data_7SF0 # _entry.id 7SF0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7SF0 pdb_00007sf0 10.2210/pdb7sf0/pdb WWPDB D_1000260149 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-03-30 2 'Structure model' 1 1 2022-05-18 3 'Structure model' 1 2 2023-10-18 4 'Structure model' 2 0 2024-02-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Atomic model' 5 4 'Structure model' 'Author supporting evidence' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Non-polymer description' 9 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' pdbx_initial_refinement_model 5 4 'Structure model' atom_site 6 4 'Structure model' chem_comp 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 4 'Structure model' entity 10 4 'Structure model' pdbx_entity_instance_feature 11 4 'Structure model' pdbx_entity_nonpoly 12 4 'Structure model' pdbx_nonpoly_scheme 13 4 'Structure model' pdbx_struct_conn_angle 14 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 4 'Structure model' '_atom_site.auth_comp_id' 4 4 'Structure model' '_atom_site.label_comp_id' 5 4 'Structure model' '_chem_comp.formula' 6 4 'Structure model' '_chem_comp.formula_weight' 7 4 'Structure model' '_chem_comp.id' 8 4 'Structure model' '_chem_comp.mon_nstd_flag' 9 4 'Structure model' '_chem_comp.name' 10 4 'Structure model' '_chem_comp.type' 11 4 'Structure model' '_chem_comp_atom.atom_id' 12 4 'Structure model' '_chem_comp_atom.comp_id' 13 4 'Structure model' '_chem_comp_atom.pdbx_aromatic_flag' 14 4 'Structure model' '_chem_comp_atom.pdbx_stereo_config' 15 4 'Structure model' '_chem_comp_atom.type_symbol' 16 4 'Structure model' '_chem_comp_bond.atom_id_1' 17 4 'Structure model' '_chem_comp_bond.atom_id_2' 18 4 'Structure model' '_chem_comp_bond.comp_id' 19 4 'Structure model' '_chem_comp_bond.pdbx_aromatic_flag' 20 4 'Structure model' '_chem_comp_bond.value_order' 21 4 'Structure model' '_entity.pdbx_description' 22 4 'Structure model' '_pdbx_entity_instance_feature.auth_comp_id' 23 4 'Structure model' '_pdbx_entity_instance_feature.comp_id' 24 4 'Structure model' '_pdbx_entity_nonpoly.comp_id' 25 4 'Structure model' '_pdbx_entity_nonpoly.name' 26 4 'Structure model' '_pdbx_nonpoly_scheme.mon_id' 27 4 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id' 28 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 29 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 30 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 31 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 32 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 33 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7SF0 _pdbx_database_status.recvd_initial_deposition_date 2021-10-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details '7SEZ contains the same protein in complex with m7GDP' _pdbx_database_related.db_id 7SEZ _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email jdgross@cgl.ucsf.edu _pdbx_contact_author.name_first John _pdbx_contact_author.name_last Gross _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1377-4705 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Peters, J.K.' 1 0000-0003-3541-7431 'Tibble, R.W.' 2 ? 'Warminski, M.' 3 ? 'Jemielity, J.' 4 ? 'Gross, J.D.' 5 0000-0002-1377-4705 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 30 _citation.language ? _citation.page_first 721 _citation.page_last ? _citation.title 'Structure of the poxvirus decapping enzyme D9 reveals its mechanism of cap recognition and catalysis.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2022.02.012 _citation.pdbx_database_id_PubMed 35290794 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Peters, J.K.' 1 ? primary 'Tibble, R.W.' 2 ? primary 'Warminski, M.' 3 ? primary 'Jemielity, J.' 4 ? primary 'Gross, J.D.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA repair NTP-phosphohydrolase' 26102.078 1 ? ? ? ? 2 non-polymer syn "7N-METHYL-8-HYDROGUANOSINE-5'-DIPHOSPHATE" 458.235 1 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 5 water nat water 18.015 169 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MutT motif/mRNA decapping enzyme,NTP-phosphohydrolase,Putative D9R' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGITMDEEVIFETPRELISIKRIKDIPRSKDTHVFAACITSDGYPLIGARRTSFAFQAILSQQNSDSIFRVSTKLLRFMY YNELREIFRRLRKGSINNIDPHFEELILLGGKLDKKESIKDCLRRELKEESDERITVKEFGNVILKLTTRDKLFNKVYIG YCMACFINQSLEDLSHTSIYNVEIRKIKSLNDCINDDKYEYLSYIYNMLVNSKLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGITMDEEVIFETPRELISIKRIKDIPRSKDTHVFAACITSDGYPLIGARRTSFAFQAILSQQNSDSIFRVSTKLLRFMY