data_7UL2 # _entry.id 7UL2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.364 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7UL2 pdb_00007ul2 10.2210/pdb7ul2/pdb WWPDB D_1000264356 ? ? EMDB EMD-26589 ? ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'CryoEM Structure of Inactive NTSR1 Bound to SR48692 and Nb6' _pdbx_database_related.db_id EMD-26589 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7UL2 _pdbx_database_status.recvd_initial_deposition_date 2022-04-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Robertson, M.J.' 1 ? 'Skiniotis, G.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1545-9985 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 1188 _citation.page_last 1195 _citation.title 'Structure determination of inactive-state GPCRs with a universal nanobody.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41594-022-00859-8 _citation.pdbx_database_id_PubMed 36396979 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Robertson, M.J.' 1 0000-0003-2610-680X primary 'Papasergi-Scott, M.M.' 2 ? primary 'He, F.' 3 0000-0002-6286-8134 primary 'Seven, A.B.' 4 ? primary 'Meyerowitz, J.G.' 5 ? primary 'Panova, O.' 6 ? primary 'Peroto, M.C.' 7 ? primary 'Che, T.' 8 0000-0002-1620-3027 primary 'Skiniotis, G.' 9 0000-0003-0238-7846 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7UL2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7UL2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Neurotensin receptor 1' 47084.391 1 ? ? ? ? 2 polymer man 'Nanobody 6' 14730.255 1 ? ? ? ? 3 non-polymer syn '2-[[1-(7-chloranylquinolin-4-yl)-5-(2,6-dimethoxyphenyl)pyrazol-3-yl]carbonylamino]adamantane-2-carboxylic acid' 587.065 1 ? ? ? ? 4 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 5 water nat water 18.015 13 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'NT-R-1,NTR1,High-affinity levocabastine-insensitive neurotensin receptor,NTRH,K-OR-1,KOR-1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;DYKDDDDAMGQPGNGSAFLLAPNRSHAPDHDVENLYFQGQRAQAGLEEALLAPGFGNASGNASERVLAAPSSELDVNTDI YSKVLVTAVYLALFVVGTVGNTVTLFTLARKKSLQSLQSTVHYHLGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAG CRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAG GLVCTPTIHTATVKVVIQVNTFMSFIFPMVVISVLYTLMILRLKSVRLLSGSREKDRNLRRITRLVLAVVIAFVVCWLPY HVRRLMFCYISDEQWTPFLYDFYHYFYMVTNALFYVSSTINPILYNLVSANFRHIFLATLACLCPVWRRRRKRPAFSRKA DSVSSNHTLSSNATRETLY ; ;DYKDDDDAMGQPGNGSAFLLAPNRSHAPDHDVENLYFQGQRAQAGLEEALLAPGFGNASGNASERVLAAPSSELDVNTDI YSKVLVTAVYLALFVVGTVGNTVTLFTLARKKSLQSLQSTVHYHLGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAG CRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAG GLVCTPTIHTATVKVVIQVNTFMSFIFPMVVISVLYTLMILRLKSVRLLSGSREKDRNLRRITRLVLAVVIAFVVCWLPY HVRRLMFCYISDEQWTPFLYDFYHYFYMVTNALFYVSSTINPILYNLVSANFRHIFLATLACLCPVWRRRRKRPAFSRKA DSVSSNHTLSSNATRETLY ; R ? 2 'polypeptide(L)' no no ;MAQVQLQESGGGLVQAGESLRLSCAASGTIFRLYDMGWYRRVSGNQRELVASITSGGSTKYGDSVKGRFTISRDNAKNTV YLQMSSLKPEDTAVYYCNAEYRTGIWEELLDGWGQGTQVTVSSHHHHHHEPEA ; ;MAQVQLQESGGGLVQAGESLRLSCAASGTIFRLYDMGWYRRVSGNQRELVASITSGGSTKYGDSVKGRFTISRDNAKNTV YLQMSSLKPEDTAVYYCNAEYRTGIWEELLDGWGQGTQVTVSSHHHHHHEPEA ; D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 TYR n 1 3 LYS n 1 4 ASP n 1 5 ASP n 1 6 ASP n 1 7 ASP n 1 8 ALA n 1 9 MET n 1 10 GLY n 1 11 GLN n 1 12 PRO n 1 13 GLY n 1 14 ASN n 1 15 GLY n 1 16 SER n 1 17 ALA n 1 18 PHE n 1 19 LEU n 1 20 LEU n 1 21 ALA n 1 22 PRO n 1 23 ASN n 1 24 ARG n 1 25 SER n 1 26 HIS n 1 27 ALA n 1 28 PRO n 1 29 ASP n 1 30 HIS n 1 31 ASP n 1 32 VAL n 1 33 GLU n 1 34 ASN n 1 35 LEU n 1 36 TYR n 1 37 PHE n 1 38 GLN n 1 39 GLY n 1 40 GLN n 1 41 ARG n 1 42 ALA n 1 43 GLN n 1 44 ALA n 1 45 GLY n 1 46 LEU n 1 47 GLU n 1 48 GLU n 1 49 ALA n 1 50 LEU n 1 51 LEU n 1 52 ALA n 1 53 PRO n 1 54 GLY n 1 55 PHE n 1 56 GLY n 1 57 ASN n 1 58 ALA n 1 59 SER n 1 60 GLY n 1 61 ASN n 1 62 ALA n 1 63 SER n 1 64 GLU n 1 65 ARG n 1 66 VAL n 1 67 LEU n 1 68 ALA n 1 69 ALA n 1 70 PRO n 1 71 SER n 1 72 SER n 1 73 GLU n 1 74 LEU n 1 75 ASP n 1 76 VAL n 1 77 ASN n 1 78 THR n 1 79 ASP n 1 80 ILE n 1 81 TYR n 1 82 SER n 1 83 LYS n 1 84 VAL n 1 85 LEU n 1 86 VAL n 1 87 THR n 1 88 ALA n 1 89 VAL n 1 90 TYR n 1 91 LEU n 1 92 ALA n 1 93 LEU n 1 94 PHE n 1 95 VAL n 1 96 VAL n 1 97 GLY n 1 98 THR n 1 99 VAL n 1 100 GLY n 1 101 ASN n 1 102 THR n 1 103 VAL n 1 104 THR n 1 105 LEU n 1 106 PHE n 1 107 THR n 1 108 LEU n 1 109 ALA n 1 110 ARG n 1 111 LYS n 1 112 LYS n 1 113 SER n 1 114 LEU n 1 115 GLN n 1 116 SER n 1 117 LEU n 1 118 GLN n 1 119 SER n 1 120 THR n 1 121 VAL n 1 122 HIS n 1 123 TYR n 1 124 HIS n 1 125 LEU n 1 126 GLY n 1 127 SER n 1 128 LEU n 1 129 ALA n 1 130 LEU n 1 131 SER n 1 132 ASP n 1 133 LEU n 1 134 LEU n 1 135 THR n 1 136 LEU n 1 137 LEU n 1 138 LEU n 1 139 ALA n 1 140 MET n 1 141 PRO n 1 142 VAL n 1 143 GLU n 1 144 LEU n 1 145 TYR n 1 146 ASN n 1 147 PHE n 1 148 ILE n 1 149 TRP n 1 150 VAL n 1 151 HIS n 1 152 HIS n 1 153 PRO n 1 154 TRP n 1 155 ALA n 1 156 PHE n 1 157 GLY n 1 158 ASP n 1 159 ALA n 1 160 GLY n 1 161 CYS n 1 162 ARG n 1 163 GLY n 1 164 TYR n 1 165 TYR n 1 166 PHE n 1 167 LEU n 1 168 ARG n 1 169 ASP n 1 170 ALA n 1 171 CYS n 1 172 THR n 1 173 TYR n 1 174 ALA n 1 175 THR n 1 176 ALA n 1 177 LEU n 1 178 ASN n 1 179 VAL n 1 180 ALA n 1 181 SER n 1 182 LEU n 1 183 SER n 1 184 VAL n 1 185 GLU n 1 186 ARG n 1 187 TYR n 1 188 LEU n 1 189 ALA n 1 190 ILE n 1 191 CYS n 1 192 HIS n 1 193 PRO n 1 194 PHE n 1 195 LYS n 1 196 ALA n 1 197 LYS n 1 198 THR n 1 199 LEU n 1 200 MET n 1 201 SER n 1 202 ARG n 1 203 SER n 1 204 ARG n 1 205 THR n 1 206 LYS n 1 207 LYS n 1 208 PHE n 1 209 ILE n 1 210 SER n 1 211 ALA n 1 212 ILE n 1 213 TRP n 1 214 LEU n 1 215 ALA n 1 216 SER n 1 217 ALA n 1 218 LEU n 1 219 LEU n 1 220 ALA n 1 221 VAL n 1 222 PRO n 1 223 MET n 1 224 LEU n 1 225 PHE n 1 226 THR n 1 227 MET n 1 228 GLY n 1 229 GLU n 1 230 GLN n 1 231 ASN n 1 232 ARG n 1 233 SER n 1 234 ALA n 1 235 ASP n 1 236 GLY n 1 237 GLN n 1 238 HIS n 1 239 ALA n 1 240 GLY n 1 241 GLY n 1 242 LEU n 1 243 VAL n 1 244 CYS n 1 245 THR n 1 246 PRO n 1 247 THR n 1 248 ILE n 1 249 HIS n 1 250 THR n 1 251 ALA n 1 252 THR n 1 253 VAL n 1 254 LYS n 1 255 VAL n 1 256 VAL n 1 257 ILE n 1 258 GLN n 1 259 VAL n 1 260 ASN n 1 261 THR n 1 262 PHE n 1 263 MET n 1 264 SER n 1 265 PHE n 1 266 ILE n 1 267 PHE n 1 268 PRO n 1 269 MET n 1 270 VAL n 1 271 VAL n 1 272 ILE n 1 273 SER n 1 274 VAL n 1 275 LEU n 1 276 TYR n 1 277 THR n 1 278 LEU n 1 279 MET n 1 280 ILE n 1 281 LEU n 1 282 ARG n 1 283 LEU n 1 284 LYS n 1 285 SER n 1 286 VAL n 1 287 ARG n 1 288 LEU n 1 289 LEU n 1 290 SER n 1 291 GLY n 1 292 SER n 1 293 ARG n 1 294 GLU n 1 295 LYS n 1 296 ASP n 1 297 ARG n 1 298 ASN n 1 299 LEU n 1 300 ARG n 1 301 ARG n 1 302 ILE n 1 303 THR n 1 304 ARG n 1 305 LEU n 1 306 VAL n 1 307 LEU n 1 308 ALA n 1 309 VAL n 1 310 VAL n 1 311 ILE n 1 312 ALA n 1 313 PHE n 1 314 VAL n 1 315 VAL n 1 316 CYS n 1 317 TRP n 1 318 LEU n 1 319 PRO n 1 320 TYR n 1 321 HIS n 1 322 VAL n 1 323 ARG n 1 324 ARG n 1 