data_7TB5 # _entry.id 7TB5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.358 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7TB5 pdb_00007tb5 10.2210/pdb7tb5/pdb WWPDB D_1000261970 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7TB5 _pdbx_database_status.recvd_initial_deposition_date 2021-12-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Blankenchip, C.L.' 1 ? 'Nguyen, J.V.' 2 ? 'Lau, R.K.' 3 ? 'Ye, Q.' 4 ? 'Corbett, K.D.' 5 0000-0001-5854-2388 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? UK ? ? primary 'Nucleic Acids Res.' NARHAD 0389 1362-4962 ? ? 50 ? 5239 5250 'Control of bacterial immune signaling by a WYL domain transcription factor.' 2022 ? 10.1093/nar/gkac343 35536256 ? ? ? ? ? ? ? ? ? US ? ? 1 Biorxiv ? ? ? ? ? ? ? ? ? 'Control of bacterial anti-phage signaling by a WYL domain transcription factor' 2022 ? 10.1101/2022.01.04.474952 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Blankenchip, C.L.' 1 ? primary 'Nguyen, J.V.' 2 ? primary 'Lau, R.K.' 3 ? primary 'Ye, Q.' 4 ? primary 'Gu, Y.' 5 ? primary 'Corbett, K.D.' 6 ? 1 'Blankenchip, C.L.' 7 ? 1 'Nguyen, J.V.' 8 ? 1 'Lau, R.K.' 9 ? 1 'Ye, Q.' 10 ? 1 'Gu, Y.' 11 ? 1 'Corbett, K.D.' 12 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7TB5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 87.657 _cell.length_a_esd ? _cell.length_b 87.657 _cell.length_b_esd ? _cell.length_c 199.699 _cell.length_c_esd ? _cell.volume 1328861.527 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7TB5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall 'P 61 2 (x,y,z+5/12)' _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'WYL domain-containing protein' 34824.598 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 water nat water 18.015 15 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)TDESKPTDDQPTSKGRQGARWGQERRLEFIDYRLRWDGQINRSSLTDFFGISVPQASLDITEYAKLAESNLEYDT RARVYRATESFKAVFPSSAVERYLDDLLRVAVQPEIPYGSFLGWQSPVAAVPKLGRRLNADIVGVILRAIRETGFIEVFY QSLTDPEGGER(MSE)LSPHALVHDGNRWHVRAYCHKRKAFRDFSLTRIKCCKYVGQDRDRADEDYAWNT(MSE)VNVVL TPHPGLTPAQRKLIENDFL(MSE)EGGE(MSE)HVECRRALLLYLLFQLNLNEDQADQRPEVIQLALKNRDEIKDLIQY ; _entity_poly.pdbx_seq_one_letter_code_can ;MTDESKPTDDQPTSKGRQGARWGQERRLEFIDYRLRWDGQINRSSLTDFFGISVPQASLDITEYAKLAESNLEYDTRARV YRATESFKAVFPSSAVERYLDDLLRVAVQPEIPYGSFLGWQSPVAAVPKLGRRLNADIVGVILRAIRETGFIEVFYQSLT DPEGGERMLSPHALVHDGNRWHVRAYCHKRKAFRDFSLTRIKCCKYVGQDRDRADEDYAWNTMVNVVLTPHPGLTPAQRK LIENDFLMEGGEMHVECRRALLLYLLFQLNLNEDQADQRPEVIQLALKNRDEIKDLIQY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 THR n 1 3 ASP n 1 4 GLU n 1 5 SER n 1 6 LYS n 1 7 PRO n 1 8 THR n 1 9 ASP n 1 10 ASP n 1 11 GLN n 1 12 PRO n 1 13 THR n 1 14 SER n 1 15 LYS n 1 16 GLY n 1 17 ARG n 1 18 GLN n 1 19 GLY n 1 20 ALA n 1 21 ARG n 1 22 TRP n 1 23 GLY n 1 24 GLN n 1 25 GLU n 1 26 ARG n 1 27 ARG n 1 28 LEU n 1 29 GLU n 1 30 PHE n 1 31 ILE n 1 32 ASP n 1 33 TYR n 1 34 ARG n 1 35 LEU n 1 36 ARG n 1 37 TRP n 1 38 ASP n 1 39 GLY n 1 40 GLN n 1 41 ILE n 1 42 ASN n 1 43 ARG n 1 44 SER n 1 45 SER n 1 46 LEU n 1 47 THR n 1 48 ASP n 1 49 PHE n 1 50 PHE n 1 51 GLY n 1 52 ILE n 1 53 SER n 1 54 VAL n 1 55 PRO n 1 56 GLN n 1 57 ALA n 1 58 SER n 1 59 LEU n 1 60 ASP n 1 61 ILE n 1 62 THR n 1 63 GLU n 1 64 TYR n 1 65 ALA n 1 66 LYS n 1 67 LEU n 1 68 ALA n 1 69 GLU n 1 70 SER n 1 71 