YNELREIFRRLRKGSINNIDPHFEELILLGGKLDKKESIKDCLRRELKEESDERITVKEFGNVILKLTTRDKLFNKVYIG YCMACFINQSLEDLSHTSIYNVEIRKIKSLNDCINDDKYEYLSYIYNMLVNSKLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "7N-METHYL-8-HYDROGUANOSINE-5'-DIPHOSPHATE" M7G 3 'SODIUM ION' NA 4 'MAGNESIUM ION' MG 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ILE n 1 4 THR n 1 5 MET n 1 6 ASP n 1 7 GLU n 1 8 GLU n 1 9 VAL n 1 10 ILE n 1 11 PHE n 1 12 GLU n 1 13 THR n 1 14 PRO n 1 15 ARG n 1 16 GLU n 1 17 LEU n 1 18 ILE n 1 19 SER n 1 20 ILE n 1 21 LYS n 1 22 ARG n 1 23 ILE n 1 24 LYS n 1 25 ASP n 1 26 ILE n 1 27 PRO n 1 28 ARG n 1 29 SER n 1 30 LYS n 1 31 ASP n 1 32 THR n 1 33 HIS n 1 34 VAL n 1 35 PHE n 1 36 ALA n 1 37 ALA n 1 38 CYS n 1 39 ILE n 1 40 THR n 1 41 SER n 1 42 ASP n 1 43 GLY n 1 44 TYR n 1 45 PRO n 1 46 LEU n 1 47 ILE n 1 48 GLY n 1 49 ALA n 1 50 ARG n 1 51 ARG n 1 52 THR n 1 53 SER n 1 54 PHE n 1 55 ALA n 1 56 PHE n 1 57 GLN n 1 58 ALA n 1 59 ILE n 1 60 LEU n 1 61 SER n 1 62 GLN n 1 63 GLN n 1 64 ASN n 1 65 SER n 1 66 ASP n 1 67 SER n 1 68 ILE n 1 69 PHE n 1 70 ARG n 1 71 VAL n 1 72 SER n 1 73 THR n 1 74 LYS n 1 75 LEU n 1 76 LEU n 1 77 ARG n 1 78 PHE n 1 79 MET n 1 80 TYR n 1 81 TYR n 1 82 ASN n 1 83 GLU n 1 84 LEU n 1 85 ARG n 1 86 GLU n 1 87 ILE n 1 88 PHE n 1 89 ARG n 1 90 ARG n 1 91 LEU n 1 92 ARG n 1 93 LYS n 1 94 GLY n 1 95 SER n 1 96 ILE n 1 97 ASN n 1 98 ASN n 1 99 ILE n 1 100 ASP n 1 101 PRO n 1 102 HIS n 1 103 PHE n 1 104 GLU n 1 105 GLU n 1 106 LEU n 1 107 ILE n 1 108 LEU n 1 109 LEU n 1 110 GLY n 1 111 GLY n 1 112 LYS n 1 113 LEU n 1 114 ASP n 1 115 LYS n 1 116 LYS n 1 117 GLU n 1 118 SER n 1 119 ILE n 1 120 LYS n 1 121 ASP n 1 122 CYS n 1 123 LEU n 1 124 ARG n 1 125 ARG n 1 126 GLU n 1 127 LEU n 1 128 LYS n 1 129 GLU n 1 130 GLU n 1 131 SER n 1 132 ASP n 1 133 GLU n 1 134 ARG n 1 135 ILE n 1 136 THR n 1 137 VAL n 1 138 LYS n 1 139 GLU n 1 140 PHE n 1 141 GLY n 1 142 ASN n 1 143 VAL n 1 144 ILE n 1 145 LEU n 1 146 LYS n 1 147 LEU n 1 148 THR n 1 149 THR n 1 150 ARG n 1 151 ASP n 1 152 LYS n 1 153 LEU n 1 154 PHE n 1 155 ASN n 1 156 LYS n 1 157 VAL n 1 158 TYR n 1 159 ILE n 1 160 GLY n 1 161 TYR n 1 162 CYS n 1 163 MET n 1 164 ALA n 1 165 CYS n 1 166 PHE n 1 167 ILE n 1 168 ASN n 1 169 GLN n 1 170 SER n 1 171 LEU n 1 172 GLU n 1 173 ASP n 1 174 LEU n 1 175 SER n 1 176 HIS n 1 177 THR n 1 178 SER n 1 179 ILE n 1 180 TYR n 1 181 ASN n 1 182 VAL n 1 183 GLU n 1 184 ILE n 1 185 ARG n 1 186 LYS n 1 187 ILE n 1 188 LYS n 1 189 SER n 1 190 LEU n 1 191 ASN n 1 192 ASP n 1 193 CYS n 1 194 ILE n 1 195 ASN n 1 196 ASP n 1 197 ASP n 1 198 LYS n 1 199 TYR n 1 200 GLU n 1 201 TYR n 1 202 LEU n 1 203 SER n 1 204 TYR n 1 205 ILE n 1 206 TYR n 1 207 ASN n 1 208 MET n 1 209 LEU n 1 210 VAL n 1 211 ASN n 1 212 SER n 1 213 LYS n 1 214 LEU n 1 215 GLU n 1 216 HIS n 1 217 HIS n 1 218 HIS n 1 219 HIS n 1 220 HIS n 1 221 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 221 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ;D9R, VACV_BRZ_SERRO2_112, VACV_CTGV_ALEH2_114, VACV_CTGV_CG04_114, VACV_CTGV_MI233-114, VACV_CTGV_VI04_114, VAC_IHDW1_116, VAC_TKT3_104, VAC_TKT4_104, VAC_TP3_119, VAC_TP5_119, VACV_CTGV_CM01_114, VACV_TT10_141, VACV_TT11_141, VACV_TT12_141, VACV_TT8_141, VACV_TT9_141 ; _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Vaccinia virus Western Reserve' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 696871 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 M7G non-polymer . "7N-METHYL-8-HYDROGUANOSINE-5'-DIPHOSPHATE" ? 'C11 H18 N5 O11 P2 1' 458.235 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 ILE 3 3 ? ? ? A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 CYS 122 122 122 CYS CYS A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 ASN 142 142 142 ASN ASN A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 ARG 150 150 150 ARG ARG A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 TYR 158 158 158 TYR TYR A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 TYR 161 161 161 TYR TYR A . n A 1 162 CYS 162 162 162 CYS CYS A . n A 1 163 MET 163 163 163 MET MET A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 CYS 165 165 165 CYS CYS A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 ASN 168 168 168 ASN ASN A . n A 1 169 GLN 169 169 169 GLN GLN A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 ASP 173 173 173 ASP ASP A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 HIS 176 176 176 HIS HIS A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 TYR 180 180 180 TYR TYR A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 ILE 184 184 184 ILE ILE A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 