325 LEU n 1 326 MET n 1 327 PHE n 1 328 CYS n 1 329 TYR n 1 330 ILE n 1 331 SER n 1 332 ASP n 1 333 GLU n 1 334 GLN n 1 335 TRP n 1 336 THR n 1 337 PRO n 1 338 PHE n 1 339 LEU n 1 340 TYR n 1 341 ASP n 1 342 PHE n 1 343 TYR n 1 344 HIS n 1 345 TYR n 1 346 PHE n 1 347 TYR n 1 348 MET n 1 349 VAL n 1 350 THR n 1 351 ASN n 1 352 ALA n 1 353 LEU n 1 354 PHE n 1 355 TYR n 1 356 VAL n 1 357 SER n 1 358 SER n 1 359 THR n 1 360 ILE n 1 361 ASN n 1 362 PRO n 1 363 ILE n 1 364 LEU n 1 365 TYR n 1 366 ASN n 1 367 LEU n 1 368 VAL n 1 369 SER n 1 370 ALA n 1 371 ASN n 1 372 PHE n 1 373 ARG n 1 374 HIS n 1 375 ILE n 1 376 PHE n 1 377 LEU n 1 378 ALA n 1 379 THR n 1 380 LEU n 1 381 ALA n 1 382 CYS n 1 383 LEU n 1 384 CYS n 1 385 PRO n 1 386 VAL n 1 387 TRP n 1 388 ARG n 1 389 ARG n 1 390 ARG n 1 391 ARG n 1 392 LYS n 1 393 ARG n 1 394 PRO n 1 395 ALA n 1 396 PHE n 1 397 SER n 1 398 ARG n 1 399 LYS n 1 400 ALA n 1 401 ASP n 1 402 SER n 1 403 VAL n 1 404 SER n 1 405 SER n 1 406 ASN n 1 407 HIS n 1 408 THR n 1 409 LEU n 1 410 SER n 1 411 SER n 1 412 ASN n 1 413 ALA n 1 414 THR n 1 415 ARG n 1 416 GLU n 1 417 THR n 1 418 LEU n 1 419 TYR n 2 1 MET n 2 2 ALA n 2 3 GLN n 2 4 VAL n 2 5 GLN n 2 6 LEU n 2 7 GLN n 2 8 GLU n 2 9 SER n 2 10 GLY n 2 11 GLY n 2 12 GLY n 2 13 LEU n 2 14 VAL n 2 15 GLN n 2 16 ALA n 2 17 GLY n 2 18 GLU n 2 19 SER n 2 20 LEU n 2 21 ARG n 2 22 LEU n 2 23 SER n 2 24 CYS n 2 25 ALA n 2 26 ALA n 2 27 SER n 2 28 GLY n 2 29 THR n 2 30 ILE n 2 31 PHE n 2 32 ARG n 2 33 LEU n 2 34 TYR n 2 35 ASP n 2 36 MET n 2 37 GLY n 2 38 TRP n 2 39 TYR n 2 40 ARG n 2 41 ARG n 2 42 VAL n 2 43 SER n 2 44 GLY n 2 45 ASN n 2 46 GLN n 2 47 ARG n 2 48 GLU n 2 49 LEU n 2 50 VAL n 2 51 ALA n 2 52 SER n 2 53 ILE n 2 54 THR n 2 55 SER n 2 56 GLY n 2 57 GLY n 2 58 SER n 2 59 THR n 2 60 LYS n 2 61 TYR n 2 62 GLY n 2 63 ASP n 2 64 SER n 2 65 VAL n 2 66 LYS n 2 67 GLY n 2 68 ARG n 2 69 PHE n 2 70 THR n 2 71 ILE n 2 72 SER n 2 73 ARG n 2 74 ASP n 2 75 ASN n 2 76 ALA n 2 77 LYS n 2 78 ASN n 2 79 THR n 2 80 VAL n 2 81 TYR n 2 82 LEU n 2 83 GLN n 2 84 MET n 2 85 SER n 2 86 SER n 2 87 LEU n 2 88 LYS n 2 89 PRO n 2 90 GLU n 2 91 ASP n 2 92 THR n 2 93 ALA n 2 94 VAL n 2 95 TYR n 2 96 TYR n 2 97 CYS n 2 98 ASN n 2 99 ALA n 2 100 GLU n 2 101 TYR n 2 102 ARG n 2 103 THR n 2 104 GLY n 2 105 ILE n 2 106 TRP n 2 107 GLU n 2 108 GLU n 2 109 LEU n 2 110 LEU n 2 111 ASP n 2 112 GLY n 2 113 TRP n 2 114 GLY n 2 115 GLN n 2 116 GLY n 2 117 THR n 2 118 GLN n 2 119 VAL n 2 120 THR n 2 121 VAL n 2 122 SER n 2 123 SER n 2 124 HIS n 2 125 HIS n 2 126 HIS n 2 127 HIS n 2 128 HIS n 2 129 HIS n 2 130 GLU n 2 131 PRO n 2 132 GLU n 2 133 ALA n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 275 human ? 'NTSR1, NTRR' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? baculovirus ? ? ? ? ? ? 1 2 sample 'Biological sequence' 276 309 human ? 'OPRK1, OPRK' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? baculovirus ? ? ? ? ? ? 1 3 sample 'Biological sequence' 310 419 human ? 'NTSR1, NTRR' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? baculovirus ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 133 ? ? ? ? ? ? ? ? ? 'Lama glama' 9844 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP NTR1_HUMAN P30989 ? 1 ;QRAQAGLEEALLAPGFGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVTAFTLARKKSLQSLQS TVHYHLGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTL MSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAGGLVCTPTIHTATVKVVIQVNTFMSFIFPMVVISVL ; 20 2 UNP OPRK_HUMAN P41145 ? 1 YTLMILRLKSVRLLSGSREKDRNLRRITRLVLVV 246 3 UNP NTR1_HUMAN P30989 ? 1 ;VIAFVVCWLPYHVRRLMFCYISDEQWTPFLYDFYHYFYMVTNALFYVSSTINPILYNLVSANFRHIFLATLACLCPVWRR RRKRPAFSRKADSVSSNHTLSSNATRETLY ; 309 4 PDB 7UL2 7UL2 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7UL2 R 40 ? 275 ? P30989 20 ? 255 ? 20 255 2 2 7UL2 R 276 ? 309 ? P41145 246 ? 279 ? 256 308 3 3 7UL2 R 310 ? 419 ? P30989 309 ? 418 ? 309 418 4 4 7UL2 D 1 ? 133 ? 7UL2 1 ? 133 ? 1 133 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7UL2 ASP R 1 ? UNP P30989 ? ? 'expression tag' -19 1 1 7UL2 TYR R 2 ? UNP P30989 ? ? 'expression tag' -18 2 1 7UL2 LYS R 3 ? UNP P30989 ? ? 'expression tag' -17 3 1 7UL2 ASP R 4 ? UNP P30989 ? ? 'expression tag' -16 4 1 7UL2 ASP R 5 ? UNP P30989 ? ? 'expression tag' -15 5 1 7UL2 ASP R 6 ? UNP P30989 ? ? 'expression tag' -14 6 1 7UL2 ASP R 7 ? UNP P30989 ? ? 'expression tag' -13 7 1 7UL2 ALA R 8 ? UNP P30989 ? ? 'expression tag' -12 8 1 7UL2 MET R 9 ? UNP P30989 ? ? 'expression tag' -11 9 1 7UL2 GLY R 10 ? UNP P30989 ? ? 'expression tag' -10 10 1 7UL2 GLN R 11 ? UNP P30989 ? ? 'expression tag' -9 11 1 7UL2 PRO R 12 ? UNP P30989 ? ? 'expression tag' -8 12 1 7UL2 GLY R 13 ? UNP P30989 ? ? 'expression tag' -7 13 1 7UL2 ASN R 14 ? UNP P30989 ? ? 'expression tag' -6 14 1 7UL2 GLY R 15 ? UNP P30989 ? ? 'expression tag' -5 15 1 7UL2 SER R 16 ? UNP P30989 ? ? 'expression tag' -4 16 1 7UL2 ALA R 17 ? UNP P30989 ? ? 'expression tag' -3 17 1 7UL2 PHE R 18 ? UNP P30989 ? ? 'expression tag' -2 18 1 7UL2 LEU R 19 ? UNP P30989 ? ? 'expression tag' -1 19 1 7UL2 LEU R 20 ? UNP P30989 ? ? 'expression tag' 0 20 1 7UL2 ALA R 21 ? UNP P30989 ? ? 'expression tag' 1 21 1 7UL2 PRO R 22 ? UNP P30989 ? ? 'expression tag' 2 22 1 7UL2 ASN R 23 ? UNP P30989 ? ? 'expression tag' 3 23 1 7UL2 ARG R 24 ? UNP P30989 ? ? 'expression tag' 4 24 1 7UL2 SER R 25 ? UNP P30989 ? ? 'expression tag' 5 25 1 7UL2 HIS R 26 ? UNP P30989 ? ? 'expression tag' 6 26 1 7UL2 ALA R 27 ? UNP P30989 ? ? 'expression tag' 7 27 1 7UL2 PRO R 28 ? UNP P30989 ? ? 'expression tag' 8 28 1 7UL2 ASP R 29 ? UNP P30989 ? ? 'expression tag' 9 29 1 7UL2 HIS R 30 ? UNP P30989 ? ? 'expression tag' 10 30 1 7UL2 ASP R 31 ? UNP P30989 ? ? 'expression tag' 11 31 1 7UL2 VAL R 32 ? UNP P30989 ? ? 'expression tag' 12 32 1 7UL2 GLU R 33 ? UNP P30989 ? ? 'expression tag' 13 33 1 7UL2 ASN R 34 ? UNP P30989 ? ? 'expression tag' 14 34 1 7UL2 LEU R 35 ? UNP P30989 ? ? 'expression tag' 15 35 1 7UL2 TYR R 36 ? UNP P30989 ? ? 'expression tag' 16 36 1 7UL2 PHE R 37 ? UNP P30989 ? ? 'expression tag' 17 37 1 7UL2 GLN R 38 ? UNP P30989 ? ? 'expression tag' 18 38 1 7UL2 GLY R 39 ? UNP P30989 ? ? 'expression tag' 19 39 1 7UL2 LEU R 105 ? UNP P30989 ALA 85 conflict 85 40 2 7UL2 ALA R 308 ? UNP P41145 VAL 278 conflict 307 41 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 Q6Q non-polymer . '2-[[1-(7-chloranylquinolin-4-yl)-5-(2,6-dimethoxyphenyl)pyrazol-3-yl]carbonylamino]adamantane-2-carboxylic acid' ? 'C32 H31 Cl N4 O5' 587.065 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7UL2 _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 7UL2 _struct.title 'CryoEM Structure of Inactive NTSR1 Bound to SR48692 and Nb6' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7UL2 _struct_keywords.text 'Antagonist, Complex, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 80 ? ARG A 110 ? ILE R 60 ARG R 90 1 ? 31 HELX_P HELX_P2 AA2 THR A 120 ? LEU A 138 ? THR R 100 LEU R 118 1 ? 