ASN n 1 72 LEU n 1 73 GLU n 1 74 TYR n 1 75 ASP n 1 76 THR n 1 77 ARG n 1 78 ALA n 1 79 ARG n 1 80 VAL n 1 81 TYR n 1 82 ARG n 1 83 ALA n 1 84 THR n 1 85 GLU n 1 86 SER n 1 87 PHE n 1 88 LYS n 1 89 ALA n 1 90 VAL n 1 91 PHE n 1 92 PRO n 1 93 SER n 1 94 SER n 1 95 ALA n 1 96 VAL n 1 97 GLU n 1 98 ARG n 1 99 TYR n 1 100 LEU n 1 101 ASP n 1 102 ASP n 1 103 LEU n 1 104 LEU n 1 105 ARG n 1 106 VAL n 1 107 ALA n 1 108 VAL n 1 109 GLN n 1 110 PRO n 1 111 GLU n 1 112 ILE n 1 113 PRO n 1 114 TYR n 1 115 GLY n 1 116 SER n 1 117 PHE n 1 118 LEU n 1 119 GLY n 1 120 TRP n 1 121 GLN n 1 122 SER n 1 123 PRO n 1 124 VAL n 1 125 ALA n 1 126 ALA n 1 127 VAL n 1 128 PRO n 1 129 LYS n 1 130 LEU n 1 131 GLY n 1 132 ARG n 1 133 ARG n 1 134 LEU n 1 135 ASN n 1 136 ALA n 1 137 ASP n 1 138 ILE n 1 139 VAL n 1 140 GLY n 1 141 VAL n 1 142 ILE n 1 143 LEU n 1 144 ARG n 1 145 ALA n 1 146 ILE n 1 147 ARG n 1 148 GLU n 1 149 THR n 1 150 GLY n 1 151 PHE n 1 152 ILE n 1 153 GLU n 1 154 VAL n 1 155 PHE n 1 156 TYR n 1 157 GLN n 1 158 SER n 1 159 LEU n 1 160 THR n 1 161 ASP n 1 162 PRO n 1 163 GLU n 1 164 GLY n 1 165 GLY n 1 166 GLU n 1 167 ARG n 1 168 MSE n 1 169 LEU n 1 170 SER n 1 171 PRO n 1 172 HIS n 1 173 ALA n 1 174 LEU n 1 175 VAL n 1 176 HIS n 1 177 ASP n 1 178 GLY n 1 179 ASN n 1 180 ARG n 1 181 TRP n 1 182 HIS n 1 183 VAL n 1 184 ARG n 1 185 ALA n 1 186 TYR n 1 187 CYS n 1 188 HIS n 1 189 LYS n 1 190 ARG n 1 191 LYS n 1 192 ALA n 1 193 PHE n 1 194 ARG n 1 195 ASP n 1 196 PHE n 1 197 SER n 1 198 LEU n 1 199 THR n 1 200 ARG n 1 201 ILE n 1 202 LYS n 1 203 CYS n 1 204 CYS n 1 205 LYS n 1 206 TYR n 1 207 VAL n 1 208 GLY n 1 209 GLN n 1 210 ASP n 1 211 ARG n 1 212 ASP n 1 213 ARG n 1 214 ALA n 1 215 ASP n 1 216 GLU n 1 217 ASP n 1 218 TYR n 1 219 ALA n 1 220 TRP n 1 221 ASN n 1 222 THR n 1 223 MSE n 1 224 VAL n 1 225 ASN n 1 226 VAL n 1 227 VAL n 1 228 LEU n 1 229 THR n 1 230 PRO n 1 231 HIS n 1 232 PRO n 1 233 GLY n 1 234 LEU n 1 235 THR n 1 236 PRO n 1 237 ALA n 1 238 GLN n 1 239 ARG n 1 240 LYS n 1 241 LEU n 1 242 ILE n 1 243 GLU n 1 244 ASN n 1 245 ASP n 1 246 PHE n 1 247 LEU n 1 248 MSE n 1 249 GLU n 1 250 GLY n 1 251 GLY n 1 252 GLU n 1 253 MSE n 1 254 HIS n 1 255 VAL n 1 256 GLU n 1 257 CYS n 1 258 ARG n 1 259 ARG n 1 260 ALA n 1 261 LEU n 1 262 LEU n 1 263 LEU n 1 264 TYR n 1 265 LEU n 1 266 LEU n 1 267 PHE n 1 268 GLN n 1 269 LEU n 1 270 ASN n 1 271 LEU n 1 272 ASN n 1 273 GLU n 1 274 ASP n 1 275 GLN n 1 276 ALA n 1 277 ASP n 1 278 GLN n 1 279 ARG n 1 280 PRO n 1 281 GLU n 1 282 VAL n 1 283 ILE n 1 284 GLN n 1 285 LEU n 1 286 ALA n 1 287 LEU n 1 288 LYS n 1 289 ASN n 1 290 ARG n 1 291 ASP n 1 292 GLU n 1 293 ILE n 1 294 LYS n 1 295 ASP n 1 296 LEU n 1 297 ILE n 1 298 GLN n 1 299 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 299 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene IPC1598_30725 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A8B4ZAA2_PSEAI _struct_ref.pdbx_db_accession A0A8B4ZAA2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTDESKPTDDQPTSKGRQGARWGQERRLEFIDYRLRWDGQINRSSLTDFFGISVPQASLDITEYAKLAESNLEYDTRARV YRATESFKAVFPSSAVERYLDDLLRVAVQPEIPYGSFLGWQSPVAAVPKLGRRLNADIVGVILRAIRETGFIEVFYQSLT DPEGGERMLSPHALVHDGNRWHVRAYCHKRKAFRDFSLTRIKCCKYVGQDRDRADEDYAWNTMVNVVLTPHPGLTPAQRK LIENDFLMEGGEMHVECRRALLLYLLFQLNLNEDQADQRPEVIQLALKNRDEIKDLIQY ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7TB5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 299 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A8B4ZAA2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 299 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 299 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7TB5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.20 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.58 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.27 M LiSO4, 1% PEG 400, and 0.1 M sodium acetate (pH 5.0)' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-08-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 55.98 _reflns.entry_id 7TB5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.30 _reflns.d_resolution_low 99.85 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21112 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.1 _reflns.pdbx_Rmerge_I_obs 0.111 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.114 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.38 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1990 _reflns_shell.percent_possible_all 98.9 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.549 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 19.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.618 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.897 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 70.47 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7TB5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 60.43 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20964 _refine.ls_number_reflns_R_free 1878 _refine.ls_number_reflns_R_work 36243 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.48 _refine.ls_percent_reflns_R_free 4.93 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2241 _refine.ls_R_factor_R_free 0.2481 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2229 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.44 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.9296 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3101 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 60.43 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 2161 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2136 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0086 ? 2186 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8734 ? 2956 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0495 ? 322 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0080 ? 384 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.7973 ? 812 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.30 2.36 . . 124 2752 97.72 . . . 0.3505 . 0.3428 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.36 2.43 . . 113 2822 99.59 . . . 0.3633 . 0.3092 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.43 2.51 . . 126 2805 99.05 . . . 0.3090 . 0.3164 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.51 2.60 . . 161 2764 99.66 . . . 0.2877 . 0.2797 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.60 2.70 . . 120 2803 99.49 . . . 0.3055 . 0.2941 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.70 2.82 . . 169 2775 99.26 . . . 0.3986 . 0.2859 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.82 2.97 . . 