18 118 5 HOH HOH B . D 2 HOH 19 119 44 HOH HOH B . D 2 HOH 20 120 50 HOH HOH B . D 2 HOH 21 121 15 HOH HOH B . D 2 HOH 22 122 24 HOH HOH B . D 2 HOH 23 123 14 HOH HOH B . D 2 HOH 24 124 64 HOH HOH B . D 2 HOH 25 125 9 HOH HOH B . D 2 HOH 26 126 57 HOH HOH B . D 2 HOH 27 127 74 HOH HOH B . D 2 HOH 28 128 43 HOH HOH B . D 2 HOH 29 129 55 HOH HOH B . D 2 HOH 30 130 42 HOH HOH B . D 2 HOH 31 131 41 HOH HOH B . D 2 HOH 32 132 23 HOH HOH B . D 2 HOH 33 133 72 HOH HOH B . D 2 HOH 34 134 51 HOH HOH B . D 2 HOH 35 135 56 HOH HOH B . D 2 HOH 36 136 38 HOH HOH B . D 2 HOH 37 137 78 HOH HOH B . D 2 HOH 38 138 80 HOH HOH B . D 2 HOH 39 139 49 HOH HOH B . D 2 HOH 40 140 54 HOH HOH B . D 2 HOH 41 141 60 HOH HOH B . D 2 HOH 42 142 1 HOH HOH B . D 2 HOH 43 143 65 HOH HOH B . D 2 HOH 44 144 79 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 4 ? CG ? A GLU 4 CG 2 1 Y 1 A GLU 4 ? CD ? A GLU 4 CD 3 1 Y 1 A GLU 4 ? OE1 ? A GLU 4 OE1 4 1 Y 1 A GLU 4 ? OE2 ? A GLU 4 OE2 5 1 Y 1 A GLU 33 ? CG ? A GLU 33 CG 6 1 Y 1 A GLU 33 ? CD ? A GLU 33 CD 7 1 Y 1 A GLU 33 ? OE1 ? A GLU 33 OE1 8 1 Y 1 A GLU 33 ? OE2 ? A GLU 33 OE2 9 1 Y 1 A GLU 40 ? CG ? A GLU 40 CG 10 1 Y 1 A GLU 40 ? CD ? A GLU 40 CD 11 1 Y 1 A GLU 40 ? OE1 ? A GLU 40 OE1 12 1 Y 1 A GLU 40 ? OE2 ? A GLU 40 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18rc5_3822 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 20200131 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 20200131 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7S5B _cell.details ? _cell.formula_units_Z ? _cell.length_a 92.226 _cell.length_a_esd ? _cell.length_b 92.226 _cell.length_b_esd ? _cell.length_c 108.436 _cell.length_c_esd ? _cell.volume 798749.991 _cell.volume_esd ? _cell.Z_PDB 36 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7S5B _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ;R 3 2" ; _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7S5B _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.44 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.2 _exptl_crystal.description prism _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.0 M sodium malonate pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details KB _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-02-26 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator Si _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.033310 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.033310 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 27.70 _reflns.entry_id 7S5B _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.50 _reflns.d_resolution_low 36.15 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 28231 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.95 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.7 _reflns.pdbx_Rmerge_I_obs 0.04556 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.19 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.04949 _reflns.pdbx_Rpim_I_all 0.01904 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star 1 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.501 _reflns_shell.d_res_low 1.554 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.37 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2735 _reflns_shell.percent_possible_all 97.35 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.61 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.5 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.671 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.45 _reflns_shell.pdbx_CC_star 0.788 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 35.92 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7S5B _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.50 _refine.ls_d_res_low 36.15 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 28214 _refine.ls_number_reflns_R_free 1412 _refine.ls_number_reflns_R_work 26802 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.96 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1780 _refine.ls_R_factor_R_free 0.1983 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1769 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model model _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.0239 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2228 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.50 _refine_hist.d_res_low 36.15 _refine_hist.number_atoms_solvent 75 _refine_hist.number_atoms_total 961 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 886 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0132 ? 890 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.3885 ? 1185 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0547 ? 136 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0076 ? 149 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 4.1699 ? 118 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.50 1.55 . . 137 2587 97.53 . . . 0.4254 . 0.3916 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.55 1.62 . . 140 2658 98.45 . . . 0.2698 . 0.2686 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.62 1.69 . . 139 2646 98.72 . . . 0.2498 . 0.2315 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.69 1.78 . . 140 2651 98.76 . . . 0.2568 . 0.2157 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.78 1.89 . . 140 2663 99.26 . . . 0.2415 . 0.1960 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.89 2.04 . . 141 2678 99.19 . . . 0.1866 . 0.1743 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.04 2.24 . . 141 2689 99.30 . . . 0.2022 . 0.1679 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.24 2.57 . . 143 2709 99.55 . . . 0.1961 . 0.1599 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.57 3.23 . . 144 2728 99.72 . . . 0.2082 . 0.1859 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.23 36.15 . . 147 2793 99.09 . . . 0.1739 . 0.1617 . . . . . . . . . . . # _struct.entry_id 7S5B _struct.title 'Unbound State of a De novo designed Protein Binder to the Human Interleukin-7 Receptor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7S5B _struct_keywords.text 'minibinder protein inhibitor cytokine receptor interleukin-7, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7S5B _struct_ref.pdbx_db_accession 7S5B _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7S5B A 1 ? 55 ? 7S5B 1 ? 55 ? 1 55 2 1 7S5B B 1 ? 55 ? 7S5B 1 ? 55 ? 