19 HELX_P HELX_P3 AA3 LEU A 138 ? PHE A 147 ? LEU R 118 PHE R 127 1 ? 10 HELX_P HELX_P4 AA4 PHE A 156 ? HIS A 192 ? PHE R 136 HIS R 172 1 ? 37 HELX_P HELX_P5 AA5 HIS A 192 ? MET A 200 ? HIS R 172 MET R 180 1 ? 9 HELX_P HELX_P6 AA6 SER A 201 ? ALA A 220 ? SER R 181 ALA R 200 1 ? 20 HELX_P HELX_P7 AA7 ALA A 220 ? THR A 226 ? ALA R 200 THR R 206 1 ? 7 HELX_P HELX_P8 AA8 HIS A 249 ? PHE A 265 ? HIS R 229 PHE R 245 1 ? 17 HELX_P HELX_P9 AA9 PHE A 265 ? LYS A 284 ? PHE R 245 LYS R 264 1 ? 20 HELX_P HELX_P10 AB1 SER A 292 ? ILE A 330 ? SER R 272 ILE R 329 1 ? 39 HELX_P HELX_P11 AB2 THR A 336 ? SER A 369 ? THR R 335 SER R 368 1 ? 34 HELX_P HELX_P12 AB3 SER A 369 ? LEU A 380 ? SER R 368 LEU R 379 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 161 SG ? ? ? 1_555 A CYS 244 SG ? ? R CYS 141 R CYS 224 1_555 ? ? ? ? ? ? ? 2.050 ? ? metalc1 metalc ? ? A ASP 132 OD1 ? ? ? 1_555 D NA . NA ? ? R ASP 112 R NA 502 1_555 ? ? ? ? ? ? ? 2.385 ? ? metalc2 metalc ? ? A THR 175 OG1 ? ? ? 1_555 D NA . NA ? ? R THR 155 R NA 502 1_555 ? ? ? ? ? ? ? 2.904 ? ? metalc3 metalc ? ? D NA . NA ? ? ? 1_555 E HOH . O ? ? R NA 502 R HOH 610 1_555 ? ? ? ? ? ? ? 3.056 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id HIS _struct_mon_prot_cis.label_seq_id 152 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id HIS _struct_mon_prot_cis.auth_seq_id 132 _struct_mon_prot_cis.auth_asym_id R _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 153 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 133 _struct_mon_prot_cis.pdbx_auth_asym_id_2 R _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.46 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 227 ? ARG A 232 ? MET R 207 ARG R 212 AA1 2 GLY A 241 ? PRO A 246 ? GLY R 221 PRO R 226 AA2 1 THR B 59 ? LYS B 60 ? THR D 59 LYS D 60 AA2 2 ALA B 51 ? ILE B 53 ? ALA D 51 ILE D 53 AA2 3 ARG B 32 ? TRP B 38 ? ARG D 32 TRP D 38 AA2 4 CYS B 97 ? ARG B 102 ? CYS D 97 ARG D 102 AA2 5 LEU B 110 ? TRP B 113 ? LEU D 110 TRP D 113 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 232 ? N ARG R 212 O GLY A 241 ? O GLY R 221 AA2 1 2 O LYS B 60 ? O LYS D 60 N SER B 52 ? N SER D 52 AA2 2 3 O ILE B 53 ? O ILE D 53 N MET B 36 ? N MET D 36 AA2 3 4 N TYR B 34 ? N TYR D 34 O GLU B 100 ? O GLU D 100 AA2 4 5 N TYR B 101 ? N TYR D 101 O LEU B 110 ? O LEU D 110 # _atom_sites.entry_id 7UL2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 -19 ? ? ? R . n A 1 2 TYR 2 -18 ? ? ? R . n A 1 3 LYS 3 -17 ? ? ? R . n A 1 4 ASP 4 -16 ? ? ? R . n A 1 5 ASP 5 -15 ? ? ? R . n A 1 6 ASP 6 -14 ? ? ? R . n A 1 7 ASP 7 -13 ? ? ? R . n A 1 8 ALA 8 -12 ? ? ? R . n A 1 9 MET 9 -11 ? ? ? R . n A 1 10 GLY 10 -10 ? ? ? R . n A 1 11 GLN 11 -9 ? ? ? R . n A 1 12 PRO 12 -8 ? ? ? R . n A 1 13 GLY 13 -7 ? ? ? R . n A 1 14 ASN 14 -6 ? ? ? R . n A 1 15 GLY 15 -5 ? ? ? R . n A 1 16 SER 16 -4 ? ? ? R . n A 1 17 ALA 17 -3 ? ? ? R . n A 1 18 PHE 18 -2 ? ? ? R . n A 1 19 LEU 19 -1 ? ? ? R . n A 1 20 LEU 20 0 ? ? ? R . n A 1 21 ALA 21 1 ? ? ? R . n A 1 22 PRO 22 2 ? ? ? R . n A 1 23 ASN 23 3 ? ? ? R . n A 1 24 ARG 24 4 ? ? ? R . n A 1 25 SER 25 5 ? ? ? R . n A 1 26 HIS 26 6 ? ? ? R . n A 1 27 ALA 27 7 ? ? ? R . n A 1 28 PRO 28 8 ? ? ? R . n A 1 29 ASP 29 9 ? ? ? R . n A 1 30 HIS 30 10 ? ? ? R . n A 1 31 ASP 31 11 ? ? ? R . n A 1 32 VAL 32 12 ? ? ? R . n A 1 33 GLU 33 13 ? ? ? R . n A 1 34 ASN 34 14 ? ? ? R . n A 1 35 LEU 35 15 ? ? ? R . n A 1 36 TYR 36 16 ? ? ? R . n A 1 37 PHE 37 17 ? ? ? R . n A 1 38 GLN 38 18 ? ? ? R . n A 1 39 GLY 39 19 ? ? ? R . n A 1 40 GLN 40 20 ? ? ? R . n A 1 41 ARG 41 21 ? ? ? R . n A 1 42 ALA 42 22 ? ? ? R . n A 1 43 GLN 43 23 ? ? ? R . n A 1 44 ALA 44 24 ? ? ? R . n A 1 45 GLY 45 25 ? ? ? R . n A 1 46 LEU 46 26 ? ? ? R . n A 1 47 GLU 47 27 ? ? ? R . n A 1 48 GLU 48 28 ? ? ? R . n A 1 49 ALA 49 29 ? ? ? R . n A 1 50 LEU 50 30 ? ? ? R . n A 1 51 LEU 51 31 ? ? ? R . n A 1 52 ALA 52 32 ? ? ? R . n A 1 53 PRO 53 33 ? ? ? R . n A 1 54 GLY 54 34 ? ? ? R . n A 1 55 PHE 55 35 ? ? ? R . n A 1 56 GLY 56 36 ? ? ? R . n A 1 57 ASN 57 37 ? ? ? R . n A 1 58 ALA 58 38 ? ? ? R . n A 1 59 SER 59 39 ? ? ? R . n A 1 60 GLY 60 40 ? ? ? R . n A 1 61 ASN 61 41 ? ? ? R . n A 1 62 ALA 62 42 ? ? ? R . n A 1 63 SER 63 43 ? ? ? R . n A 1 64 GLU 64 44 ? ? ? R . n A 1 65 ARG 65 45 ? ? ? R . n A 1 66 VAL 66 46 ? ? ? R . n A 1 67 LEU 67 47 ? ? ? R . n A 1 68 ALA 68 48 ? ? ? R . n A 1 69 ALA 69 49 ? ? ? R . n A 1 70 PRO 70 50 ? ? ? R . n A 1 71 SER 71 51 ? ? ? R . n A 1 72 SER 72 52 ? ? ? R . n A 1 73 GLU 73 53 ? ? ? R . n A 1 74 LEU 74 54 ? ? ? R . n A 1 75 ASP 75 55 ? ? ? R . n A 1 76 VAL 76 56 ? ? ? R . n A 1 77 ASN 77 57 ? ? ? R . n A 1 78 THR 78 58 ? ? ? R . n A 1 79 ASP 79 59 ? ? ? R . n A 1 80 ILE 80 60 60 ILE ILE R . n A 1 81 TYR 81 61 61 TYR TYR R . n A 1 82 SER 82 62 62 SER SER R . n A 1 83 LYS 83 63 63 LYS LYS R . n A 1 84 VAL 84 64 64 VAL VAL R . n A 1 85 LEU 85 65 65 LEU LEU R . n A 1 86 VAL 86 66 66 VAL VAL R . n A 1 87 THR 87 67 67 THR THR R . n A 1 88 ALA 88 68 68 ALA ALA R . n A 1 89 VAL 89 69 69 VAL VAL R . n A 1 90 TYR 90 70 70 TYR TYR R . n A 1 91 LEU 91 71 71 LEU LEU R . n A 1 92 ALA 92 72 72 ALA ALA R . n A 1 93 LEU 93 73 73 LEU LEU R . n A 1 94 PHE 94 74 74 PHE PHE R . n A 1 95 VAL 95 75 75 VAL VAL R . n A 1 96 VAL 96 76 76 VAL VAL R . n A 1 97 GLY 97 77 77 GLY GLY R . n A 1 98 THR 98 78 78 THR THR R . n A 1 99 VAL 99 79 79 VAL VAL R . n A 1 100 GLY 100 80 80 GLY GLY R . n A 1 101 ASN 101 81 81 ASN ASN R . n A 1 102 THR 102 82 82 THR THR R . n A 1 103 VAL 103 83 83 VAL VAL R . n A 1 104 THR 104 84 84 THR THR R . n A 1 105 LEU 105 85 85 LEU LEU R . n A 1 106 PHE 106 86 86 PHE PHE R . n A 1 107 THR 107 87 87 THR THR R . n A 1 108 LEU 108 88 88 LEU LEU R . n A 1 109 ALA 109 89 89 ALA ALA R . n A 1 110 ARG 110 90 90 ARG ARG R . n A 1 111 LYS 111 91 ? ? ? R . n A 1 112 LYS 112 92 ? ? ? R . n A 1 113 SER 113 93 ? ? ? R . n A 1 114 LEU 114 94 ? ? ? R . n A 1 115 GLN 115 95 ? ? ? R . n A 1 116 SER 116 96 ? ? ? R . n A 1 117 LEU 117 97 ? ? ? R . n A 1 118 GLN 118 98 ? ? ? R . n A 1 119 SER 119 99 99 SER ALA R . n A 1 120 THR 120 100 100 THR THR R . n A 1 121 VAL 121 101 101 VAL VAL R . n A 1 122 HIS 122 102 102 HIS HIS R . n A 1 123 TYR 123 103 103 TYR TYR R . n A 1 124 HIS 124 104 104 HIS HIS R . n A 1 125 LEU 125 105 105 LEU LEU R . n A 1 126 GLY 126 106 106 GLY GLY R . n A 1 127 SER 127 107 107 SER SER R . n A 1 128 LEU 128 108 108 LEU LEU R . n A 1 129 ALA 129 109 109 ALA ALA R . n A 1 130 LEU 130 110 110 LEU LEU R . n A 1 131 SER 131 111 111 SER SER R . n A 1 132 ASP 132 112 112 ASP ASP R . n A 1 133 LEU 133 113 113 LEU LEU R . n A 1 134 LEU 134 114 114 LEU LEU R . n A 1 135 THR 135 115 115 THR THR R . n A 1 136 LEU 136 116 116 LEU LEU R . n A 1 137 LEU 137 117 117 LEU LEU R . n A 1 138 LEU 138 118 118 LEU LEU R . n A 1 139 ALA 139 119 119 ALA ALA R . n A 1 140 MET 140 120 120 MET MET R . n A 1 141 PRO 141 121 121 PRO PRO R . n A 1 142 VAL 142 122 122 VAL VAL R . n A 1 143 GLU 143 123 123 GLU GLU R . n A 1 144 LEU 144 124 124 LEU LEU R . n A 1 145 TYR 145 125 125 