ASN 191 191 191 ASN ASN A . n A 1 192 ASP 192 192 192 ASP ASP A . n A 1 193 CYS 193 193 193 CYS CYS A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 ASN 195 195 195 ASN ASN A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 LYS 198 198 198 LYS LYS A . n A 1 199 TYR 199 199 199 TYR TYR A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 TYR 201 201 201 TYR TYR A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 TYR 204 204 204 TYR TYR A . n A 1 205 ILE 205 205 205 ILE ILE A . n A 1 206 TYR 206 206 206 TYR TYR A . n A 1 207 ASN 207 207 207 ASN ASN A . n A 1 208 MET 208 208 208 MET MET A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 ASN 211 211 211 ASN ASN A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 LYS 213 213 ? ? ? A . n A 1 214 LEU 214 214 ? ? ? A . n A 1 215 GLU 215 215 ? ? ? A . n A 1 216 HIS 216 216 ? ? ? A . n A 1 217 HIS 217 217 ? ? ? A . n A 1 218 HIS 218 218 ? ? ? A . n A 1 219 HIS 219 219 ? ? ? A . n A 1 220 HIS 220 220 ? ? ? A . n A 1 221 HIS 221 221 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 M7G 1 301 1 M7G M7G A . C 3 NA 1 302 1 NA NA A . D 4 MG 1 303 1 MG MG A . E 4 MG 1 304 2 MG MG A . F 5 HOH 1 401 106 HOH HOH A . F 5 HOH 2 402 74 HOH HOH A . F 5 HOH 3 403 88 HOH HOH A . F 5 HOH 4 404 160 HOH HOH A . F 5 HOH 5 405 96 HOH HOH A . F 5 HOH 6 406 136 HOH HOH A . F 5 HOH 7 407 111 HOH HOH A . F 5 HOH 8 408 25 HOH HOH A . F 5 HOH 9 409 120 HOH HOH A . F 5 HOH 10 410 36 HOH HOH A . F 5 HOH 11 411 68 HOH HOH A . F 5 HOH 12 412 173 HOH HOH A . F 5 HOH 13 413 95 HOH HOH A . F 5 HOH 14 414 76 HOH HOH A . F 5 HOH 15 415 159 HOH HOH A . F 5 HOH 16 416 56 HOH HOH A . F 5 HOH 17 417 161 HOH HOH A . F 5 HOH 18 418 30 HOH HOH A . F 5 HOH 19 419 82 HOH HOH A . F 5 HOH 20 420 57 HOH HOH A . F 5 HOH 21 421 37 HOH HOH A . F 5 HOH 22 422 73 HOH HOH A . F 5 HOH 23 423 18 HOH HOH A . F 5 HOH 24 424 169 HOH HOH A . F 5 HOH 25 425 148 HOH HOH A . F 5 HOH 26 426 51 HOH HOH A . F 5 HOH 27 427 27 HOH HOH A . F 5 HOH 28 428 163 HOH HOH A . F 5 HOH 29 429 125 HOH HOH A . F 5 HOH 30 430 63 HOH HOH A . F 5 HOH 31 431 35 HOH HOH A . F 5 HOH 32 432 166 HOH HOH A . F 5 HOH 33 433 1 HOH HOH A . F 5 HOH 34 434 20 HOH HOH A . F 5 HOH 35 435 11 HOH HOH A . F 5 HOH 36 436 64 HOH HOH A . F 5 HOH 37 437 171 HOH HOH A . F 5 HOH 38 438 28 HOH HOH A . F 5 HOH 39 439 5 HOH HOH A . F 5 HOH 40 440 146 HOH HOH A . F 5 HOH 41 441 145 HOH HOH A . F 5 HOH 42 442 4 HOH HOH A . F 5 HOH 43 443 86 HOH HOH A . F 5 HOH 44 444 80 HOH HOH A . F 5 HOH 45 445 114 HOH HOH A . F 5 HOH 46 446 107 HOH HOH A . F 5 HOH 47 447 7 HOH HOH A . F 5 HOH 48 448 21 HOH HOH A . F 5 HOH 49 449 117 HOH HOH A . F 5 HOH 50 450 47 HOH HOH A . F 5 HOH 51 451 83 HOH HOH A . F 5 HOH 52 452 139 HOH HOH A . F 5 HOH 53 453 6 HOH HOH A . F 5 HOH 54 454 102 HOH HOH A . F 5 HOH 55 455 10 HOH HOH A . F 5 HOH 56 456 174 HOH HOH A . F 5 HOH 57 457 67 HOH HOH A . F 5 HOH 58 458 44 HOH HOH A . F 5 HOH 59 459 52 HOH HOH A . F 5 HOH 60 460 164 HOH HOH A . F 5 HOH 61 461 40 HOH HOH A . F 5 HOH 62 462 124 HOH HOH A . F 5 HOH 63 463 157 HOH HOH A . F 5 HOH 64 464 69 HOH HOH A . F 5 HOH 65 465 13 HOH HOH A . F 5 HOH 66 466 19 HOH HOH A . F 5 HOH 67 467 32 HOH HOH A . F 5 HOH 68 468 141 HOH HOH A . F 5 HOH 69 469 31 HOH HOH A . F 5 HOH 70 470 2 HOH HOH A . F 5 HOH 71 471 54 HOH HOH A . F 5 HOH 72 472 153 HOH HOH A . F 5 HOH 73 473 17 HOH HOH A . F 5 HOH 74 474 16 HOH HOH A . F 5 HOH 75 475 147 HOH HOH A . F 5 HOH 76 476 9 HOH HOH A . F 5 HOH 77 477 22 HOH HOH A . F 5 HOH 78 478 3 HOH HOH A . F 5 HOH 79 479 142 HOH HOH A . F 5 HOH 80 480 62 HOH HOH A . F 5 HOH 81 481 130 HOH HOH A . F 5 HOH 82 482 38 HOH HOH A . F 5 HOH 83 483 59 HOH HOH A . F 5 HOH 84 484 91 HOH HOH A . F 5 HOH 85 485 41 HOH HOH A . F 5 HOH 86 486 172 HOH HOH A . F 5 HOH 87 487 162 HOH HOH A . F 5 HOH 88 488 134 HOH HOH A . F 5 HOH 89 489 14 HOH HOH A . F 5 HOH 90 490 61 HOH HOH A . F 5 HOH 91 491 46 HOH HOH A . F 5 HOH 92 492 29 HOH HOH A . F 5 HOH 93 493 34 HOH HOH A . F 5 HOH 94 494 97 HOH HOH A . F 5 HOH 95 495 152 HOH HOH A . F 5 HOH 96 496 24 HOH HOH A . F 5 HOH 97 497 143 HOH HOH A . F 5 HOH 98 498 149 HOH HOH A . F 5 HOH 99 499 84 HOH HOH A . F 5 HOH 100 500 175 HOH HOH A . F 5 HOH 101 501 12 HOH HOH A . F 5 HOH 102 502 15 HOH HOH A . F 5 HOH 103 503 128 HOH HOH A . F 5 HOH 104 504 70 HOH HOH A . F 5 HOH 105 505 23 HOH HOH A . F 5 HOH 106 506 112 HOH HOH A . F 5 HOH 107 507 93 HOH HOH A . F 5 HOH 108 508 58 HOH HOH A . F 5 HOH 109 509 26 HOH HOH A . F 5 HOH 110 510 43 HOH HOH A . F 5 HOH 111 511 89 HOH HOH A . F 5 HOH 112 