142 2779 99.62 . . . 0.2600 . 0.2760 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.97 3.16 . . 133 2818 99.83 . . . 0.2951 . 0.2446 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.16 3.40 . . 153 2795 99.90 . . . 0.2797 . 0.2462 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.40 3.74 . . 152 2781 99.83 . . . 0.2727 . 0.2131 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.74 4.28 . . 169 2777 100.00 . . . 0.2202 . 0.1867 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.29 5.40 . . 161 2785 99.97 . . . 0.1936 . 0.1748 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.40 60.43 . . 155 2787 99.39 . . . 0.2204 . 0.2112 . . . . . . . . . . . # _struct.entry_id 7TB5 _struct.title 'Structure of P. aeruginosa PA17 CapW' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7TB5 _struct_keywords.text 'helix-turn-helix, winged helix, WYL, transcription factor, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 16 ? ASP A 38 ? GLY A 16 ASP A 38 1 ? 23 HELX_P HELX_P2 AA2 ASN A 42 ? GLY A 51 ? ASN A 42 GLY A 51 1 ? 10 HELX_P HELX_P3 AA3 SER A 53 ? ALA A 68 ? SER A 53 ALA A 68 1 ? 16 HELX_P HELX_P4 AA4 PHE A 91 ? GLU A 97 ? PHE A 91 GLU A 97 5 ? 7 HELX_P HELX_P5 AA5 ARG A 98 ? ALA A 107 ? ARG A 98 ALA A 107 1 ? 10 HELX_P HELX_P6 AA6 ASN A 135 ? THR A 149 ? ASN A 135 THR A 149 1 ? 15 HELX_P HELX_P7 AA7 ARG A 213 ? GLU A 216 ? ARG A 213 GLU A 216 5 ? 4 HELX_P HELX_P8 AA8 ASP A 217 ? THR A 222 ? ASP A 217 THR A 222 1 ? 6 HELX_P HELX_P9 AA9 THR A 235 ? PHE A 246 ? THR A 235 PHE A 246 1 ? 12 HELX_P HELX_P10 AB1 LEU A 261 ? LEU A 269 ? LEU A 261 LEU A 269 1 ? 9 HELX_P HELX_P11 AB2 PRO A 280 ? LEU A 285 ? PRO A 280 LEU A 285 5 ? 6 HELX_P HELX_P12 AB3 ASN A 289 ? LEU A 296 ? ASN A 289 LEU A 296 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ARG 167 C ? ? ? 1_555 A MSE 168 N ? ? A ARG 167 A MSE 168 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale2 covale both ? A MSE 168 C ? ? ? 1_555 A LEU 169 N ? ? A MSE 168 A LEU 169 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale3 covale both ? A THR 222 C ? ? ? 1_555 A MSE 223 N ? ? A THR 222 A MSE 223 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale4 covale both ? A MSE 223 C ? ? ? 1_555 A VAL 224 N ? ? A MSE 223 A VAL 224 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale5 covale both ? A LEU 247 C ? ? ? 1_555 A MSE 248 N ? ? A LEU 247 A MSE 248 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale6 covale both ? A MSE 248 C ? ? ? 1_555 A GLU 249 N ? ? A MSE 248 A GLU 249 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale7 covale both ? A GLU 252 C ? ? ? 1_555 A MSE 253 N ? ? A GLU 252 A MSE 253 1_555 ? ? ? ? ? ? ? 1.319 ? ? covale8 covale both ? A MSE 253 C ? ? ? 1_555 A HIS 254 N ? ? A MSE 253 A HIS 254 1_555 ? ? ? ? ? ? ? 