TYR TYR R . n A 1 146 ASN 146 126 126 ASN ASN R . n A 1 147 PHE 147 127 127 PHE PHE R . n A 1 148 ILE 148 128 128 ILE ILE R . n A 1 149 TRP 149 129 129 TRP TRP R . n A 1 150 VAL 150 130 130 VAL VAL R . n A 1 151 HIS 151 131 131 HIS HIS R . n A 1 152 HIS 152 132 132 HIS HIS R . n A 1 153 PRO 153 133 133 PRO PRO R . n A 1 154 TRP 154 134 134 TRP TRP R . n A 1 155 ALA 155 135 135 ALA ALA R . n A 1 156 PHE 156 136 136 PHE PHE R . n A 1 157 GLY 157 137 137 GLY GLY R . n A 1 158 ASP 158 138 138 ASP ASP R . n A 1 159 ALA 159 139 139 ALA ALA R . n A 1 160 GLY 160 140 140 GLY GLY R . n A 1 161 CYS 161 141 141 CYS CYS R . n A 1 162 ARG 162 142 142 ARG ARG R . n A 1 163 GLY 163 143 143 GLY GLY R . n A 1 164 TYR 164 144 144 TYR TYR R . n A 1 165 TYR 165 145 145 TYR TYR R . n A 1 166 PHE 166 146 146 PHE PHE R . n A 1 167 LEU 167 147 147 LEU LEU R . n A 1 168 ARG 168 148 148 ARG ARG R . n A 1 169 ASP 169 149 149 ASP ASP R . n A 1 170 ALA 170 150 150 ALA ALA R . n A 1 171 CYS 171 151 151 CYS CYS R . n A 1 172 THR 172 152 152 THR THR R . n A 1 173 TYR 173 153 153 TYR TYR R . n A 1 174 ALA 174 154 154 ALA ALA R . n A 1 175 THR 175 155 155 THR THR R . n A 1 176 ALA 176 156 156 ALA ALA R . n A 1 177 LEU 177 157 157 LEU LEU R . n A 1 178 ASN 178 158 158 ASN ASN R . n A 1 179 VAL 179 159 159 VAL VAL R . n A 1 180 ALA 180 160 160 ALA ALA R . n A 1 181 SER 181 161 161 SER SER R . n A 1 182 LEU 182 162 162 LEU LEU R . n A 1 183 SER 183 163 163 SER SER R . n A 1 184 VAL 184 164 164 VAL VAL R . n A 1 185 GLU 185 165 165 GLU GLU R . n A 1 186 ARG 186 166 166 ARG ARG R . n A 1 187 TYR 187 167 167 TYR TYR R . n A 1 188 LEU 188 168 168 LEU LEU R . n A 1 189 ALA 189 169 169 ALA ALA R . n A 1 190 ILE 190 170 170 ILE ILE R . n A 1 191 CYS 191 171 171 CYS CYS R . n A 1 192 HIS 192 172 172 HIS HIS R . n A 1 193 PRO 193 173 173 PRO PRO R . n A 1 194 PHE 194 174 174 PHE PHE R . n A 1 195 LYS 195 175 175 LYS LYS R . n A 1 196 ALA 196 176 176 ALA ALA R . n A 1 197 LYS 197 177 177 LYS LYS R . n A 1 198 THR 198 178 178 THR THR R . n A 1 199 LEU 199 179 179 LEU LEU R . n A 1 200 MET 200 180 180 MET MET R . n A 1 201 SER 201 181 181 SER SER R . n A 1 202 ARG 202 182 182 ARG ARG R . n A 1 203 SER 203 183 183 SER SER R . n A 1 204 ARG 204 184 184 ARG ARG R . n A 1 205 THR 205 185 185 THR THR R . n A 1 206 LYS 206 186 186 LYS LYS R . n A 1 207 LYS 207 187 187 LYS LYS R . n A 1 208 PHE 208 188 188 PHE PHE R . n A 1 209 ILE 209 189 189 ILE ILE R . n A 1 210 SER 210 190 190 SER SER R . n A 1 211 ALA 211 191 191 ALA ALA R . n A 1 212 ILE 212 192 192 ILE ILE R . n A 1 213 TRP 213 193 193 TRP TRP R . n A 1 214 LEU 214 194 194 LEU LEU R . n A 1 215 ALA 215 195 195 ALA ALA R . n A 1 216 SER 216 196 196 SER SER R . n A 1 217 ALA 217 197 197 ALA ALA R . n A 1 218 LEU 218 198 198 LEU LEU R . n A 1 219 LEU 219 199 199 LEU LEU R . n A 1 220 ALA 220 200 200 ALA ALA R . n A 1 221 VAL 221 201 201 VAL VAL R . n A 1 222 PRO 222 202 202 PRO PRO R . n A 1 223 MET 223 203 203 MET MET R . n A 1 224 LEU 224 204 204 LEU LEU R . n A 1 225 PHE 225 205 205 PHE PHE R . n A 1 226 THR 226 206 206 THR THR R . n A 1 227 MET 227 207 207 MET MET R . n A 1 228 GLY 228 208 208 GLY GLY R . n A 1 229 GLU 229 209 209 GLU GLU R . n A 1 230 GLN 230 210 210 GLN GLN R . n A 1 231 ASN 231 211 211 ASN ASN R . n A 1 232 ARG 232 212 212 ARG ARG R . n A 1 233 SER 233 213 213 SER SER R . n A 1 234 ALA 234 214 214 ALA ALA R . n A 1 235 ASP 235 215 ? ? ? R . n A 1 236 GLY 236 216 ? ? ? R . n A 1 237 GLN 237 217 ? ? ? R . n A 1 238 HIS 238 218 218 HIS HIS R . n A 1 239 ALA 239 219 219 ALA ALA R . n A 1 240 GLY 240 220 220 GLY GLY R . n A 1 241 GLY 241 221 221 GLY GLY R . n A 1 242 LEU 242 222 222 LEU LEU R . n A 1 243 VAL 243 223 223 VAL VAL R . n A 1 244 CYS 244 224 224 CYS CYS R . n A 1 245 THR 245 225 225 THR THR R . n A 1 246 PRO 246 226 226 PRO PRO R . n A 1 247 THR 247 227 227 THR THR R . n A 1 248 ILE 248 228 228 ILE ILE R . n A 1 249 HIS 249 229 229 HIS HIS R . n A 1 250 THR 250 230 230 THR THR R . n A 1 251 ALA 251 231 231 ALA ALA R . n A 1 252 THR 252 232 232 THR THR R . n A 1 253 VAL 253 233 233 VAL VAL R . n A 1 254 LYS 254 234 234 LYS LYS R . n A 1 255 VAL 255 235 235 VAL VAL R . n A 1 256 VAL 256 236 236 VAL VAL R . n A 1 257 ILE 257 237 237 ILE ILE R . n A 1 258 GLN 258 238 238 GLN GLN R . n A 1 259 VAL 259 239 239 VAL VAL R . n A 1 260 ASN 260 240 240 ASN ASN R . n A 1 261 THR 261 241 241 THR THR R . n A 1 262 PHE 262 242 242 PHE PHE R . n A 1 263 MET 263 243 243 MET MET R . n A 1 264 SER 264 244 244 SER SER R . n A 1 265 PHE 265 245 245 PHE PHE R . n A 1 266 ILE 266 246 246 ILE ILE R . n A 1 267 PHE 267 247 247 PHE PHE R . n A 1 268 PRO 268 248 248 PRO PRO R . n A 1 269 MET 269 249 249 MET MET R . n A 1 270 VAL 270 250 250 VAL VAL R . n A 1 271 VAL 271 251 251 VAL VAL R . n A 1 272 ILE 272 252 252 ILE ILE R . n A 1 273 SER 273 253 253 SER SER R . n A 1 274 VAL 274 254 254 VAL VAL R . n A 1 275 LEU 275 255 255 LEU LEU R . n A 1 276 TYR 276 256 256 TYR TYR R . n A 1 277 THR 277 257 257 THR THR R . n A 1 278 LEU 278 258 258 LEU LEU R . n A 1 279 MET 279 259 259 MET MET R . n A 1 280 ILE 280 260 260 ILE ILE R . n A 1 281 LEU 281 261 261 LEU LEU R . n A 1 282 ARG 282 262 262 ARG ARG R . n A 1 283 LEU 283 263 263 LEU LEU R . n A 1 284 LYS 284 264 264 LYS LYS R . n A 1 285 SER 285 265 265 SER SER R . n A 1 286 VAL 286 266 266 VAL VAL R . n A 1 287 ARG 287 267 267 ARG ARG R . n A 1 288 LEU 288 268 268 LEU LEU R . n A 1 289 LEU 289 269 269 LEU LEU R . n A 1 290 SER 290 270 270 SER SER R . n A 1 291 GLY 291 271 271 GLY GLY R . n A 1 292 SER 292 272 272 SER SER R . n A 1 293 ARG 293 273 273 ARG ARG R . n A 1 294 GLU 294 274 274 GLU GLU R . n A 1 295 LYS 295 294 294 LYS LYS R . n A 1 296 ASP 296 295 295 ASP ASP R . n A 1 297 ARG 297 296 296 ARG ARG R . n A 1 298 ASN 298 297 297 ASN ASN R . n A 1 299 LEU 299 298 298 LEU LEU R . n A 1 300 ARG 300 299 299 ARG ARG R . n A 1 301 ARG 301 300 300 ARG ARG R . n A 1 302 ILE 302 301 301 ILE ILE R . n A 1 303 THR 303 302 302 THR THR R . n A 1 304 ARG 304 303 303 ARG ARG R . n A 1 305 LEU 305 304 304 LEU LEU R . n A 1 306 VAL 306 305 305 VAL VAL R . n A 1 307 LEU 307 306 306 LEU LEU R . n A 1 308 ALA 308 307 307 ALA ALA R . n A 1 309 VAL 309 308 308 VAL VAL R . n A 1 310 VAL 310 309 309 VAL VAL R . n A 1 311 ILE 311 310 310 ILE ILE R . n A 1 312 ALA 312 311 311 ALA ALA R . n A 1 313 PHE 313 312 312 PHE PHE R . n A 1 314 VAL 314 313 313 VAL VAL R . n A 1 315 VAL 315 314 314 VAL VAL R . n A 1 316 CYS 316 315 315 CYS CYS R . n A 1 317 TRP 317 316 316 TRP TRP R . n A 1 318 LEU 318 317 317 LEU LEU R . n A 1 319 PRO 319 318 318 PRO PRO R . n A 1 320 TYR 320 319 319 TYR TYR R . n A 1 321 HIS 321 320 320 HIS HIS R . n A 1 322 VAL 322 321 321 VAL VAL R . n A 1 323 ARG 323 322 322 ARG ARG R . n A 1 324 ARG 324 323 323 ARG ARG R . n A 1 325 LEU 325 324 324 LEU LEU R . n A 1 326 MET 326 325 325 MET MET R . n A 1 327 PHE 327 326 326 PHE PHE R . n A 1 328 CYS 328 327 327 CYS CYS R . n A 1 329 