1 55 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C 2 1 B,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details 'SEC demonstrates monomer' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 1 ? GLY A 17 ? SER A 1 GLY A 17 1 ? 17 HELX_P HELX_P2 AA2 ASP A 18 ? LYS A 34 ? ASP A 18 LYS A 34 1 ? 17 HELX_P HELX_P3 AA3 SER A 38 ? LYS A 55 ? SER A 38 LYS A 55 1 ? 18 HELX_P HELX_P4 AA4 VAL B 2 ? GLN B 16 ? VAL B 2 GLN B 16 1 ? 15 HELX_P HELX_P5 AA5 ASP B 18 ? LYS B 34 ? ASP B 18 LYS B 34 1 ? 17 HELX_P HELX_P6 AA6 SER B 38 ? LYS B 55 ? SER B 38 LYS B 55 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 10 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 101 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 128 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 128 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 12_555 _pdbx_validate_symm_contact.dist 1.75 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE B ARG 14 ? ? CZ B ARG 14 ? ? NH1 B ARG 14 ? ? 123.84 120.30 3.54 0.50 N 2 1 NE B ARG 14 ? ? CZ B ARG 14 ? ? NH2 B ARG 14 ? ? 117.19 120.30 -3.11 0.50 N # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 B HOH 142 ? D HOH . 2 1 B HOH 143 ? D HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z 3 -x+y,-x,z 4 x-y,-y,-z 5 -x,-x+y,-z 6 y,x,-z 7 x+1/3,y+2/3,z+2/3 8 -y+1/3,x-y+2/3,z+2/3 9 -x+y+1/3,-x+2/3,z+2/3 10 x-y+1/3,-y+2/3,-z+2/3 11 -x+1/3,-x+y+2/3,-z+2/3 12 y+1/3,x+2/3,-z+2/3 13 x+2/3,y+1/3,z+1/3 14 -y+2/3,x-y+1/3,z+1/3 15 -x+y+2/3,-x+1/3,z+1/3 16 x-y+2/3,-y+1/3,-z+1/3 17 -x+2/3,-x+y+1/3,-z+1/3 18 y+2/3,x+1/3,-z+1/3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 HOH O O N N 106 HOH H1 H N N 107 HOH H2 H N N 108 ILE N N N N 109 ILE CA C N S 110 ILE C C N N 111 ILE O O N N 112 ILE CB C N S 113 ILE CG1 C N N 114 ILE CG2 C N N 115 ILE CD1 C N N 116 ILE OXT O N N 117 ILE H H N N 118 ILE H2 H N N 119 ILE HA H N N 120 ILE HB H N N 121 ILE HG12 H N N 122 ILE HG13 H N N 123 ILE HG21 H N N 124 ILE HG22 H N N 125 ILE HG23 H N N 126 ILE HD11 H N N 127 ILE HD12 H N N 128 ILE HD13 H N N 129 ILE HXT H N N 130 LEU N N N N 131 LEU CA C N S 132 LEU C C N N 133 LEU O O N N 134 LEU CB C N N 135 LEU CG C N N 136 LEU CD1 C N N 137 LEU CD2 C N N 138 LEU OXT O N N 139 LEU H H N N 140 LEU H2 H N N 141 LEU HA H N N 142 LEU HB2 H N N 143 LEU HB3 H N N 144 LEU HG H N N 145 LEU HD11 H N N 146 LEU HD12 H N N 147 LEU HD13 H N N 148 LEU HD21 H N N 149 LEU HD22 H N N 150 LEU HD23 H N N 151 LEU HXT H N N 152 LYS N N N N 153 LYS CA C N S 154 LYS C C N N 155 LYS O O N N 156 LYS CB C N N 157 LYS CG C N N 158 LYS CD C N N 159 LYS CE C N N 160 LYS NZ N N N 161 LYS OXT O N N 162 LYS H H N N 163 LYS H2 H N N 164 LYS HA H N N 165 LYS HB2 H N N 166 LYS HB3 H N N 167 LYS HG2 H N N 168 LYS HG3 H N N 169 LYS HD2 H N N 170 LYS HD3 H N N 171 LYS HE2 H N N 172 LYS HE3 H N N 173 LYS HZ1 H N N 174 LYS HZ2 H N N 175 LYS HZ3 H N N 176 LYS HXT H N N 177 MET N N N N 178 MET CA C N S 179 MET C C N N 180 MET O O N N 181 MET CB C N N 182 MET CG C N N 183 MET SD S N N 184 MET CE C N N 185 MET OXT O N N 186 MET H H N N 187 MET H2 H N N 188 MET HA H N N 189 MET HB2 H N N 190 MET HB3 H N N 191 MET HG2 H N N 192 MET HG3 H N N 193 MET HE1 H N N 194 MET HE2 H N N 195 MET HE3 H N N 196 MET HXT H N N 197 SER N N N N 198 SER CA C N S 199 SER C C N N 200 SER O O N N 201 SER CB C N N 202 SER OG O N N 203 SER OXT O N N 204 SER H H N N 205 SER H2 H N N 206 SER HA H N N 207 SER HB2 H N N 208 SER HB3 H N N 209 SER HG H N N 210 SER HXT H N N 211 TRP N N N N 212 TRP CA C N S 213 TRP C C N N 214 TRP O O N N 215 TRP CB C N N 216 TRP CG C Y N 217 TRP CD1 C Y N 218 TRP CD2 C Y N 219 TRP NE1 N Y N 220 TRP CE2 C Y N 221 TRP CE3 C Y N 222 TRP CZ2 C Y N 223 TRP CZ3 C Y N 224 TRP CH2 C Y N 225 TRP OXT O N N 226 TRP H H N N 227 TRP H2 H N N 228 TRP HA H N N 229 TRP HB2 H N N 230 TRP HB3 H N N 231 TRP HD1 H N N 232 TRP HE1 H N N 233 TRP HE3 H N N 234 TRP HZ2 H N N 235 TRP HZ3 H N N 236 TRP HH2 H N N 237 TRP HXT H N N 238 TYR N N N N 239 TYR CA C N S 240 TYR C C N N 241 TYR O O N N 242 TYR CB C N N 243 TYR CG C Y N 244 TYR CD1 C Y N 245 TYR CD2 C Y N 246 TYR CE1 C Y N 247 TYR CE2 C Y N 248 TYR CZ C Y N 249 TYR OH O N N 250 TYR OXT O N N 251 TYR H H N N 252 TYR H2 H N N 253 TYR HA H N N 254 TYR HB2 H N N 255 TYR HB3 H N N 256 TYR HD1 H N N 257 TYR HD2 H N N 258 TYR HE1 H N N 259 TYR HE2 H N N 260 TYR HH H N N 261 TYR HXT H N N 262 VAL N N N N 263 VAL CA C N S 264 VAL C C N N 265 VAL O O N N 266 VAL CB C N N 267 VAL CG1 C N N 268 VAL CG2 C N N 269 VAL OXT O N N 270 VAL H H N N 271 VAL H2 H N N 272 VAL HA H N N 273 VAL HB H N N 274 VAL HG11 H N N 275 VAL HG12 H N N 276 VAL HG13 H N N 277 VAL HG21 H N N 278 VAL HG22 H N N 279 VAL HG23 H N N 280 VAL HXT H N N 281 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 HOH O H1 sing N N 100 HOH O H2 sing N N 101 ILE N CA sing N N 102 ILE N H sing N N 103 ILE N H2 sing N N 104 ILE CA C sing N N 105 ILE CA CB sing N N 106 ILE CA HA sing N N 107 ILE C O doub N N 108 ILE C OXT sing N N 109 ILE CB CG1 sing N N 110 ILE CB CG2 sing N N 111 ILE CB HB sing N N 112 ILE CG1 CD1 sing N N 113 ILE CG1 HG12 sing N N 114 ILE CG1 HG13 sing N N 115 ILE CG2 HG21 sing N N 116 ILE CG2 HG22 sing N N 117 ILE CG2 HG23 sing N N 118 ILE CD1 HD11 sing N N 119 ILE CD1 HD12 sing N N 120 ILE CD1 HD13 sing N N 121 ILE OXT HXT sing N N 122 LEU N CA sing N N 123 LEU N H sing N N 124 LEU N H2 sing N N 125 LEU CA C sing N N 126 LEU CA CB sing N N 127 LEU CA HA sing N N 128 LEU C O doub N N 129 LEU C OXT sing N N 130 LEU CB CG sing N N 131 LEU CB HB2 sing N N 132 LEU CB HB3 sing N N 133 LEU CG CD1 sing N N 134 LEU CG CD2 sing N N 135 LEU CG HG sing N N 136 LEU CD1 HD11 sing N N 137 LEU CD1 HD12 sing N N 138 LEU CD1 HD13 sing N N 139 LEU CD2 HD21 sing N N 140 LEU CD2 HD22 sing N N 141 LEU CD2 HD23 sing N N 142 LEU OXT HXT sing N N 143 LYS N CA sing N N 144 LYS N H sing N N 145 LYS N H2 sing N N 146 LYS CA C sing N N 147 LYS CA CB sing N N 148 LYS CA HA sing N N 149 LYS C O doub N N 150 LYS C OXT sing N N 151 LYS CB CG sing N N 152 LYS CB HB2 sing N N 153 LYS CB HB3 sing N N 154 LYS CG CD sing N N 155 LYS CG HG2 sing N N 156 LYS CG HG3 sing N N 157 LYS CD CE sing N N 158 LYS CD HD2 sing N N 159 LYS CD HD3 sing N N 160 LYS CE NZ sing N N 161 LYS CE HE2 sing N N 162 LYS CE HE3 sing N N 163 LYS NZ HZ1 sing N N 164 LYS NZ HZ2 sing N N 165 LYS NZ HZ3 sing N N 166 LYS OXT HXT sing N N 167 MET N CA sing N N 168 MET N H sing N N 169 MET N H2 sing N N 170 MET CA C sing N N 171 MET CA CB sing N N 172 MET CA HA sing N N 173 MET C O doub N N 174 MET C OXT sing N N 175 MET CB CG sing N N 176 MET CB HB2 sing N N 177 MET CB HB3 sing N N 178 MET CG SD sing N N 179 MET CG HG2 sing N N 180 MET CG HG3 sing N N 181 MET SD CE sing N N 182 MET CE HE1 sing N N 183 MET CE HE2 sing N N 184 MET CE HE3 sing N N 185 MET OXT HXT sing N N 186 SER N CA sing N N 187 SER N H sing N N 188 SER N H2 sing N N 189 SER CA C sing N N 190 SER CA CB sing N N 191 SER CA HA sing N N 192 SER C O doub N N 193 SER C OXT sing N N 194 SER CB OG sing N N 195 SER CB HB2 sing N N 196 SER CB HB3 sing N N 197 SER OG HG sing N N 198 SER OXT HXT sing N N 199 TRP N CA sing N N 200 TRP N H sing N N 201 TRP N H2 sing N N 202 TRP CA C sing N N 203 TRP CA CB sing N N 204 TRP CA HA sing N N 205 TRP C O doub N N 206 TRP C OXT sing N N 207 TRP CB CG sing N N 208 TRP CB HB2 sing N N 209 TRP CB HB3 sing N N 210 TRP CG CD1 doub Y N 211 TRP CG CD2 sing Y N 212 TRP CD1 NE1 sing Y N 213 TRP CD1 HD1 sing N N 214 TRP CD2 CE2 doub Y N 215 TRP CD2 CE3 sing Y N 216 TRP NE1 CE2 sing Y N 217 TRP NE1 HE1 sing N N 218 TRP CE2 CZ2 sing Y N 219 TRP CE3 CZ3 doub Y N 220 TRP CE3 HE3 sing N N 221 TRP CZ2 CH2 doub Y N 222 TRP CZ2 HZ2 sing N N 223 TRP CZ3 CH2 sing Y N 224 TRP CZ3 HZ3 sing N N 225 TRP CH2 HH2 sing N N 226 TRP OXT HXT sing N N 227 TYR N CA sing N N 228 TYR N H sing N N 229 TYR N H2 sing N N 230 TYR CA C sing N N 231 TYR CA CB sing N N 232 TYR CA HA sing N N 233 TYR C O doub N N 234 TYR C OXT sing N N 235 TYR CB CG sing N N 236 TYR CB HB2 sing N N 237 TYR CB HB3 sing N N 238 TYR CG CD1 doub Y N 239 TYR CG CD2 sing Y N 240 TYR CD1 CE1 sing Y N 241 TYR CD1 HD1 sing N N 242 TYR CD2 CE2 doub Y N 243 TYR CD2 HD2 sing N N 244 TYR CE1 CZ doub Y N 245 TYR CE1 HE1 sing N N 246 TYR CE2 CZ sing Y N 247 TYR CE2 HE2 sing N N 248 TYR CZ OH sing N N 249 TYR OH HH sing N N 250 TYR OXT HXT sing N N 251 VAL N CA sing N N 252 VAL N H sing N N 253 VAL N H2 sing N N 254 VAL CA C sing N N 255 VAL CA CB sing N N 256 VAL CA HA sing N N 257 VAL C O doub N N 258 VAL C OXT sing N N 259 VAL CB CG1 sing N N 260 VAL CB CG2 sing N N 261 VAL CB HB sing N N 262 VAL CG1 HG11 sing N N 263 VAL CG1 HG12 sing N N 264 VAL CG1 HG13 sing N N 265 VAL CG2 HG21 sing N N 266 VAL CG2 HG22 sing N N 267 VAL CG2 HG23 sing N N 268 VAL OXT HXT sing N N 269 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Department of Defense (DOD, United States)' 'United States' FA8750-17-C-0219 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' HHSN272201700059C 2 'Howard Hughes Medical Institute (HHMI)' 'United States' DB 3 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' ACB-12002 4 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'AGM-12006, P30GM138396' 5 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'S10 OD012289' 6 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details model # _space_group.name_H-M_alt 'R 3 2 :H' _space_group.name_Hall ;R 3 2" ; _space_group.IT_number 155 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 7S5B _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010843 _atom_sites.fract_transf_matrix[1][2] 0.006260 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012520 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009222 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_