1.333 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 40 ? ILE A 41 ? GLN A 40 ILE A 41 AA1 2 VAL A 80 ? ALA A 83 ? VAL A 80 ALA A 83 AA1 3 LEU A 72 ? ASP A 75 ? LEU A 72 ASP A 75 AA2 1 ALA A 192 ? SER A 197 ? ALA A 192 SER A 197 AA2 2 ARG A 180 ? CYS A 187 ? ARG A 180 CYS A 187 AA2 3 GLY A 165 ? ASP A 177 ? GLY A 165 ASP A 177 AA2 4 GLY A 150 ? TYR A 156 ? GLY A 150 TYR A 156 AA2 5 ILE A 201 ? GLN A 209 ? ILE A 201 GLN A 209 AA3 1 MSE A 223 ? LEU A 228 ? MSE A 223 LEU A 228 AA3 2 MSE A 253 ? ARG A 258 ? MSE A 253 ARG A 258 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 41 ? N ILE A 41 O TYR A 81 ? O TYR A 81 AA1 2 3 O VAL A 80 ? O VAL A 80 N ASP A 75 ? N ASP A 75 AA2 1 2 O ALA A 192 ? O ALA A 192 N CYS A 187 ? N CYS A 187 AA2 2 3 O ARG A 180 ? O ARG A 180 N ASP A 177 ? N ASP A 177 AA2 3 4 O LEU A 169 ? O LEU A 169 N ILE A 152 ? N ILE A 152 AA2 4 5 N GLU A 153 ? N GLU A 153 O LYS A 205 ? O LYS A 205 AA3 1 2 N VAL A 224 ? N VAL A 224 O CYS A 257 ? O CYS A 257 # _atom_sites.entry_id 7TB5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011408 _atom_sites.fract_transf_matrix[1][2] 0.006586 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013173 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005008 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? SE ? ? 26.02326 7.89457 ? ? 1.54240 29.12501 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 PRO 7 7 ? ? ? A . n A 1 8 THR 8 8 ? ? ? A . n A 1 9 ASP 9 9 ? ? ? A . n A 1 10 ASP 10 10 ? ? ? A . n A 1 11 GLN 11 11 ? ? ? A . n A 1 12 PRO 12 12 ? ? ? A . n A 1 13 THR 13 13 ? ? ? A . n A 1 14 SER 14 14 ? ? ? A . n A 1 15 LYS 15 15 ? ? ? A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 VAL 108 108 ? ? ? A . n A 1 109 GLN 109 109 ? ? ? A . n A 1 110 PRO 110 110 ? ? ? A . n A 1 111 GLU 111 111 ? ? ? A . n A 1 112 ILE 112 112 ? ? ? A . n A 1 113 PRO 113 113 ? ? ? A . n A 1 114 TYR 114 114 ? ? ? A . n A 1 115 GLY 115 115 ? ? ? A . n A 1 116 SER 116 116 ? ? ? A . n A 1 117 PHE 117 117 ? ? ? A . n A 1 118 LEU 118 118 ? ? ? A . n A 1 119 GLY 119 119 ? ? ? A . n A 1 120 TRP 120 120 ? ? ? A . n A 1 121 GLN 121 121 ? ? ? A . n A 1 122 SER 122 122 ? ? ? A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 TYR 156 156 156 TYR TYR A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 PRO 162 162 162 PRO PRO A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 MSE 168 168 168 MSE MSE A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 PRO 171 171 171 PRO PRO A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 HIS 176 176 176 HIS HIS A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 ASN 179 179 179 ASN ASN A . n A 1 180 ARG 180 180 180 ARG ARG A . n A 1 181 TRP 181 181 181 TRP TRP A . n A 1 182 HIS 182 182 182 HIS HIS A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 CYS 187 187 187 CYS CYS A . n A 1 188 HIS 188 188 188 HIS HIS A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 PHE 193 193 193 PHE PHE A . n A 1 194 ARG 194 194 194 ARG ARG A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 PHE 196 196 196 PHE PHE A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 ARG 200 200 200 ARG ARG A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 LYS 202 202 202 LYS LYS A . n A 1 203 CYS 203 203 203 CYS CYS A . n A 1 204 CYS 204 204 204 CYS CYS A . n A 1 205 LYS 205 205 205 LYS LYS A . n A 1 206 TYR 206 206 206 TYR TYR A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 GLY 208 208 208 GLY GLY A . n A 1 209 GLN 209 209 209 GLN GLN A . n A 1 210 ASP 210 210 210 ASP ASP A . n A 1 211 ARG 211 211 211 ARG ARG A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 ARG 213 213 213 ARG ARG A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 ASP 215 215 215 ASP ASP A . n A 1 216 GLU 216 216 216 GLU GLU A . n A 1 217 ASP 217 217 217 ASP ASP A . n A 1 218 TYR 218 218 218 TYR TYR A . n A 1 219 ALA 219 219 219 ALA ALA A . n A 1 220 TRP 220 220 220 TRP TRP A . n A 1 221 ASN 221 221 221 ASN ASN A . n A 1 222 THR 222 222 222 THR THR A . n A 1 223 MSE 223 223 223 MSE MSE A . n A 1 224 VAL 224 224 224 VAL VAL A . n A 1 225 ASN 225 225 225 ASN ASN A . n A 1 226 VAL 226 226 226 VAL VAL A . n A 1 227 VAL 227 227 227 VAL VAL A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 THR 229 229 229 THR THR A . n A 1 230 PRO 230 230 230 PRO PRO A . n A 1 231 HIS 231 231 231 HIS HIS A . n A 1 232 PRO 232 232 232 PRO PRO A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 THR 235 235 235 THR THR A . n A 1 236 PRO 236 236 236 PRO PRO A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 GLN 238 238 238 GLN GLN A . n A 1 239 ARG 239 239 239 ARG ARG A . n A 1 240 LYS 240 240 240 LYS LYS A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 ILE 242 242 242 ILE ILE A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 ASN 244 244 244 ASN ASN A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 PHE 246 246 246 PHE PHE A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 MSE 248 248 248 MSE MSE A . n A 1 249 GLU 249 249 249 GLU GLU A . n A 1 250 GLY 250 250 250 GLY GLY A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 GLU 252 252 252 GLU GLU A . n A 1 253 MSE 253 253 253 MSE MSE A . n A 1 254 HIS 254 254 254 HIS HIS A . n A 1 255 VAL 255 255 255 VAL VAL A . n A 1 256 GLU 256 256 256 GLU GLU A . n A 1 257 CYS 257 257 257 CYS CYS A . n A 1 258 ARG 258 258 258 ARG ARG A . n A 1 259 ARG 259 259 259 ARG ARG A . n A 1 260 ALA 260 260 260 ALA ALA A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 LEU 262 262 262 LEU LEU A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 TYR 264 264 264 TYR TYR A . n A 1 265 LEU 265 265 265 LEU LEU A . n A 1 266 LEU 266 266 266 LEU LEU A . n A 1 267 PHE 267 267 267 PHE PHE A . n A 1 268 GLN 268 268 268 GLN GLN A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 ASN 270 270 270 ASN ASN A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 ASN 272 272 272 ASN ASN A . n A 1 273 GLU 273 273 273 GLU GLU A . n A 1 274 ASP 274 274 ? ? ? A . n A 1 275 GLN 275 275 ? ? ? A . n A 1 276 ALA 276 276 276 ALA ALA A . n A 1 277 ASP 277 277 277 ASP ASP A . n A 1 278 GLN 278 278 278 GLN GLN A . n A 1 279 ARG 279 279 279 ARG ARG A . n A 1 280 PRO 280 280 280 PRO PRO A . n A 1 281 GLU 281 281 281 GLU GLU A . n A 1 282 VAL 282 282 282 VAL VAL A . n A 1 283 ILE 283 283 283 ILE ILE A . n A 1 284 GLN 284 284 284 GLN GLN A . n A 1 285 LEU 285 285 285 LEU LEU A . n A 1 286 ALA 286 286 286 ALA ALA A . n A 1 287 LEU 287 287 287 LEU LEU A . n A 1 288 LYS 288 288 288 LYS LYS A . n A 1 289 ASN 289 289 289 ASN ASN A . n A 1 290 ARG 290 290 290 ARG ARG A . n A 1 291 ASP 291 291 291 ASP ASP A . n A 1 292 GLU 292 292 292 GLU GLU A . n A 1 293 ILE 293 293 293 ILE ILE A . n A 1 294 LYS 294 294 294 LYS LYS A . n A 1 295 ASP 295 295 295 ASP ASP A . n A 1 296 LEU 296 296 296 LEU LEU A . n A 1 297 ILE 297 297 297 ILE ILE A . n A 1 298 GLN 298 298 298 GLN GLN A . n A 1 299 TYR 299 299 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email kcorbett@ucsd.edu _pdbx_contact_author.name_first Kevin _pdbx_contact_author.name_last Corbett _pdbx_contact_author.name_mi D _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5854-2388 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 1 SO4 SO4 A . C 2 SO4 1 302 2 SO4 SO4 A . D 3 HOH 1 401 13 HOH HOH A . D 3 HOH 2 402 7 HOH HOH A . D 3 HOH 3 403 10 HOH HOH A . D 3 HOH 4 404 14 HOH HOH A . D 3 HOH 5 405 2 HOH HOH A . D 3 HOH 6 406 15 HOH HOH A . D 3 HOH 7 407 1 HOH HOH A . D 3 HOH 8 408 12 HOH HOH A . D 3 HOH 9 409 11 HOH HOH A . D 3 HOH 10 410 3 HOH HOH A . D 3 HOH 11 411 4 HOH HOH A . D 3 HOH 12 412 6 HOH HOH A . D 3 HOH 13 413 5 HOH HOH A . D 3 HOH 14 414 9 HOH HOH A . D 3 HOH 15 415 8 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 168 A MSE 168 ? MET 'modified residue' 2 A MSE 223 A MSE 223 ? MET 'modified residue' 3 A MSE 248 A MSE 248 ? MET 'modified residue' 4 A MSE 253 A MSE 253 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 10580 ? 1 MORE -109 ? 1 'SSA (A^2)' 25150 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+5/6 0.5000000000 -0.8660254038 0.0000000000 43.8285000000 -0.8660254038 -0.5000000000 0.0000000000 75.9131888195 0.0000000000 0.0000000000 -1.0000000000 166.4158333333 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id SO4 _pdbx_struct_special_symmetry.auth_seq_id 301 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id SO4 _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-01-19 2 'Structure model' 1 1 2022-05-25 3 'Structure model' 1 2 2022-06-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_volume' 2 3 'Structure model' '_citation.page_first' 3 3 'Structure model' '_citation.page_last' 4 3 'Structure model' '_citation_author.identifier_ORCID' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/6 3 y,-x+y,z+5/6 4 -y,x-y,z+1/3 5 -x+y,-x,z+2/3 6 x-y,-y,-z 7 -x,-x+y,-z+2/3 8 -x,-y,z+1/2 9 y,x,-z+1/3 10 -y,-x,-z+5/6 11 -x+y,y,-z+1/2 12 x,x-y,-z+1/6 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 40.4808182209 _pdbx_refine_tls.origin_y 20.9002614783 _pdbx_refine_tls.origin_z 86.1816488221 _pdbx_refine_tls.T[1][1] 0.44969292306 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0417063263923 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0478735075639 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.397409739964 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0338409539986 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.436575347954 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.22895461982 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.23163588789 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.0188536863588 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.831183440935 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.333171981762 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 2.37936242058 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.078711675404 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.127235157086 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.043032887249 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0595335225666 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.042011681793 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0767220313622 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.113179148765 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.240086097491 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.110214117055 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 16 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 266 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 298 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details 'chain A' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_entry_details.entry_id 7TB5 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HE A ARG 27 ? ? OD2 A ASP 60 ? ? 1.55 2 1 HH12 A ARG 211 ? ? OE2 A GLU 216 ? ? 1.55 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 98 ? CG ? A ARG 98 CG 2 1 Y 1 A ARG 98 ? CD ? A ARG 98 CD 3 1 Y 1 A ARG 98 ? NE ? A ARG 98 NE 4 1 Y 1 A ARG 98 ? CZ ? A ARG 98 CZ 5 1 Y 1 A ARG 98 ? NH1 ? A ARG 98 NH1 6 1 Y 1 A ARG 98 ? NH2 ? A ARG 98 NH2 7 1 Y 1 A GLU 249 ? CG ? A GLU 249 CG 8 1 Y 1 A GLU 249 ? CD ? A GLU 249 CD 9 1 Y 1 A GLU 249 ? OE1 ? A GLU 249 OE1 10 1 Y 1 A GLU 249 ? OE2 ? A GLU 249 OE2 11 1 Y 1 A GLU 273 ? CG ? A GLU 273 CG 12 1 Y 1 A GLU 273 ? CD ? A GLU 273 CD 13 1 Y 1 A GLU 273 ? OE1 ? A GLU 273 OE1 14 1 Y 1 A GLU 273 ? OE2 ? A GLU 273 OE2 15 1 Y 1 A ASP 277 ? CG ? A ASP 277 CG 16 1 Y 1 A ASP 277 ? OD1 ? A ASP 277 OD1 17 1 Y 1 A ASP 277 ? OD2 ? A ASP 277 OD2 18 1 Y 1 A ARG 290 ? CG ? A ARG 290 CG 19 1 Y 1 A ARG 290 ? CD ? A ARG 290 CD 20 1 Y 1 A ARG 290 ? NE ? A ARG 290 NE 21 1 Y 1 A ARG 290 ? CZ ? A ARG 290 CZ 22 1 Y 1 A ARG 290 ? NH1 ? A ARG 290 NH1 23 1 Y 1 A ARG 290 ? NH2 ? A ARG 290 NH2 24 1 Y 1 A ASP 291 ? CG ? A ASP 291 CG 25 1 Y 1 A ASP 291 ? OD1 ? A ASP 291 OD1 26 1 Y 1 A ASP 291 ? OD2 ? A ASP 291 OD2 27 1 Y 1 A LYS 294 ? CG ? A LYS 294 CG 28 1 Y 1 A LYS 294 ? CD ? A LYS 294 CD 29 1 Y 1 A LYS 294 ? CE ? A LYS 294 CE 30 1 Y 1 A LYS 294 ? NZ ? A LYS 294 NZ 31 1 Y 1 A GLN 298 ? CG ? A GLN 298 CG 32 1 Y 1 A GLN 298 ? CD ? A GLN 298 CD 33 1 Y 1 A GLN 298 ? OE1 ? A GLN 298 OE1 34 1 Y 1 A GLN 298 ? NE2 ? A GLN 298 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A PRO 7 ? A PRO 7 8 1 Y 1 A THR 8 ? A THR 8 9 1 Y 1 A ASP 9 ? A ASP 9 10 1 Y 1 A ASP 10 ? A ASP 10 11 1 Y 1 A GLN 11 ? A GLN 11 12 1 Y 1 A PRO 12 ? A PRO 12 13 1 Y 1 A THR 13 ? A THR 13 14 1 Y 1 A SER 14 ? A SER 14 15 1 Y 1 A LYS 15 ? A LYS 15 16 1 Y 1 A VAL 108 ? A VAL 108 17 1 Y 1 A GLN 109 ? A GLN 109 18 1 Y 1 A PRO 110 ? A PRO 110 19 1 Y 1 A GLU 111 ? A GLU 111 20 1 Y 1 A ILE 112 ? A ILE 112 21 1 Y 1 A PRO 113 ? A PRO 113 22 1 Y 1 A TYR 114 ? A TYR 114 23 1 Y 1 A GLY 115 ? A GLY 115 24 1 Y 1 A SER 116 ? A SER 116 25 1 Y 1 A PHE 117 ? A PHE 117 26 1 Y 1 A LEU 118 ? A LEU 118 27 1 Y 1 A GLY 119 ? A GLY 119 28 1 Y 1 A TRP 120 ? A TRP 120 29 1 Y 1 A GLN 121 ? A GLN 121 30 1 Y 1 A SER 122 ? A SER 122 31 1 Y 1 A ASP 274 ? A ASP 274 32 1 Y 1 A GLN 275 ? A GLN 275 33 1 Y 1 A TYR 299 ? A TYR 299 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'R21 AI148814' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # _pdbx_related_exp_data_set.ordinal 1 _pdbx_related_exp_data_set.data_reference 10.15785/SBGRID/869 _pdbx_related_exp_data_set.metadata_reference ? _pdbx_related_exp_data_set.data_set_type 'diffraction image data' _pdbx_related_exp_data_set.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 61 2 2' _space_group.name_Hall 'P 61 2 (x,y,z+5/12)' _space_group.IT_number 178 _space_group.crystal_system hexagonal _space_group.id 1 #