TYR 329 328 328 TYR TYR R . n A 1 330 ILE 330 329 329 ILE ILE R . n A 1 331 SER 331 330 330 SER SER R . n A 1 332 ASP 332 331 ? ? ? R . n A 1 333 GLU 333 332 ? ? ? R . n A 1 334 GLN 334 333 ? ? ? R . n A 1 335 TRP 335 334 334 TRP TRP R . n A 1 336 THR 336 335 335 THR THR R . n A 1 337 PRO 337 336 336 PRO PRO R . n A 1 338 PHE 338 337 337 PHE PHE R . n A 1 339 LEU 339 338 338 LEU LEU R . n A 1 340 TYR 340 339 339 TYR TYR R . n A 1 341 ASP 341 340 340 ASP ASP R . n A 1 342 PHE 342 341 341 PHE PHE R . n A 1 343 TYR 343 342 342 TYR TYR R . n A 1 344 HIS 344 343 343 HIS HIS R . n A 1 345 TYR 345 344 344 TYR TYR R . n A 1 346 PHE 346 345 345 PHE PHE R . n A 1 347 TYR 347 346 346 TYR TYR R . n A 1 348 MET 348 347 347 MET MET R . n A 1 349 VAL 349 348 348 VAL VAL R . n A 1 350 THR 350 349 349 THR THR R . n A 1 351 ASN 351 350 350 ASN ASN R . n A 1 352 ALA 352 351 351 ALA ALA R . n A 1 353 LEU 353 352 352 LEU LEU R . n A 1 354 PHE 354 353 353 PHE PHE R . n A 1 355 TYR 355 354 354 TYR TYR R . n A 1 356 VAL 356 355 355 VAL VAL R . n A 1 357 SER 357 356 356 SER SER R . n A 1 358 SER 358 357 357 SER SER R . n A 1 359 THR 359 358 358 THR THR R . n A 1 360 ILE 360 359 359 ILE ILE R . n A 1 361 ASN 361 360 360 ASN ASN R . n A 1 362 PRO 362 361 361 PRO PRO R . n A 1 363 ILE 363 362 362 ILE ILE R . n A 1 364 LEU 364 363 363 LEU LEU R . n A 1 365 TYR 365 364 364 TYR TYR R . n A 1 366 ASN 366 365 365 ASN ASN R . n A 1 367 LEU 367 366 366 LEU LEU R . n A 1 368 VAL 368 367 367 VAL VAL R . n A 1 369 SER 369 368 368 SER SER R . n A 1 370 ALA 370 369 369 ALA ALA R . n A 1 371 ASN 371 370 370 ASN ASN R . n A 1 372 PHE 372 371 371 PHE PHE R . n A 1 373 ARG 373 372 372 ARG ARG R . n A 1 374 HIS 374 373 373 HIS HIS R . n A 1 375 ILE 375 374 374 ILE ILE R . n A 1 376 PHE 376 375 375 PHE PHE R . n A 1 377 LEU 377 376 376 LEU LEU R . n A 1 378 ALA 378 377 377 ALA ALA R . n A 1 379 THR 379 378 378 THR THR R . n A 1 380 LEU 380 379 379 LEU LEU R . n A 1 381 ALA 381 380 ? ? ? R . n A 1 382 CYS 382 381 ? ? ? R . n A 1 383 LEU 383 382 ? ? ? R . n A 1 384 CYS 384 383 ? ? ? R . n A 1 385 PRO 385 384 ? ? ? R . n A 1 386 VAL 386 385 ? ? ? R . n A 1 387 TRP 387 386 ? ? ? R . n A 1 388 ARG 388 387 ? ? ? R . n A 1 389 ARG 389 388 ? ? ? R . n A 1 390 ARG 390 389 ? ? ? R . n A 1 391 ARG 391 390 ? ? ? R . n A 1 392 LYS 392 391 ? ? ? R . n A 1 393 ARG 393 392 ? ? ? R . n A 1 394 PRO 394 393 ? ? ? R . n A 1 395 ALA 395 394 ? ? ? R . n A 1 396 PHE 396 395 ? ? ? R . n A 1 397 SER 397 396 ? ? ? R . n A 1 398 ARG 398 397 ? ? ? R . n A 1 399 LYS 399 398 ? ? ? R . n A 1 400 ALA 400 399 ? ? ? R . n A 1 401 ASP 401 400 ? ? ? R . n A 1 402 SER 402 401 ? ? ? R . n A 1 403 VAL 403 402 ? ? ? R . n A 1 404 SER 404 403 ? ? ? R . n A 1 405 SER 405 404 ? ? ? R . n A 1 406 ASN 406 405 ? ? ? R . n A 1 407 HIS 407 406 ? ? ? R . n A 1 408 THR 408 407 ? ? ? R . n A 1 409 LEU 409 408 ? ? ? R . n A 1 410 SER 410 409 ? ? ? R . n A 1 411 SER 411 410 ? ? ? R . n A 1 412 ASN 412 411 ? ? ? R . n A 1 413 ALA 413 412 ? ? ? R . n A 1 414 THR 414 413 ? ? ? R . n A 1 415 ARG 415 414 ? ? ? R . n A 1 416 GLU 416 415 ? ? ? R . n A 1 417 THR 417 416 ? ? ? R . n A 1 418 LEU 418 417 ? ? ? R . n A 1 419 TYR 419 418 ? ? ? R . n B 2 1 MET 1 1 ? ? ? D . n B 2 2 ALA 2 2 ? ? ? D . n B 2 3 GLN 3 3 3 GLN GLN D . n B 2 4 VAL 4 4 4 VAL VAL D . n B 2 5 GLN 5 5 5 GLN GLN D . n B 2 6 LEU 6 6 6 LEU LEU D . n B 2 7 GLN 7 7 7 GLN GLN D . n B 2 8 GLU 8 8 ? ? ? D . n B 2 9 SER 9 9 ? ? ? D . n B 2 10 GLY 10 10 ? ? ? D . n B 2 11 GLY 11 11 ? ? ? D . n B 2 12 GLY 12 12 ? ? ? D . n B 2 13 LEU 13 13 ? ? ? D . n B 2 14 VAL 14 14 ? ? ? D . n B 2 15 GLN 15 15 ? ? ? D . n B 2 16 ALA 16 16 ? ? ? D . n B 2 17 GLY 17 17 ? ? ? D . n B 2 18 GLU 18 18 ? ? ? D . n B 2 19 SER 19 19 ? ? ? D . n B 2 20 LEU 20 20 ? ? ? D . n B 2 21 ARG 21 21 ? ? ? D . n B 2 22 LEU 22 22 ? ? ? D . n B 2 23 SER 23 23 ? ? ? D . n B 2 24 CYS 24 24 ? ? ? D . n B 2 25 ALA 25 25 25 ALA ALA D . n B 2 26 ALA 26 26 26 ALA ALA D . n B 2 27 SER 27 27 27 SER SER D . n B 2 28 GLY 28 28 28 GLY GLY D . n B 2 29 THR 29 29 29 THR THR D . n B 2 30 ILE 30 30 30 ILE ILE D . n B 2 31 PHE 31 31 31 PHE PHE D . n B 2 32 ARG 32 32 32 ARG ARG D . n B 2 33 LEU 33 33 33 LEU LEU D . n B 2 34 TYR 34 34 34 TYR TYR D . n B 2 35 ASP 35 35 35 ASP ASP D . n B 2 36 MET 36 36 36 MET MET D . n B 2 37 GLY 37 37 37 GLY GLY D . n B 2 38 TRP 38 38 38 TRP TRP D . n B 2 39 TYR 39 39 39 TYR TYR D . n B 2 40 ARG 40 40 ? ? ? D . n B 2 41 ARG 41 41 ? ? ? D . n B 2 42 VAL 42 42 ? ? ? D . n B 2 43 SER 43 43 ? ? ? D . n B 2 44 GLY 44 44 ? ? ? D . n B 2 45 ASN 45 45 ? ? ? D . n B 2 46 GLN 46 46 ? ? ? D . n B 2 47 ARG 47 47 ? ? ? D . n B 2 48 GLU 48 48 ? ? ? D . n B 2 49 LEU 49 49 ? ? ? D . n B 2 50 VAL 50 50 50 VAL VAL D . n B 2 51 ALA 51 51 51 ALA ALA D . n B 2 52 SER 52 52 52 SER SER D . n B 2 53 ILE 53 53 53 ILE ILE D . n B 2 54 THR 54 54 54 THR THR D . n B 2 55 SER 55 55 55 SER SER D . n B 2 56 GLY 56 56 56 GLY GLY D . n B 2 57 GLY 57 57 57 GLY GLY D . n B 2 58 SER 58 58 58 SER SER D . n B 2 59 THR 59 59 59 THR THR D . n B 2 60 LYS 60 60 60 LYS LYS D . n B 2 61 TYR 61 61 61 TYR TYR D . n B 2 62 GLY 62 62 ? ? ? D . n B 2 63 ASP 63 63 ? ? ? D . n B 2 64 SER 64 64 ? ? ? D . n B 2 65 VAL 65 65 ? ? ? D . n B 2 66 LYS 66 66 ? ? ? D . n B 2 67 GLY 67 67 ? ? ? D . n B 2 68 ARG 68 68 ? ? ? D . n B 2 69 PHE 69 69 ? ? ? D . n B 2 70 THR 70 70 ? ? ? D . n B 2 71 ILE 71 71 ? ? ? D . n B 2 72 SER 72 72 72 SER SER D . n B 2 73 ARG 73 73 73 ARG ARG D . n B 2 74 ASP 74 74 74 ASP ASP D . n B 2 75 ASN 75 75 75 ASN ASN D . n B 2 76 ALA 76 76 76 ALA ALA D . n B 2 77 LYS 77 77 77 LYS LYS D . n B 2 78 ASN 78 78 78 ASN ASN D . n B 2 79 THR 79 79 79 THR THR D . n B 2 80 VAL 80 80 80 VAL VAL D . n B 2 81 TYR 81 81 ? ? ? D . n B 2 82 LEU 82 82 ? ? ? D . n B 2 83 GLN 83 83 ? ? ? D . n B 2 84 MET 84 84 ? ? ? D . n B 2 85 SER 85 85 ? ? ? D . n B 2 86 SER 86 86 ? ? ? D . n B 2 87 LEU 87 87 ? ? ? D . n B 2 88 LYS 88 88 ? ? ? D . n B 2 89 PRO 89 89 ? ? ? D . n B 2 90 GLU 90 90 ? ? ? D . n B 2 91 ASP 91 91 ? ? ? D . n B 2 92 THR 92 92 ? ? ? D . n B 2 93 ALA 93 93 ? ? ? D . n B 2 94 VAL 94 94 ? ? ? D . n B 2 95 TYR 95 95 ? ? ? D . n B 2 96 TYR 96 96 96 TYR TYR D . n B 2 97 CYS 97 97 97 CYS CYS D . n B 2 98 ASN 98 98 98 ASN ASN D . n B 2 99 ALA 99 99 99 ALA ALA D . n B 2 100 GLU 100 100 100 GLU GLU D . n B 2 101 TYR 101 101 101 TYR TYR D . n B 2 102 ARG 102 102 102 ARG ARG D . n B 2 103 THR 103 103 103 THR THR D . n B 2 104 GLY 104 104 104 GLY GLY D . n B 2 105 ILE 105 105 105 ILE ILE D . n B 2 106 TRP 106 106 106 TRP TRP D . n B 2 107 GLU 107 107 107 GLU GLU D . n B 2 108 GLU 108 108 108 GLU GLU D . n B 2 109 LEU 109 109 109 LEU LEU D . n B 2 110 LEU 110 110 110 LEU LEU D . n B 2 111 ASP 111 111 111 ASP ASP D . n B 2 112 GLY 112 112 112 GLY GLY D . n B 2 113 TRP 113 113 113 TRP TRP D . n B 2 114 GLY 114 114 114 GLY GLY D . n B 2 115 GLN 115 115 ? ? ? D . n B 2 116 GLY 116 116 ? ? ? D . n B 2 117 THR 117 117 ? ? ? D . n B 2 118 GLN 118 118 ? ? ? D . n B 2 119 VAL 119 119 ? ? ? D . n B 2 120 THR 120 120 ? ? ? D . n B 2 121 VAL 121 121 ? ? ? D . n B 2 122 SER 122 122 ? ? ? D . n B 2 123 SER 123 123 ? ? ? D . n B 2 124 HIS 124 124 ? ? ? D . n B 2 125 HIS 125 125 ? ? ? D . n B 2 126 HIS 126 126 ? ? ? D . n B 2 127 HIS 127 127 ? ? ? D . n B 2 128 HIS 128 128 ? ? ? D . n B 2 129 HIS 129 129 ? ? ? D . n B 2 130 GLU 130 130 ? ? ? D . n B 2 131 PRO 131 131 ? ? ? D . n B 2 132 GLU 132 132 ? ? ? D . n B 2 133 ALA 133 133 ? ? ? D . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email yiorgo@stanford.edu _pdbx_contact_author.name_first Georgios _pdbx_contact_author.name_last Skiniotis _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0238-7846 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 Q6Q 1 501 1000 Q6Q Q6Q R . D 4 NA 1 502 1 NA NA R . E 5 HOH 1 601 8 HOH HOH R . E 5 HOH 2 602 10 HOH HOH R . E 5 HOH 3 603 2 HOH HOH R . E 5 HOH 4 604 9 HOH HOH R . E 5 HOH 5 605 4 HOH HOH R . E 5 HOH 6 606 13 HOH HOH R . E 5 HOH 7 607 1 HOH HOH R . E 5 HOH 8 608 5 HOH HOH R . E 5 HOH 9 609 6 HOH HOH R . E 5 HOH 10 610 3 HOH HOH R . E 5 HOH 11 611 7 HOH HOH R . E 5 HOH 12 612 14 HOH HOH R . E 5 HOH 13 613 12 HOH HOH R . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 132 ? R ASP 112 ? 1_555 NA ? D NA . ? R NA 502 ? 1_555 OG1 ? A THR 175 ? R THR 155 ? 1_555 139.3 ? 2 OD1 ? A ASP 132 ? R ASP 112 ? 1_555 NA ? D NA . ? R NA 502 ? 1_555 O ? E HOH . ? R HOH 610 ? 1_555 69.7 ? 3 OG1 ? A THR 175 ? R THR 155 ? 1_555 NA ? D NA . ? R NA 502 ? 1_555 O ? E HOH . ? R HOH 610 ? 1_555 71.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-29 2 'Structure model' 1 1 2022-11-23 3 'Structure model' 1 2 2022-11-30 4 'Structure model' 1 3 2022-12-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' citation 4 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.year' 7 3 'Structure model' '_citation.pdbx_database_id_PubMed' 8 3 'Structure model' '_citation.title' 9 4 'Structure model' '_citation.journal_volume' 10 4 'Structure model' '_citation.page_first' 11 4 'Structure model' '_citation.page_last' 12 4 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_entry_details.entry_id 7UL2 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _em_3d_fitting.entry_id 7UL2 _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol ? _em_3d_fitting.ref_space ? _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 7UL2 _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles 372987 _em_3d_reconstruction.resolution 2.4 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type POINT _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 7.5 _em_buffer.specimen_id 1 _em_buffer.name ? # loop_ _em_entity_assembly.id _em_entity_assembly.parent_id _em_entity_assembly.details _em_entity_assembly.name _em_entity_assembly.source _em_entity_assembly.type _em_entity_assembly.entity_id_list _em_entity_assembly.synonym _em_entity_assembly.oligomeric_details 1 0 ? 'Complex of NTSR1 and Nb6' RECOMBINANT COMPLEX 1,2 ? ? 2 1 ? NTSR1 RECOMBINANT COMPLEX 1 ? ? 3 1 ? Nb6 RECOMBINANT COMPLEX 2 ? ? # _em_imaging.id 1 _em_imaging.entry_id 7UL2 _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen ? _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode OTHER _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_max 1500 _em_imaging.nominal_defocus_min 500 _em_imaging.nominal_magnification ? _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model ? _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature ? _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity ? _em_vitrification.instrument ? _em_vitrification.entry_id 7UL2 _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 7UL2 _em_experiment.id 1 _em_experiment.aggregation_state PARTICLE _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.entity_assembly_id 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE R 127 ? ? -120.24 -51.86 2 1 PHE R 245 ? ? -124.08 -54.39 3 1 SER R 270 ? ? 78.31 -2.62 4 1 TYR D 34 ? ? -115.50 -83.40 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 R ILE 60 ? CG1 ? A ILE 80 CG1 2 1 Y 1 R ILE 60 ? CG2 ? A ILE 80 CG2 3 1 Y 1 R ILE 60 ? CD1 ? A ILE 80 CD1 4 1 Y 1 R TYR 61 ? CG ? A TYR 81 CG 5 1 Y 1 R TYR 61 ? CD1 ? A TYR 81 CD1 6 1 Y 1 R TYR 61 ? CD2 ? A TYR 81 CD2 7 1 Y 1 R TYR 61 ? CE1 ? A TYR 81 CE1 8 1 Y 1 R TYR 61 ? CE2 ? A TYR 81 CE2 9 1 Y 1 R TYR 61 ? CZ ? A TYR 81 CZ 10 1 Y 1 R TYR 61 ? OH ? A TYR 81 OH 11 1 Y 1 R ARG 90 ? CG ? A ARG 110 CG 12 1 Y 1 R ARG 90 ? CD ? A ARG 110 CD 13 1 Y 1 R ARG 90 ? NE ? A ARG 110 NE 14 1 Y 1 R ARG 90 ? CZ ? A ARG 110 CZ 15 1 Y 1 R ARG 90 ? NH1 ? A ARG 110 NH1 16 1 Y 1 R ARG 90 ? NH2 ? A ARG 110 NH2 17 1 Y 1 R SER 99 ? OG ? A SER 119 OG 18 1 Y 1 R THR 100 ? OG1 ? A THR 120 OG1 19 1 Y 1 R THR 100 ? CG2 ? A THR 120 CG2 20 1 Y 1 R HIS 102 ? CG ? A HIS 122 CG 21 1 Y 1 R HIS 102 ? ND1 ? A HIS 122 ND1 22 1 Y 1 R HIS 102 ? CD2 ? A HIS 122 CD2 23 1 Y 1 R HIS 102 ? CE1 ? A HIS 122 CE1 24 1 Y 1 R HIS 102 ? NE2 ? A HIS 122 NE2 25 1 Y 1 R GLU 165 ? CG ? A GLU 185 CG 26 1 Y 1 R GLU 165 ? CD ? A GLU 185 CD 27 1 Y 1 R GLU 165 ? OE1 ? A GLU 185 OE1 28 1 Y 1 R GLU 165 ? OE2 ? A GLU 185 OE2 29 1 Y 1 R PHE 174 ? CG ? A PHE 194 CG 30 1 Y 1 R PHE 174 ? CD1 ? A PHE 194 CD1 31 1 Y 1 R PHE 174 ? CD2 ? A PHE 194 CD2 32 1 Y 1 R PHE 174 ? CE1 ? A PHE 194 CE1 33 1 Y 1 R PHE 174 ? CE2 ? A PHE 194 CE2 34 1 Y 1 R PHE 174 ? CZ ? A PHE 194 CZ 35 1 Y 1 R LYS 175 ? CG ? A LYS 195 CG 36 1 Y 1 R LYS 175 ? CD ? A LYS 195 CD 37 1 Y 1 R LYS 175 ? CE ? A LYS 195 CE 38 1 Y 1 R LYS 175 ? NZ ? A LYS 195 NZ 39 1 Y 1 R LYS 177 ? CG ? A LYS 197 CG 40 1 Y 1 R LYS 177 ? CD ? A LYS 197 CD 41 1 Y 1 R LYS 177 ? CE ? A LYS 197 CE 42 1 Y 1 R LYS 177 ? NZ ? A LYS 197 NZ 43 1 Y 1 R THR 178 ? OG1 ? A THR 198 OG1 44 1 Y 1 R THR 178 ? CG2 ? A THR 198 CG2 45 1 Y 1 R MET 180 ? CG ? A MET 200 CG 46 1 Y 1 R MET 180 ? SD ? A MET 200 SD 47 1 Y 1 R MET 180 ? CE ? A MET 200 CE 48 1 Y 1 R SER 181 ? OG ? A SER 201 OG 49 1 Y 1 R ARG 182 ? CG ? A ARG 202 CG 50 1 Y 1 R ARG 182 ? CD ? A ARG 202 CD 51 1 Y 1 R ARG 182 ? NE ? A ARG 202 NE 52 1 Y 1 R ARG 182 ? CZ ? A ARG 202 CZ 53 1 Y 1 R ARG 182 ? NH1 ? A ARG 202 NH1 54 1 Y 1 R ARG 182 ? NH2 ? A ARG 202 NH2 55 1 Y 1 R LYS 186 ? CG ? A LYS 206 CG 56 1 Y 1 R LYS 186 ? CD ? A LYS 206 CD 57 1 Y 1 R LYS 186 ? CE ? A LYS 206 CE 58 1 Y 1 R LYS 186 ? NZ ? A LYS 206 NZ 59 1 Y 1 R LYS 187 ? CG ? A LYS 207 CG 60 1 Y 1 R LYS 187 ? CD ? A LYS 207 CD 61 1 Y 1 R LYS 187 ? CE ? A LYS 207 CE 62 1 Y 1 R LYS 187 ? NZ ? A LYS 207 NZ 63 1 Y 1 R ARG 212 ? CG ? A ARG 232 CG 64 1 Y 1 R ARG 212 ? CD ? A ARG 232 CD 65 1 Y 1 R ARG 212 ? NE ? A ARG 232 NE 66 1 Y 1 R ARG 212 ? CZ ? A ARG 232 CZ 67 1 Y 1 R ARG 212 ? NH1 ? A ARG 232 NH1 68 1 Y 1 R ARG 212 ? NH2 ? A ARG 232 NH2 69 1 Y 1 R SER 213 ? OG ? A SER 233 OG 70 1 Y 1 R HIS 218 ? CG ? A HIS 238 CG 71 1 Y 1 R HIS 218 ? ND1 ? A HIS 238 ND1 72 1 Y 1 R HIS 218 ? CD2 ? A HIS 238 CD2 73 1 Y 1 R HIS 218 ? CE1 ? A HIS 238 CE1 74 1 Y 1 R HIS 218 ? NE2 ? A HIS 238 NE2 75 1 Y 1 R ARG 262 ? CG ? A