512 50 HOH HOH A . F 5 HOH 113 513 151 HOH HOH A . F 5 HOH 114 514 55 HOH HOH A . F 5 HOH 115 515 33 HOH HOH A . F 5 HOH 116 516 131 HOH HOH A . F 5 HOH 117 517 75 HOH HOH A . F 5 HOH 118 518 129 HOH HOH A . F 5 HOH 119 519 87 HOH HOH A . F 5 HOH 120 520 113 HOH HOH A . F 5 HOH 121 521 123 HOH HOH A . F 5 HOH 122 522 65 HOH HOH A . F 5 HOH 123 523 167 HOH HOH A . F 5 HOH 124 524 155 HOH HOH A . F 5 HOH 125 525 49 HOH HOH A . F 5 HOH 126 526 99 HOH HOH A . F 5 HOH 127 527 53 HOH HOH A . F 5 HOH 128 528 78 HOH HOH A . F 5 HOH 129 529 8 HOH HOH A . F 5 HOH 130 530 165 HOH HOH A . F 5 HOH 131 531 48 HOH HOH A . F 5 HOH 132 532 72 HOH HOH A . F 5 HOH 133 533 156 HOH HOH A . F 5 HOH 134 534 101 HOH HOH A . F 5 HOH 135 535 98 HOH HOH A . F 5 HOH 136 536 42 HOH HOH A . F 5 HOH 137 537 85 HOH HOH A . F 5 HOH 138 538 90 HOH HOH A . F 5 HOH 139 539 60 HOH HOH A . F 5 HOH 140 540 81 HOH HOH A . F 5 HOH 141 541 119 HOH HOH A . F 5 HOH 142 542 100 HOH HOH A . F 5 HOH 143 543 109 HOH HOH A . F 5 HOH 144 544 140 HOH HOH A . F 5 HOH 145 545 94 HOH HOH A . F 5 HOH 146 546 71 HOH HOH A . F 5 HOH 147 547 104 HOH HOH A . F 5 HOH 148 548 66 HOH HOH A . F 5 HOH 149 549 45 HOH HOH A . F 5 HOH 150 550 110 HOH HOH A . F 5 HOH 151 551 170 HOH HOH A . F 5 HOH 152 552 122 HOH HOH A . F 5 HOH 153 553 150 HOH HOH A . F 5 HOH 154 554 77 HOH HOH A . F 5 HOH 155 555 116 HOH HOH A . F 5 HOH 156 556 39 HOH HOH A . F 5 HOH 157 557 138 HOH HOH A . F 5 HOH 158 558 132 HOH HOH A . F 5 HOH 159 559 121 HOH HOH A . F 5 HOH 160 560 92 HOH HOH A . F 5 HOH 161 561 115 HOH HOH A . F 5 HOH 162 562 168 HOH HOH A . F 5 HOH 163 563 158 HOH HOH A . F 5 HOH 164 564 79 HOH HOH A . F 5 HOH 165 565 154 HOH HOH A . F 5 HOH 166 566 135 HOH HOH A . F 5 HOH 167 567 133 HOH HOH A . F 5 HOH 168 568 144 HOH HOH A . F 5 HOH 169 569 127 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 115 ? CG ? A LYS 115 CG 2 1 Y 1 A LYS 115 ? CD ? A LYS 115 CD 3 1 Y 1 A LYS 115 ? CE ? A LYS 115 CE 4 1 Y 1 A LYS 115 ? NZ ? A LYS 115 NZ 5 1 Y 1 A LYS 116 ? CG ? A LYS 116 CG 6 1 Y 1 A LYS 116 ? CD ? A LYS 116 CD 7 1 Y 1 A LYS 116 ? CE ? A LYS 116 CE 8 1 Y 1 A LYS 116 ? NZ ? A LYS 116 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.0 _cell.angle_alpha_esd ? _cell.angle_beta 90.0 _cell.angle_beta_esd ? _cell.angle_gamma 90.0 _cell.angle_gamma_esd ? _cell.entry_id 7SF0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.74 _cell.length_a_esd ? _cell.length_b 139.99 _cell.length_b_esd ? _cell.length_c 76.02 _cell.length_c_esd ? _cell.volume 561261.179052 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7SF0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7SF0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.69 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.24 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'sodium sulfate, PEG3350, Bis Tris propane pH 7.5, magnesium chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-03-19 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.115869 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.115869 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 31.7254807362 _reflns.entry_id 7SF0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.95 _reflns.d_resolution_low 70 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20891 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.76 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.6 _reflns.pdbx_Rmerge_I_obs 0.08334 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.86 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.95 _reflns_shell.d_res_low 2.02 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2021 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.142 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 37.461745743 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7SF0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.95000442951 _refine.ls_d_res_low 69.995 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20889 _refine.ls_number_reflns_R_free 2000 _refine.ls_number_reflns_R_work 18889 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7469200649 _refine.ls_percent_reflns_R_free 9.57441715736 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.205288343236 _refine.ls_R_factor_R_free 0.247087454328 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.200953188538 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34831509729 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7SEZ _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.8199895987 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.24573610686 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.95000442951 _refine_hist.d_res_low 69.995 _refine_hist.number_atoms_solvent 169 _refine_hist.number_atoms_total 1918 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1717 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.00465902541968 ? 1775 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.919078613483 ? 2393 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0345373871298 ? 268 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.00355474979398 ? 300 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.6509348168 ? 675 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.95000442951 1.9988 . . 136 1284 97.8635423846 . . . 0.369328322473 . 0.28632943435 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9988 2.0528 . . 142 1339 99.7306397306 . . . 0.272690480983 . 0.237349623804 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0528 2.1132 . . 139 1318 99.7262149213 . . . 0.306818803135 . 0.224007697663 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1132 2.1814 . . 141 1332 99.7967479675 . . . 0.27073021653 . 0.200210473797 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1814 2.2594 . . 141 1331 99.72899729 . . . 0.264591572748 . 0.208623380902 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2594 2.3499 . . 141 1331 99.9321113374 . . . 0.267952618116 . 0.216598245681 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3499 2.4568 . . 143 1352 100.0 . . . 0.236836166701 . 0.198020858412 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4568 2.5864 . . 142 1338 100.0 . . . 0.280071170408 . 0.211186829034 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5864 2.7484 . . 143 1344 99.9327956989 . . . 0.258159707193 . 0.216252501415 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7484 2.9606 . . 143 1362 100.0 . . . 0.234081092868 . 0.202942162001 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9606 3.2586 . . 144 1351 100.0 . . . 0.248081596883 . 0.200954535105 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2586 3.7301 . . 145 1373 99.8684210526 . . . 0.249701861039 . 0.194098478764 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7301 4.6993 . . 146 1379 100.0 . . . 0.211245997511 . 0.168565264864 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.6993 69.995 . . 154 1455 99.9378881988 . . . 0.235906299866 . 0.208997257988 . . . . . . . . . . . # _struct.entry_id 7SF0 _struct.title 'Crystal structure of Vaccinia Virus decapping enzyme D9 in complex with trinucleotide substrate' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7SF0 _struct_keywords.text 'Nudix, decapping, mRNA cap, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code L7QJE0_9POXV _struct_ref.pdbx_db_accession L7QJE0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGITMDEEVIFETPRELISIKRIKDIPRSKDTHVFAACITSDGYPLIGARRTSFAFQAILSQQNSDSIFRVSTKLLRFMY YNELREIFRRLRKGSINNIDPHFEELILLGGKLDKKESIKDCLRRELKEESDERITVKEFGNVILKLTTRDKLFNKVYIG YCMACFINQSLEDLSHTSIYNVEIRKIKSLNDCINDDKYEYLSYIYNMLVNSK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7SF0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 213 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession L7QJE0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 213 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 213 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7SF0 LEU A 214 ? UNP L7QJE0 ? ? 'expression tag' 214 1 1 7SF0 GLU A 215 ? UNP L7QJE0 ? ? 'expression tag' 215 2 1 7SF0 HIS A 216 ? UNP L7QJE0 ? ? 'expression tag' 216 3 1 7SF0 HIS A 217 ? UNP L7QJE0 ? ? 'expression tag' 217 4 1 7SF0 HIS A 218 ? UNP L7QJE0 ? ? 'expression tag' 218 5 1 7SF0 HIS A 219 ? UNP L7QJE0 ? ? 'expression tag' 219 6 1 7SF0 HIS A 220 ? UNP L7QJE0 ? ? 'expression tag' 220 7 1 7SF0 HIS A 221 ? UNP L7QJE0 ? ? 'expression tag' 221 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 53 ? GLN A 62 ? SER A 53 GLN A 62 1 ? 10 HELX_P HELX_P2 AA2 SER A 72 ? MET A 79 ? SER A 72 MET A 79 5 ? 8 HELX_P HELX_P3 AA3 TYR A 80 ? ARG A 89 ? TYR A 80 ARG A 89 1 ? 10 HELX_P HELX_P4 AA4 SER A 118 ? SER A 131 ? SER A 118 SER A 131 1 ? 14 HELX_P HELX_P5 AA5 LEU A 171 ? SER A 175 ? LEU A 171 SER A 175 5 ? 5 HELX_P HELX_P6 AA6 ASN A 191 ? CYS A 193 ? ASN A 191 CYS A 193 5 ? 3 HELX_P HELX_P7 AA7 LYS A 198 ? ASN A 211 ? LYS A 198 ASN A 211 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 100 OD2 ? ? ? 1_555 C NA . NA ? ? A ASP 100 A NA 302 3_454 ? ? ? ? ? ? ? 2.835 ? ? metalc2 metalc ? ? A GLU 126 OE1 ? ? ? 1_555 E MG . MG ? ? A GLU 126 A MG 304 1_555 ? ? ? ? ? ? ? 2.245 ? ? metalc3 metalc ? ? A GLU 130 OE2 ? ? ? 1_555 E MG . MG ? ? A GLU 130 A MG 304 1_555 ? ? ? ? ? ? ? 2.249 ? ? metalc4 metalc ? ? A GLU 183 OE2 ? ? ? 1_555 E MG . MG ? ? A GLU 183 A MG 304 1_555 ? ? ? ? ? ? ? 2.231 ? ? metalc5 metalc ? ? B M7G . O1A ? ? ? 1_555 D MG . MG ? ? A M7G 301 A MG 303 1_555 ? ? ? ? ? ? ? 2.493 ? ? metalc6 metalc ? ? B M7G . O3B ? ? ? 1_555 D MG . MG ? ? A M7G 301 A MG 303 1_555 ? ? ? ? ? ? ? 1.996 ? ? metalc7 metalc ? ? C NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 302 A HOH 449 1_555 ? ? ? ? ? ? ? 2.318 ? ? metalc8 metalc ? ? C NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 302 A HOH 461 1_555 ? ? ? ? ? ? ? 2.265 ? ? metalc9 metalc ? ? C NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 302 A HOH 551 1_555 ? ? ? ? ? ? ? 2.838 ? ? metalc10 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 304 A HOH 414 1_555 ? ? ? ? ? ? ? 2.125 ? ? metalc11 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 304 A HOH 444 1_555 ? ? ? ? ? ? ? 2.176 ? ? metalc12 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 304 A HOH 473 1_555 ? ? ? ? ? ? ? 2.024 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 100 ? A ASP 100 ? 1_555 NA ? C NA . ? A NA 302 ? 3_454 O ? F HOH . ? A HOH 449 ? 1_555 32.7 ? 2 OD2 ? A ASP 100 ? A ASP 100 ? 1_555 NA ? C NA . ? A NA 302 ? 3_454 O ? F HOH . ? A HOH 461 ? 1_555 40.6 ? 3 O ? F HOH . ? A HOH 449 ? 1_555 NA ? C NA . ? A NA 302 ? 3_454 O ? F HOH . ? A HOH 461 ? 1_555 10.9 ? 4 OD2 ? A ASP 100 ? A ASP 100 ? 1_555 NA ? C NA . ? A NA 302 ? 3_454 O ? F HOH . ? A HOH 551 ? 1_555 40.8 ? 5 O ? F HOH . ? A HOH 449 ? 1_555 NA ? C NA . ? A NA 302 ? 3_454 O ? F HOH . ? A HOH 551 ? 1_555 8.2 ? 6 O ? F HOH . ? A HOH 461 ? 1_555 NA ? C NA . ? A NA 302 ? 3_454 O ? F HOH . ? A HOH 551 ? 1_555 10.2 ? 7 OE1 ? A GLU 126 ? A GLU 126 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 OE2 ? A GLU 130 ? A GLU 130 ? 1_555 101.7 ? 8 OE1 ? A GLU 126 ? A GLU 126 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 OE2 ? A GLU 183 ? A GLU 183 ? 1_555 148.6 ? 9 OE2 ? A GLU 130 ? A GLU 130 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 OE2 ? A GLU 183 ? A GLU 183 ? 1_555 76.4 ? 10 OE1 ? A GLU 126 ? A GLU 126 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 414 ? 1_555 97.4 ? 11 OE2 ? A GLU 130 ? A GLU 130 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 414 ? 1_555 154.0 ? 12 OE2 ? A GLU 183 ? A GLU 183 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 414 ? 1_555 96.1 ? 13 OE1 ? A GLU 126 ? A GLU 126 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 444 ? 1_555 78.6 ? 14 OE2 ? A GLU 130 ? A GLU 130 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 444 ? 1_555 112.1 ? 15 OE2 ? A GLU 183 ? A GLU 183 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 444 ? 1_555 73.5 ? 16 O ? F HOH . ? A HOH 414 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 444 ? 1_555 88.8 ? 17 OE1 ? A GLU 126 ? A GLU 126 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 473 ? 1_555 107.2 ? 18 OE2 ? A GLU 130 ? A GLU 130 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 473 ? 1_555 81.2 ? 19 OE2 ? A GLU 183 ? A GLU 183 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 473 ? 1_555 103.6 ? 20 O ? F HOH . ? A HOH 414 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 473 ? 1_555 76.4 ? 21 O ? F HOH . ? A HOH 444 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 473 ? 1_555 164.6 ? 22 O1A ? B M7G . ? A M7G 301 ? 1_555 MG ? D MG . ? A MG 303 ? 1_555 O3B ? B M7G . ? A M7G 301 ? 1_555 79.4 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 8 ? GLU A 12 ? GLU A 8 GLU A 12 AA1 2 GLU A 16 ? ILE A 23 ? GLU A 16 ILE A 23 AA1 3 VAL A 137 ? ASP A 151 ? VAL A 137 ASP A 151 AA1 4 LYS A 156 ? ILE A 167 ? LYS A 156 ILE A 167 AA1 5 HIS A 33 ? ILE A 39 ? HIS A 33 ILE A 39 AA1 6 LEU A 109 ? LYS A 112 ? LEU A 109 LYS A 112 AA2 1 LEU A 106 ? ILE A 107 ? LEU A 106 ILE A 107 AA2 2 LEU A 46 ? ARG A 50 ? LEU A 46 ARG A 50 AA2 3 ILE A 184 ? SER A 189 ? ILE A 184 SER A 189 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 11 ? N PHE A 11 O ILE A 18 ? O ILE A 18 AA1 2 3 N LEU A 17 ? N LEU A 17 O ARG A 150 ? O ARG A 150 AA1 3 4 N GLU A 139 ? N GLU A 139 O PHE A 166 ? O PHE A 166 AA1 4 5 O TYR A 161 ? O TYR A 161 N PHE A 35 ? N PHE A 35 AA1 5 6 N VAL A 34 ? N VAL A 34 O GLY A 111 ? O GLY A 111 AA2 1 2 O ILE A 107 ? O ILE A 107 N GLY A 48 ? N GLY A 48 AA2 2 3 N ALA A 49 ? N ALA A 49 O ARG A 185 ? O ARG A 185 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 27 ? ? -68.77 89.57 2 1 SER A 29 ? ? -172.08 -165.78 3 1 ASN A 64 ? ? -156.78 24.63 4 1 LYS A 116 ? ? -91.11 31.88 5 1 ASN A 211 ? ? -110.66 57.85 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 415 ? F HOH . 2 1 A HOH 495 ? F HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # _pdbx_entry_details.entry_id 7SF0 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A ILE 3 ? A ILE 3 4 1 Y 1 A LYS 213 ? A LYS 213 5 1 Y 1 A LEU 214 ? A LEU 214 6 1 Y 1 A GLU 215 ? A GLU 215 7 1 Y 1 A HIS 216 ? A HIS 216 8 1 Y 1 A HIS 217 ? A HIS 217 9 1 Y 1 A HIS 218 ? A HIS 218 10 1 Y 1 A HIS 219 ? A HIS 219 11 1 Y 1 A HIS 220 ? A HIS 220 12 1 Y 1 A HIS 221 ? A HIS 221 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 M7G PA P N N 230 M7G O1A O N N 231 M7G O2A O N N 232 M7G O3A O N N 233 M7G "O5'" O N N 234 M7G PB P N N 235 M7G O1B O N N 236 M7G O2B O N N 237 M7G O3B O N N 238 M7G "C5'" C N N 239 M7G "C4'" C N R 240 M7G "O4'" O N N 241 M7G "C3'" C N S 242 M7G "O3'" O N N 243 M7G "C2'" C N R 244 M7G "O2'" O N N 245 M7G "C1'" C N R 246 M7G N9 N Y N 247 M7G C8 C Y N 248 M7G N7 N Y N 249 M7G CM7 C N N 250 M7G C5 C Y N 251 M7G C6 C N N 252 M7G O6 O N N 253 M7G N1 N N N 254 M7G C2 C N N 255 M7G N2 N N N 256 M7G N3 N N N 257 M7G C4 C Y N 258 M7G HOA2 H N N 259 M7G HOB2 H N N 260 M7G HOB3 H N N 261 M7G "H5'1" H N N 262 M7G "H5'2" H N N 263 M7G "H4'" H N N 264 M7G "H3'" H N N 265 M7G "HO3'" H N N 266 M7G "H2'" H N N 267 M7G "HO2'" H N N 268 M7G "H1'" H N N 269 M7G H81 H N N 270 M7G HM71 H N N 271 M7G HM72 H N N 272 M7G HM73 H N N 273 M7G HN1 H N N 274 M7G HN21 H N N 275 M7G HN22 H N N 276 MET N N N N 277 MET CA C N S 278 MET C C N N 279 MET O O N N 280 MET CB C N N 281 MET CG C N N 282 MET SD S N N 283 MET CE C N N 284 MET OXT O N N 285 MET H H N N 286 MET H2 H N N 287 MET HA H N N 288 MET HB2 H N N 289 MET HB3 H N N 290 MET HG2 H N N 291 MET HG3 H N N 292 MET HE1 H N N 293 MET HE2 H N N 294 MET HE3 H N N 295 MET HXT H N N 296 MG MG MG N N 297 NA NA NA N N 298 PHE N N N N 299 PHE CA C N S 300 PHE C C N N 301 PHE O O N N 302 PHE CB C N N 303 PHE CG C Y N 304 PHE CD1 C Y N 305 PHE CD2 C Y N 306 PHE CE1 C Y N 307 PHE CE2 C Y N 308 PHE CZ C Y N 309 PHE OXT O N N 310 PHE H H N N 311 PHE H2 H N N 312 PHE HA H N N 313 PHE HB2 H N N 314 PHE HB3 H N N 315 PHE HD1 H N N 316 PHE HD2 H N N 317 PHE HE1 H N N 318 PHE HE2 H N N 319 PHE HZ H N N 320 PHE HXT H N N 321 PRO N N N N 322 PRO CA C N S 323 PRO C C N N 324 PRO O O N N 325 PRO CB C N N 326 PRO CG C N N 327 PRO CD C N N 328 PRO OXT O N N 329 PRO H H N N 330 PRO HA H N N 331 PRO HB2 H N N 332 PRO HB3 H N N 333 PRO HG2 H N N 334 PRO HG3 H N N 335 PRO HD2 H N N 336 PRO HD3 H N N 337 PRO HXT H N N 338 SER N N N N 339 SER CA C N S 340 SER C C N N 341 SER O O N N 342 SER CB C N N 343 SER OG O N N 344 SER OXT O N N 345 SER H H N N 346 SER H2 H N N 347 SER HA H N N 348 SER HB2 H N N 349 SER HB3 H N N 350 SER HG H N N 351 SER HXT H N N 352 THR N N N N 353 THR CA C N S 354 THR C C N N 355 THR O O N N 356 THR CB C N R 357 THR OG1 O N N 358 THR CG2 C N N 359 THR OXT O N N 360 THR H H N N 361 THR H2 H N N 362 THR HA H N N 363 THR HB H N N 364 THR HG1 H N N 365 THR HG21 H N N 366 THR HG22 H N N 367 THR HG23 H N N 368 THR HXT H N N 369 TYR N N N N 370 TYR CA C N S 371 TYR C C N N 372 TYR O O N N 373 TYR CB C N N 374 TYR CG C Y N 375 TYR CD1 C Y N 376 TYR CD2 C Y N 377 TYR CE1 C Y N 378 TYR CE2 C Y N 379 TYR CZ C Y N 380 TYR OH O N N 381 TYR OXT O N N 382 TYR H H N N 383 TYR H2 H N N 384 TYR HA H N N 385 TYR HB2 H N N 386 TYR HB3 H N N 387 TYR HD1 H N N 388 TYR HD2 H N N 389 TYR HE1 H N N 390 TYR HE2 H N N 391 TYR HH H N N 392 TYR HXT H N N 393 VAL N N N N 394 VAL CA C N S 395 VAL C C N N 396 VAL O O N N 397 VAL CB C N N 398 VAL CG1 C N N 399 VAL CG2 C N N 400 VAL OXT O N N 401 VAL H H N N 402 VAL H2 H N N 403 VAL HA H N N 404 VAL HB H N N 405 VAL HG11 H N N 406 VAL HG12 H N N 407 VAL HG13 H N N 408 VAL HG21 H N N 409 VAL HG22 H N N 410 VAL HG23 H N N 411 VAL HXT H N N 412 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 M7G PA O1A doub N N 218 M7G PA O2A sing N N 219 M7G PA O3A sing N N 220 M7G PA "O5'" sing N N 221 M7G O2A HOA2 sing N N 222 M7G O3A PB sing N N 223 M7G "O5'" "C5'" sing N N 224 M7G PB O1B doub N N 225 M7G PB O2B sing N N 226 M7G PB O3B sing N N 227 M7G O2B HOB2 sing N N 228 M7G O3B HOB3 sing N N 229 M7G "C5'" "C4'" sing N N 230 M7G "C5'" "H5'1" sing N N 231 M7G "C5'" "H5'2" sing N N 232 M7G "C4'" "O4'" sing N N 233 M7G "C4'" "C3'" sing N N 234 M7G "C4'" "H4'" sing N N 235 M7G "O4'" "C1'" sing N N 236 M7G "C3'" "O3'" sing N N 237 M7G "C3'" "C2'" sing N N 238 M7G "C3'" "H3'" sing N N 239 M7G "O3'" "HO3'" sing N N 240 M7G "C2'" "O2'" sing N N 241 M7G "C2'" "C1'" sing N N 242 M7G "C2'" "H2'" sing N N 243 M7G "O2'" "HO2'" sing N N 244 M7G "C1'" N9 sing N N 245 M7G "C1'" "H1'" sing N N 246 M7G N9 C8 sing Y N 247 M7G N9 C4 sing Y N 248 M7G C8 N7 doub Y N 249 M7G C8 H81 sing N N 250 M7G N7 CM7 sing N N 251 M7G N7 C5 sing Y N 252 M7G CM7 HM71 sing N N 253 M7G CM7 HM72 sing N N 254 M7G CM7 HM73 sing N N 255 M7G C5 C6 sing N N 256 M7G C5 C4 doub Y N 257 M7G C6 O6 doub N N 258 M7G C6 N1 sing N N 259 M7G N1 C2 sing N N 260 M7G N1 HN1 sing N N 261 M7G C2 N2 sing N N 262 M7G C2 N3 doub N N 263 M7G N2 HN21 sing N N 264 M7G N2 HN22 sing N N 265 M7G N3 C4 sing N N 266 MET N CA sing N N 267 MET N H sing N N 268 MET N H2 sing N N 269 MET CA C sing N N 270 MET CA CB sing N N 271 MET CA HA sing N N 272 MET C O doub N N 273 MET C OXT sing N N 274 MET CB CG sing N N 275 MET CB HB2 sing N N 276 MET CB HB3 sing N N 277 MET CG SD sing N N 278 MET CG HG2 sing N N 279 MET CG HG3 sing N N 280 MET SD CE sing N N 281 MET CE HE1 sing N N 282 MET CE HE2 sing N N 283 MET CE HE3 sing N N 284 MET OXT HXT sing N N 285 PHE N CA sing N N 286 PHE N H sing N N 287 PHE N H2 sing N N 288 PHE CA C sing N N 289 PHE CA CB sing N N 290 PHE CA HA sing N N 291 PHE C O doub N N 292 PHE C OXT sing N N 293 PHE CB CG sing N N 294 PHE CB HB2 sing N N 295 PHE CB HB3 sing N N 296 PHE CG CD1 doub Y N 297 PHE CG CD2 sing Y N 298 PHE CD1 CE1 sing Y N 299 PHE CD1 HD1 sing N N 300 PHE CD2 CE2 doub Y N 301 PHE CD2 HD2 sing N N 302 PHE CE1 CZ doub Y N 303 PHE CE1 HE1 sing N N 304 PHE CE2 CZ sing Y N 305 PHE CE2 HE2 sing N N 306 PHE CZ HZ sing N N 307 PHE OXT HXT sing N N 308 PRO N CA sing N N 309 PRO N CD sing N N 310 PRO N H sing N N 311 PRO CA C sing N N 312 PRO CA CB sing N N 313 PRO CA HA sing N N 314 PRO C O doub N N 315 PRO C OXT sing N N 316 PRO CB CG sing N N 317 PRO CB HB2 sing N N 318 PRO CB HB3 sing N N 319 PRO CG CD sing N N 320 PRO CG HG2 sing N N 321 PRO CG HG3 sing N N 322 PRO CD HD2 sing N N 323 PRO CD HD3 sing N N 324 PRO OXT HXT sing N N 325 SER N CA sing N N 326 SER N H sing N N 327 SER N H2 sing N N 328 SER CA C sing N N 329 SER CA CB sing N N 330 SER CA HA sing N N 331 SER C O doub N N 332 SER C OXT sing N N 333 SER CB OG sing N N 334 SER CB HB2 sing N N 335 SER CB HB3 sing N N 336 SER OG HG sing N N 337 SER OXT HXT sing N N 338 THR N CA sing N N 339 THR N H sing N N 340 THR N H2 sing N N 341 THR CA C sing N N 342 THR CA CB sing N N 343 THR CA HA sing N N 344 THR C O doub N N 345 THR C OXT sing N N 346 THR CB OG1 sing N N 347 THR CB CG2 sing N N 348 THR CB HB sing N N 349 THR OG1 HG1 sing N N 350 THR CG2 HG21 sing N N 351 THR CG2 HG22 sing N N 352 THR CG2 HG23 sing N N 353 THR OXT HXT sing N N 354 TYR N CA sing N N 355 TYR N H sing N N 356 TYR N H2 sing N N 357 TYR CA C sing N N 358 TYR CA CB sing N N 359 TYR CA HA sing N N 360 TYR C O doub N N 361 TYR C OXT sing N N 362 TYR CB CG sing N N 363 TYR CB HB2 sing N N 364 TYR CB HB3 sing N N 365 TYR CG CD1 doub Y N 366 TYR CG CD2 sing Y N 367 TYR CD1 CE1 sing Y N 368 TYR CD1 HD1 sing N N 369 TYR CD2 CE2 doub Y N 370 TYR CD2 HD2 sing N N 371 TYR CE1 CZ doub Y N 372 TYR CE1 HE1 sing N N 373 TYR CE2 CZ sing Y N 374 TYR CE2 HE2 sing N N 375 TYR CZ OH sing N N 376 TYR OH HH sing N N 377 TYR OXT HXT sing N N 378 VAL N CA sing N N 379 VAL N H sing N N 380 VAL N H2 sing N N 381 VAL CA C sing N N 382 VAL CA CB sing N N 383 VAL CA HA sing N N 384 VAL C O doub N N 385 VAL C OXT sing N N 386 VAL CB CG1 sing N N 387 VAL CB CG2 sing N N 388 VAL CB HB sing N N 389 VAL CG1 HG11 sing N N 390 VAL CG1 HG12 sing N N 391 VAL CG1 HG13 sing N N 392 VAL CG2 HG21 sing N N 393 VAL CG2 HG22 sing N N 394 VAL CG2 HG23 sing N N 395 VAL OXT HXT sing N N 396 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 2R01GM078360 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 5F32GM133084 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id M7G _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id M7G _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7SEZ _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 7SF0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018961 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007143 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013154 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 2.59044 63.03566 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? NA ? ? ? ? ? ? ? ? ? NA1+ ? ? 9.95753 ? 4.19129 ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 1.42069 35.72801 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_