ARG 282 CG 76 1 Y 1 R ARG 262 ? CD ? A ARG 282 CD 77 1 Y 1 R ARG 262 ? NE ? A ARG 282 NE 78 1 Y 1 R ARG 262 ? CZ ? A ARG 282 CZ 79 1 Y 1 R ARG 262 ? NH1 ? A ARG 282 NH1 80 1 Y 1 R ARG 262 ? NH2 ? A ARG 282 NH2 81 1 Y 1 R LYS 264 ? CG ? A LYS 284 CG 82 1 Y 1 R LYS 264 ? CD ? A LYS 284 CD 83 1 Y 1 R LYS 264 ? CE ? A LYS 284 CE 84 1 Y 1 R LYS 264 ? NZ ? A LYS 284 NZ 85 1 Y 1 R VAL 266 ? CG1 ? A VAL 286 CG1 86 1 Y 1 R VAL 266 ? CG2 ? A VAL 286 CG2 87 1 Y 1 R SER 270 ? OG ? A SER 290 OG 88 1 Y 1 R GLU 274 ? CG ? A GLU 294 CG 89 1 Y 1 R GLU 274 ? CD ? A GLU 294 CD 90 1 Y 1 R GLU 274 ? OE1 ? A GLU 294 OE1 91 1 Y 1 R GLU 274 ? OE2 ? A GLU 294 OE2 92 1 Y 1 R ARG 300 ? CG ? A ARG 301 CG 93 1 Y 1 R ARG 300 ? CD ? A ARG 301 CD 94 1 Y 1 R ARG 300 ? NE ? A ARG 301 NE 95 1 Y 1 R ARG 300 ? CZ ? A ARG 301 CZ 96 1 Y 1 R ARG 300 ? NH1 ? A ARG 301 NH1 97 1 Y 1 R ARG 300 ? NH2 ? A ARG 301 NH2 98 1 Y 1 R ILE 329 ? CG1 ? A ILE 330 CG1 99 1 Y 1 R ILE 329 ? CG2 ? A ILE 330 CG2 100 1 Y 1 R ILE 329 ? CD1 ? A ILE 330 CD1 101 1 Y 1 R SER 330 ? OG ? A SER 331 OG 102 1 Y 1 R ASN 370 ? CG ? A ASN 371 CG 103 1 Y 1 R ASN 370 ? OD1 ? A ASN 371 OD1 104 1 Y 1 R ASN 370 ? ND2 ? A ASN 371 ND2 105 1 Y 1 R ARG 372 ? CG ? A ARG 373 CG 106 1 Y 1 R ARG 372 ? CD ? A ARG 373 CD 107 1 Y 1 R ARG 372 ? NE ? A ARG 373 NE 108 1 Y 1 R ARG 372 ? CZ ? A ARG 373 CZ 109 1 Y 1 R ARG 372 ? NH1 ? A ARG 373 NH1 110 1 Y 1 R ARG 372 ? NH2 ? A ARG 373 NH2 111 1 Y 1 R HIS 373 ? CG ? A HIS 374 CG 112 1 Y 1 R HIS 373 ? ND1 ? A HIS 374 ND1 113 1 Y 1 R HIS 373 ? CD2 ? A HIS 374 CD2 114 1 Y 1 R HIS 373 ? CE1 ? A HIS 374 CE1 115 1 Y 1 R HIS 373 ? NE2 ? A HIS 374 NE2 116 1 Y 1 R ILE 374 ? CG1 ? A ILE 375 CG1 117 1 Y 1 R ILE 374 ? CG2 ? A ILE 375 CG2 118 1 Y 1 R ILE 374 ? CD1 ? A ILE 375 CD1 119 1 Y 1 R LEU 376 ? CG ? A LEU 377 CG 120 1 Y 1 R LEU 376 ? CD1 ? A LEU 377 CD1 121 1 Y 1 R LEU 376 ? CD2 ? A LEU 377 CD2 122 1 Y 1 D GLN 3 ? CG ? B GLN 3 CG 123 1 Y 1 D GLN 3 ? CD ? B GLN 3 CD 124 1 Y 1 D GLN 3 ? OE1 ? B GLN 3 OE1 125 1 Y 1 D GLN 3 ? NE2 ? B GLN 3 NE2 126 1 Y 1 D VAL 4 ? CG1 ? B VAL 4 CG1 127 1 Y 1 D VAL 4 ? CG2 ? B VAL 4 CG2 128 1 Y 1 D GLN 5 ? CG ? B GLN 5 CG 129 1 Y 1 D GLN 5 ? CD ? B GLN 5 CD 130 1 Y 1 D GLN 5 ? OE1 ? B GLN 5 OE1 131 1 Y 1 D GLN 5 ? NE2 ? B GLN 5 NE2 132 1 Y 1 D LEU 6 ? CG ? B LEU 6 CG 133 1 Y 1 D LEU 6 ? CD1 ? B LEU 6 CD1 134 1 Y 1 D LEU 6 ? CD2 ? B LEU 6 CD2 135 1 Y 1 D GLN 7 ? CG ? B GLN 7 CG 136 1 Y 1 D GLN 7 ? CD ? B GLN 7 CD 137 1 Y 1 D GLN 7 ? OE1 ? B GLN 7 OE1 138 1 Y 1 D GLN 7 ? NE2 ? B GLN 7 NE2 139 1 Y 1 D SER 27 ? OG ? B SER 27 OG 140 1 Y 1 D THR 29 ? OG1 ? B THR 29 OG1 141 1 Y 1 D THR 29 ? CG2 ? B THR 29 CG2 142 1 Y 1 D ILE 30 ? CG1 ? B ILE 30 CG1 143 1 Y 1 D ILE 30 ? CG2 ? B ILE 30 CG2 144 1 Y 1 D ILE 30 ? CD1 ? B ILE 30 CD1 145 1 Y 1 D LEU 33 ? CG ? B LEU 33 CG 146 1 Y 1 D LEU 33 ? CD1 ? B LEU 33 CD1 147 1 Y 1 D LEU 33 ? CD2 ? B LEU 33 CD2 148 1 Y 1 D TRP 38 ? CG ? B TRP 38 CG 149 1 Y 1 D TRP 38 ? CD1 ? B TRP 38 CD1 150 1 Y 1 D TRP 38 ? CD2 ? B TRP 38 CD2 151 1 Y 1 D TRP 38 ? NE1 ? B TRP 38 NE1 152 1 Y 1 D TRP 38 ? CE2 ? B TRP 38 CE2 153 1 Y 1 D TRP 38 ? CE3 ? B TRP 38 CE3 154 1 Y 1 D TRP 38 ? CZ2 ? B TRP 38 CZ2 155 1 Y 1 D TRP 38 ? CZ3 ? B TRP 38 CZ3 156 1 Y 1 D TRP 38 ? CH2 ? B TRP 38 CH2 157 1 Y 1 D VAL 50 ? CG1 ? B VAL 50 CG1 158 1 Y 1 D VAL 50 ? CG2 ? B VAL 50 CG2 159 1 Y 1 D SER 52 ? OG ? B SER 52 OG 160 1 Y 1 D ILE 53 ? CG1 ? B ILE 53 CG1 161 1 Y 1 D ILE 53 ? CG2 ? B ILE 53 CG2 162 1 Y 1 D ILE 53 ? CD1 ? B ILE 53 CD1 163 1 Y 1 D SER 55 ? OG ? B SER 55 OG 164 1 Y 1 D SER 58 ? OG ? B SER 58 OG 165 1 Y 1 D THR 59 ? OG1 ? B THR 59 OG1 166 1 Y 1 D THR 59 ? CG2 ? B THR 59 CG2 167 1 Y 1 D LYS 60 ? CG ? B LYS 60 CG 168 1 Y 1 D LYS 60 ? CD ? B LYS 60 CD 169 1 Y 1 D LYS 60 ? CE ? B LYS 60 CE 170 1 Y 1 D LYS 60 ? NZ ? B LYS 60 NZ 171 1 Y 1 D TYR 61 ? CG ? B TYR 61 CG 172 1 Y 1 D TYR 61 ? CD1 ? B TYR 61 CD1 173 1 Y 1 D TYR 61 ? CD2 ? B TYR 61 CD2 174 1 Y 1 D TYR 61 ? CE1 ? B TYR 61 CE1 175 1 Y 1 D TYR 61 ? CE2 ? B TYR 61 CE2 176 1 Y 1 D TYR 61 ? CZ ? B TYR 61 CZ 177 1 Y 1 D TYR 61 ? OH ? B TYR 61 OH 178 1 Y 1 D SER 72 ? OG ? B SER 72 OG 179 1 Y 1 D ASP 74 ? CG ? B ASP 74 CG 180 1 Y 1 D ASP 74 ? OD1 ? B ASP 74 OD1 181 1 Y 1 D ASP 74 ? OD2 ? B ASP 74 OD2 182 1 Y 1 D ASN 75 ? CG ? B ASN 75 CG 183 1 Y 1 D ASN 75 ? OD1 ? B ASN 75 OD1 184 1 Y 1 D ASN 75 ? ND2 ? B ASN 75 ND2 185 1 Y 1 D LYS 77 ? CG ? B LYS 77 CG 186 1 Y 1 D LYS 77 ? CD ? B LYS 77 CD 187 1 Y 1 D LYS 77 ? CE ? B LYS 77 CE 188 1 Y 1 D LYS 77 ? NZ ? B LYS 77 NZ 189 1 Y 1 D ASN 78 ? CG ? B ASN 78 CG 190 1 Y 1 D ASN 78 ? OD1 ? B ASN 78 OD1 191 1 Y 1 D ASN 78 ? ND2 ? B ASN 78 ND2 192 1 Y 1 D THR 79 ? OG1 ? B THR 79 OG1 193 1 Y 1 D THR 79 ? CG2 ? B THR 79 CG2 194 1 Y 1 D VAL 80 ? CG1 ? B VAL 80 CG1 195 1 Y 1 D VAL 80 ? CG2 ? B VAL 80 CG2 196 1 Y 1 D TYR 96 ? CG ? B TYR 96 CG 197 1 Y 1 D TYR 96 ? CD1 ? B TYR 96 CD1 198 1 Y 1 D TYR 96 ? CD2 ? B TYR 96 CD2 199 1 Y 1 D TYR 96 ? CE1 ? B TYR 96 CE1 200 1 Y 1 D TYR 96 ? CE2 ? B TYR 96 CE2 201 1 Y 1 D TYR 96 ? CZ ? B TYR 96 CZ 202 1 Y 1 D TYR 96 ? OH ? B TYR 96 OH 203 1 Y 1 D CYS 97 ? SG ? B CYS 97 SG 204 1 Y 1 D ASN 98 ? CG ? B ASN 98 CG 205 1 Y 1 D ASN 98 ? OD1 ? B ASN 98 OD1 206 1 Y 1 D ASN 98 ? ND2 ? B ASN 98 ND2 207 1 Y 1 D ILE 105 ? CG1 ? B ILE 105 CG1 208 1 Y 1 D ILE 105 ? CG2 ? B ILE 105 CG2 209 1 Y 1 D ILE 105 ? CD1 ? B ILE 105 CD1 210 1 Y 1 D GLU 108 ? CG ? B GLU 108 CG 211 1 Y 1 D GLU 108 ? CD ? B GLU 108 CD 212 1 Y 1 D GLU 108 ? OE1 ? B GLU 108 OE1 213 1 Y 1 D GLU 108 ? OE2 ? B GLU 108 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 R ASP -19 ? A ASP 1 2 1 Y 1 R TYR -18 ? A TYR 2 3 1 Y 1 R LYS -17 ? A LYS 3 4 1 Y 1 R ASP -16 ? A ASP 4 5 1 Y 1 R ASP -15 ? A ASP 5 6 1 Y 1 R ASP -14 ? A ASP 6 7 1 Y 1 R ASP -13 ? A ASP 7 8 1 Y 1 R ALA -12 ? A ALA 8 9 1 Y 1 R MET -11 ? A MET 9 10 1 Y 1 R GLY -10 ? A GLY 10 11 1 Y 1 R GLN -9 ? A GLN 11 12 1 Y 1 R PRO -8 ? A PRO 12 13 1 Y 1 R GLY -7 ? A GLY 13 14 1 Y 1 R ASN -6 ? A ASN 14 15 1 Y 1 R GLY -5 ? A GLY 15 16 1 Y 1 R SER -4 ? A SER 16 17 1 Y 1 R ALA -3 ? A ALA 17 18 1 Y 1 R PHE -2 ? A PHE 18 19 1 Y 1 R LEU -1 ? A LEU 19 20 1 Y 1 R LEU 0 ? A LEU 20 21 1 Y 1 R ALA 1 ? A ALA 21 22 1 Y 1 R PRO 2 ? A PRO 22 23 1 Y 1 R ASN 3 ? A ASN 23 24 1 Y 1 R ARG 4 ? A ARG 24 25 1 Y 1 R SER 5 ? A SER 25 26 1 Y 1 R HIS 6 ? A HIS 26 27 1 Y 1 R ALA 7 ? A ALA 27 28 1 Y 1 R PRO 8 ? A PRO 28 29 1 Y 1 R ASP 9 ? A ASP 29 30 1 Y 1 R HIS 10 ? A HIS 30 31 1 Y 1 R ASP 11 ? A ASP 31 32 1 Y 1 R VAL 12 ? A VAL 32 33 1 Y 1 R GLU 13 ? A GLU 33 34 1 Y 1 R ASN 14 ? A ASN 34 35 1 Y 1 R LEU 15 ? A LEU 35 36 1 Y 1 R TYR 16 ? A TYR 36 37 1 Y 1 R PHE 17 ? A PHE 37 38 1 Y 1 R GLN 18 ? A GLN 38 39 1 Y 1 R GLY 19 ? A GLY 39 40 1 Y 1 R GLN 20 ? A GLN 40 41 1 Y 1 R ARG 21 ? A ARG 41 42 1 Y 1 R ALA 22 ? A ALA 42 43 1 Y 1 R GLN 23 ? A GLN 43 44 1 Y 1 R ALA 24 ? A ALA 44 45 1 Y 1 R GLY 25 ? A GLY 45 46 1 Y 1 R LEU 26 ? A LEU 46 47 1 Y 1 R GLU 27 ? A GLU 47 48 1 Y 1 R GLU 28 ? A GLU 48 49 1 Y 1 R ALA 29 ? A ALA 49 50 1 Y 1 R LEU 30 ? A LEU 50 51 1 Y 1 R LEU 31 ? A LEU 51 52 1 Y 1 R ALA 32 ? A ALA 52 53 1 Y 1 R PRO 33 ? A PRO 53 54 1 Y 1 R GLY 34 ? A GLY 54 55 1 Y 1 R PHE 35 ? A PHE 55 56 1 Y 1 R GLY 36 ? A GLY 56 57 1 Y 1 R ASN 37 ? A ASN 57 58 1 Y 1 R ALA 38 ? A ALA 58 59 1 Y 1 R SER 39 ? A SER 59 60 1 Y 1 R GLY 40 ? A GLY 60 61 1 Y 1 R ASN 41 ? A ASN 61 62 1 Y 1 R ALA 42 ? A ALA 62 63 1 Y 1 R SER 43 ? A SER 63 64 1 Y 1 R GLU 44 ? A GLU 64 65 1 Y 1 R ARG 45 ? A ARG 65 66 1 Y 1 R VAL 46 ? A VAL 66 67 1 Y 1 R LEU 47 ? A LEU 67 68 1 Y 1 R ALA 48 ? A ALA 68 69 1 Y 1 R ALA 49 ? A ALA 69 70 1 Y 1 R PRO 50 ? A PRO 70 71 1 Y 1 R SER 51 ? A SER 71 72 1 Y 1 R SER 52 ? A SER 72 73 1 Y 1 R GLU 53 ? A GLU 73 74 1 Y 1 R LEU 54 ? A LEU 74 75 1 Y 1 R ASP 55 ? A ASP 75 76 1 Y 1 R VAL 56 ? A VAL 76 77 1 Y 1 R ASN 57 ? A ASN 77 78 1 Y 1 R THR 58 ? A THR 78 79 1 Y 1 R ASP 59 ? A ASP 79 80 1 Y 1 R LYS 91 ? A LYS 111 81 1 Y 1 R LYS 92 ? A LYS 112 82 1 Y 1 R SER 93 ? A SER 113 83 1 Y 1 R LEU 94 ? A LEU 114 84 1 Y 1 R GLN 95 ? A GLN 115 85 1 Y 1 R SER 96 ? A SER 116 86 1 Y 1 R LEU 97 ? A LEU 117 87 1 Y 1 R GLN 98 ? A GLN 118 88 1 Y 1 R ASP 215 ? A ASP 235 89 1 Y 1 R GLY 216 ? A GLY 236 90 1 Y 1 R GLN 217 ? A GLN 237 91 1 Y 1 R ASP 331 ? A ASP 332 92 1 Y 1 R GLU 332 ? A GLU 333 93 1 Y 1 R GLN 333 ? A GLN 334 94 1 Y 1 R ALA 380 ? A ALA 381 95 1 Y 1 R CYS 381 ? A CYS 382 96 1 Y 1 R LEU 382 ? A LEU 383 97 1 Y 1 R CYS 383 ? A CYS 384 98 1 Y 1 R PRO 384 ? A PRO 385 99 1 Y 1 R VAL 385 ? A VAL 386 100 1 Y 1 R TRP 386 ? A TRP 387 101 1 Y 1 R ARG 387 ? A ARG 388 102 1 Y 1 R ARG 388 ? A ARG 389 103 1 Y 1 R ARG 389 ? A ARG 390 104 1 Y 1 R ARG 390 ? A ARG 391 105 1 Y 1 R LYS 391 ? A LYS 392 106 1 Y 1 R ARG 392 ? A ARG 393 107 1 Y 1 R PRO 393 ? A PRO 394 108 1 Y 1 R ALA 394 ? A ALA 395 109 1 Y 1 R PHE 395 ? A PHE 396 110 1 Y 1 R SER 396 ? A SER 397 111 1 Y 1 R ARG 397 ? A ARG 398 112 1 Y 1 R LYS 398 ? A LYS 399 113 1 Y 1 R ALA 399 ? A ALA 400 114 1 Y 1 R ASP 400 ? A ASP 401 115 1 Y 1 R SER 401 ? A SER 402 116 1 Y 1 R VAL 402 ? A VAL 403 117 1 Y 1 R SER 403 ? A SER 404 118 1 Y 1 R SER 404 ? A SER 405 119 1 Y 1 R ASN 405 ? A ASN 406 120 1 Y 1 R HIS 406 ? A HIS 407 121 1 Y 1 R THR 407 ? A THR 408 122 1 Y 1 R LEU 408 ? A LEU 409 123 1 Y 1 R SER 409 ? A SER 410 124 1 Y 1 R SER 410 ? A SER 411 125 1 Y 1 R ASN 411 ? A ASN 412 126 1 Y 1 R ALA 412 ? A ALA 413 127 1 Y 1 R THR 413 ? A THR 414 128 1 Y 1 R ARG 414 ? A ARG 415 129 1 Y 1 R GLU 415 ? A GLU 416 130 1 Y 1 R THR 416 ? A THR 417 131 1 Y 1 R LEU 417 ? A LEU 418 132 1 Y 1 R TYR 418 ? A TYR 419 133 1 Y 1 D MET 1 ? B MET 1 134 1 Y 1 D ALA 2 ? B ALA 2 135 1 Y 1 D GLU 8 ? B GLU 8 136 1 Y 1 D SER 9 ? B SER 9 137 1 Y 1 D GLY 10 ? B GLY 10 138 1 Y 1 D GLY 11 ? B GLY 11 139 1 Y 1 D GLY 12 ? B GLY 12 140 1 Y 1 D LEU 13 ? B LEU 13 141 1 Y 1 D VAL 14 ? B VAL 14 142 1 Y 1 D GLN 15 ? B GLN 15 143 1 Y 1 D ALA 16 ? B ALA 16 144 1 Y 1 D GLY 17 ? B GLY 17 145 1 Y 1 D GLU 18 ? B GLU 18 146 1 Y 1 D SER 19 ? B SER 19 147 1 Y 1 D LEU 20 ? B LEU 20 148 1 Y 1 D ARG 21 ? B ARG 21 149 1 Y 1 D LEU 22 ? B LEU 22 150 1 Y 1 D SER 23 ? B SER 23 151 1 Y 1 D CYS 24 ? B CYS 24 152 1 Y 1 D ARG 40 ? B ARG 40 153 1 Y 1 D ARG 41 ? B ARG 41 154 1 Y 1 D VAL 42 ? B VAL 42 155 1 Y 1 D SER 43 ? B SER 43 156 1 Y 1 D GLY 44 ? B GLY 44 157 1 Y 1 D ASN 45 ? B ASN 45 158 1 Y 1 D GLN 46 ? B GLN 46 159 1 Y 1 D ARG 47 ? B ARG 47 160 1 Y 1 D GLU 48 ? B GLU 48 161 1 Y 1 D LEU 49 ? B LEU 49 162 1 Y 1 D GLY 62 ? B GLY 62 163 1 Y 1 D ASP 63 ? B ASP 63 164 1 Y 1 D SER 64 ? B SER 64 165 1 Y 1 D VAL 65 ? B VAL 65 166 1 Y 1 D LYS 66 ? B LYS 66 167 1 Y 1 D GLY 67 ? B GLY 67 168 1 Y 1 D ARG 68 ? B ARG 68 169 1 Y 1 D PHE 69 ? B PHE 69 170 1 Y 1 D THR 70 ? B THR 70 171 1 Y 1 D ILE 71 ? B ILE 71 172 1 Y 1 D TYR 81 ? B TYR 81 173 1 Y 1 D LEU 82 ? B LEU 82 174 1 Y 1 D GLN 83 ? B GLN 83 175 1 Y 1 D MET 84 ? B MET 84 176 1 Y 1 D SER 85 ? B SER 85 177 1 Y 1 D SER 86 ? B SER 86 178 1 Y 1 D LEU 87 ? B LEU 87 179 1 Y 1 D LYS 88 ? B LYS 88 180 1 Y 1 D PRO 89 ? B PRO 89 181 1 Y 1 D GLU 90 ? B GLU 90 182 1 Y 1 D ASP 91 ? B ASP 91 183 1 Y 1 D THR 92 ? B THR 92 184 1 Y 1 D ALA 93 ? B ALA 93 185 1 Y 1 D VAL 94 ? B VAL 94 186 1 Y 1 D TYR 95 ? B TYR 95 187 1 Y 1 D GLN 115 ? B GLN 115 188 1 Y 1 D GLY 116 ? B GLY 116 189 1 Y 1 D THR 117 ? B THR 117 190 1 Y 1 D GLN 118 ? B GLN 118 191 1 Y 1 D VAL 119 ? B VAL 119 192 1 Y 1 D THR 120 ? B THR 120 193 1 Y 1 D VAL 121 ? B VAL 121 194 1 Y 1 D SER 122 ? B SER 122 195 1 Y 1 D SER 123 ? B SER 123 196 1 Y 1 D HIS 124 ? B HIS 124 197 1 Y 1 D HIS 125 ? B HIS 125 198 1 Y 1 D HIS 126 ? B HIS 126 199 1 Y 1 D HIS 127 ? B HIS 127 200 1 Y 1 D HIS 128 ? B HIS 128 201 1 Y 1 D HIS 129 ? B HIS 129 202 1 Y 1 D GLU 130 ? B GLU 130 203 1 Y 1 D PRO 131 ? B PRO 131 204 1 Y 1 D GLU 132 ? B GLU 132 205 1 Y 1 D ALA 133 ? B ALA 133 # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' _em_ctf_correction.details ? # loop_ _em_entity_assembly_naturalsource.id _em_entity_assembly_naturalsource.entity_assembly_id _em_entity_assembly_naturalsource.cell _em_entity_assembly_naturalsource.cellular_location _em_entity_assembly_naturalsource.ncbi_tax_id _em_entity_assembly_naturalsource.organ _em_entity_assembly_naturalsource.organelle _em_entity_assembly_naturalsource.organism _em_entity_assembly_naturalsource.strain _em_entity_assembly_naturalsource.tissue 2 1 ? ? 9606 ? ? 'Homo sapiens' ? ? 3 2 ? ? 9606 ? ? 'Homo sapiens' ? ? 3 3 ? ? 9844 ? ? 'Lama glama' ? ? # loop_ _em_entity_assembly_recombinant.id _em_entity_assembly_recombinant.entity_assembly_id _em_entity_assembly_recombinant.cell _em_entity_assembly_recombinant.ncbi_tax_id _em_entity_assembly_recombinant.organism _em_entity_assembly_recombinant.plasmid _em_entity_assembly_recombinant.strain 2 1 ? 7108 'Spodoptera frugiperda' ? ? 2 2 ? 7108 'Spodoptera frugiperda' ? ? 3 3 ? 562 'Escherichia coli' ? ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 60.82 _em_image_recording.average_exposure_time ? _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K3 (6k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? _em_image_recording.avg_electron_dose_per_subtomogram ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'PARTICLE SELECTION' ? ? ? 1 ? ? 2 'IMAGE ACQUISITION' ? ? ? ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? ? ? 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? ? ? ? ? ? 8 'MODEL REFINEMENT' ? ? ? ? ? ? 9 OTHER ? ? ? ? ? ? 10 'INITIAL EULER ASSIGNMENT' ? ? ? 1 ? ? 11 'FINAL EULER ASSIGNMENT' ? ? ? 1 ? ? 12 CLASSIFICATION ? ? ? 1 ? ? 13 RECONSTRUCTION ? ? ? 1 ? ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _pdbx_audit_support.funding_organization 'The G. Harold and Leila Y. Mathers Foundation' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id Q6Q _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id Q6Q _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 '2-[[1-(7-chloranylquinolin-4-yl)-5-(2,6-dimethoxyphenyl)pyrazol-3-yl]carbonylamino]adamantane-2-carboxylic acid' Q6Q 4 'SODIUM ION' NA 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #