data_7X43 # _entry.id 7X43 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7X43 pdb_00007x43 10.2210/pdb7x43/pdb WWPDB D_1300028006 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7X43 _pdbx_database_status.recvd_initial_deposition_date 2022-03-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chang, Y.T.' 1 0000-0002-8877-4048 'Chuang, W.J.' 2 0000-0001-8670-2799 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Expression in Pichia pastoris and characterization of chlorotoxin, an anti-glioma migration agent' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Chang, Y.T.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7X43 _cell.details ? _cell.formula_units_Z ? _cell.length_a 22.390 _cell.length_a_esd ? _cell.length_b 26.500 _cell.length_b_esd ? _cell.length_c 47.257 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7X43 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Chlorotoxin 4438.194 1 ? M1R ? ? 2 water nat water 18.015 41 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name CTX,ClTx # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code EAEARCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR _entity_poly.pdbx_seq_one_letter_code_can EAEARCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ALA n 1 3 GLU n 1 4 ALA n 1 5 ARG n 1 6 CYS n 1 7 MET n 1 8 PRO n 1 9 CYS n 1 10 PHE n 1 11 THR n 1 12 THR n 1 13 ASP n 1 14 HIS n 1 15 GLN n 1 16 MET n 1 17 ALA n 1 18 ARG n 1 19 LYS n 1 20 CYS n 1 21 ASP n 1 22 ASP n 1 23 CYS n 1 24 CYS n 1 25 GLY n 1 26 GLY n 1 27 LYS n 1 28 GLY n 1 29 ARG n 1 30 GLY n 1 31 LYS n 1 32 CYS n 1 33 TYR n 1 34 GLY n 1 35 PRO n 1 36 GLN n 1 37 CYS n 1 38 LEU n 1 39 CYS n 1 40 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 40 _entity_src_gen.gene_src_common_name 'Egyptian scorpion' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Leiurus quinquestriatus quinquestriatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6885 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name Pichia _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4919 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CTXL_LEIQU _struct_ref.pdbx_db_accession P45639 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7X43 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P45639 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 36 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 36 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7X43 GLU A 1 ? UNP P45639 ? ? 'expression tag' -3 1 1 7X43 ALA A 2 ? UNP P45639 ? ? 'expression tag' -2 2 1 7X43 GLU A 3 ? UNP P45639 ? ? 'expression tag' -1 3 1 7X43 ALA A 4 ? UNP P45639 ? ? 'expression tag' 0 4 1 7X43 ARG A 5 ? UNP P45639 MET 1 'engineered mutation' 1 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7X43 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 22.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1 M monosodium phosphate and 0.75 M sodium citrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-05-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSRRC BEAMLINE BL13B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL13B1 _diffrn_source.pdbx_synchrotron_site NSRRC # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7X43 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.04 _reflns.d_resolution_low 30.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14128 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.92 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.5 _reflns.pdbx_Rmerge_I_obs 0.036 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 45.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.04 _reflns_shell.d_res_low 1.08 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1379 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.164 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.013 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 0.029 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] -0.042 _refine.B_iso_max ? _refine.B_iso_mean 7.418 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.968 _refine.correlation_coeff_Fo_to_Fc_free 0.962 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7X43 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.040 _refine.ls_d_res_low 23.628 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14086 _refine.ls_number_reflns_R_free 711 _refine.ls_number_reflns_R_work 13375 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.922 _refine.ls_percent_reflns_R_free 5.048 _refine.ls_R_factor_all 0.140 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.1457 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1393 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7X41 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.026 _refine.pdbx_overall_ESU_R_Free 0.024 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 0.506 _refine.overall_SU_ML 0.012 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 276 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 41 _refine_hist.number_atoms_total 317 _refine_hist.d_res_high 1.040 _refine_hist.d_res_low 23.628 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.013 284 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.013 256 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.468 1.686 378 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.528 1.621 595 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 8.248 5.000 36 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 28.688 18.125 16 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 9.686 15.000 52 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 10.495 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.085 0.200 34 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 319 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 69 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.217 0.200 56 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.183 0.200 236 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.165 0.200 131 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.081 0.200 148 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.132 0.200 30 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.250 0.200 7 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.169 0.200 38 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.053 0.200 4 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.418 0.434 147 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 0.391 0.428 146 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 0.622 0.651 182 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 0.629 0.657 183 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 0.668 0.673 137 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 0.666 0.684 138 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 0.800 0.925 196 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 0.798 0.937 197 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 1.502 6.834 325 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 1.288 6.084 314 ? r_lrange_other ? ? 'X-RAY DIFFRACTION' ? 0.853 3.000 540 ? r_rigid_bond_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.040 1.067 1041 . 53 987 99.9039 . 0.153 . 0.160 . 0.153 . . . . . 0.119 . 20 . 0.977 0.970 'X-RAY DIFFRACTION' 1.067 1.096 969 . 51 918 100.0000 . 0.116 . 0.095 . 0.117 . . . . . 0.091 . 20 . 0.983 0.983 'X-RAY DIFFRACTION' 1.096 1.128 991 . 44 947 100.0000 . 0.103 . 0.117 . 0.102 . . . . . 0.081 . 20 . 0.986 0.985 'X-RAY DIFFRACTION' 1.128 1.162 936 . 38 898 100.0000 . 0.105 . 0.128 . 0.104 . . . . . 0.087 . 20 . 0.985 0.982 'X-RAY DIFFRACTION' 1.162 1.200 903 . 42 861 100.0000 . 0.103 . 0.110 . 0.103 . . . . . 0.089 . 20 . 0.986 0.986 'X-RAY DIFFRACTION' 1.200 1.243 894 . 51 843 100.0000 . 0.103 . 0.100 . 0.103 . . . . . 0.088 . 20 . 0.987 0.986 'X-RAY DIFFRACTION' 1.243 1.289 841 . 46 795 100.0000 . 0.106 . 0.125 . 0.105 . . . . . 0.093 . 20 . 0.985 0.981 'X-RAY DIFFRACTION' 1.289 1.342 826 . 40 786 100.0000 . 0.110 . 0.152 . 0.108 . . . . . 0.098 . 20 . 0.982 0.974 'X-RAY DIFFRACTION' 1.342 1.401 809 . 50 759 100.0000 . 0.112 . 0.149 . 0.109 . . . . . 0.098 . 20 . 0.983 0.977 'X-RAY DIFFRACTION' 1.401 1.469 747 . 44 703 100.0000 . 0.112 . 0.096 . 0.113 . . . . . 0.107 . 20 . 0.983 0.986 'X-RAY DIFFRACTION' 1.469 1.549 726 . 37 689 100.0000 . 0.114 . 0.113 . 0.114 . . . . . 0.110 . 20 . 0.983 0.984 'X-RAY DIFFRACTION' 1.549 1.642 689 . 39 649 99.8549 . 0.115 . 0.116 . 0.115 . . . . . 0.112 . 20 . 0.983 0.983 'X-RAY DIFFRACTION' 1.642 1.755 650 . 36 613 99.8462 . 0.129 . 0.150 . 0.128 . . . . . 0.132 . 20 . 0.981 0.979 'X-RAY DIFFRACTION' 1.755 1.894 612 . 25 587 100.0000 . 0.145 . 0.130 . 0.146 . . . . . 0.152 . 20 . 0.977 0.976 'X-RAY DIFFRACTION' 1.894 2.074 567 . 26 540 99.8236 . 0.154 . 0.153 . 0.154 . . . . . 0.170 . 20 . 0.974 0.973 'X-RAY DIFFRACTION' 2.074 2.317 511 . 23 488 100.0000 . 0.168 . 0.170 . 0.168 . . . . . 0.194 . 20 . 0.968 0.967 'X-RAY DIFFRACTION' 2.317 2.671 464 . 22 442 100.0000 . 0.169 . 0.183 . 0.168 . . . . . 0.199 . 20 . 0.966 0.948 'X-RAY DIFFRACTION' 2.671 3.260 400 . 18 382 100.0000 . 0.175 . 0.203 . 0.174 . . . . . 0.211 . 20 . 0.968 0.963 'X-RAY DIFFRACTION' 3.260 4.568 318 . 15 300 99.0566 . 0.158 . 0.193 . 0.157 . . . . . 0.202 . 20 . 0.978 0.962 'X-RAY DIFFRACTION' 4.568 23.628 202 . 11 187 98.0198 . 0.285 . 0.211 . 0.290 . . . . . 0.409 . 20 . 0.942 0.958 # _struct.entry_id 7X43 _struct.title 'Crystal structure of chlorotoxin mutant - M1R' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7X43 _struct_keywords.text 'Neurotoxin, Anti-glioma migration agent, Glioma diagnosis, TOXIN' _struct_keywords.pdbx_keywords TOXIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 15 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 25 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 11 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 21 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 23 SG ? ? A CYS 2 A CYS 19 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 5 A CYS 28 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 16 A CYS 33 1_555 ? ? ? ? ? ? ? 2.038 ? ? disulf4 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 20 A CYS 35 1_555 ? ? ? ? ? ? ? 2.029 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 7 ? PRO A 8 ? MET A 3 PRO A 4 AA1 2 GLN A 36 ? CYS A 39 ? GLN A 32 CYS A 35 AA1 3 GLY A 30 ? TYR A 33 ? GLY A 26 TYR A 29 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N MET A 7 ? N MET A 3 O CYS A 37 ? O CYS A 33 AA1 2 3 O LEU A 38 ? O LEU A 34 N LYS A 31 ? N LYS A 27 # _atom_sites.entry_id 7X43 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.044663 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.037736 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021161 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.056 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 -3 ? ? ? A . n A 1 2 ALA 2 -2 ? ? ? A . n A 1 3 GLU 3 -1 ? ? ? A . n A 1 4 ALA 4 0 0 ALA ALA A . n A 1 5 ARG 5 1 1 ARG ARG A . n A 1 6 CYS 6 2 2 CYS CYS A . n A 1 7 MET 7 3 3 MET MET A . n A 1 8 PRO 8 4 4 PRO PRO A . n A 1 9 CYS 9 5 5 CYS CYS A . n A 1 10 PHE 10 6 6 PHE PHE A . n A 1 11 THR 11 7 7 THR THR A . n A 1 12 THR 12 8 8 THR THR A . n A 1 13 ASP 13 9 9 ASP ASP A . n A 1 14 HIS 14 10 10 HIS HIS A . n A 1 15 GLN 15 11 11 GLN GLN A . n A 1 16 MET 16 12 12 MET MET A . n A 1 17 ALA 17 13 13 ALA ALA A . n A 1 18 ARG 18 14 14 ARG ARG A . n A 1 19 LYS 19 15 15 LYS LYS A . n A 1 20 CYS 20 16 16 CYS CYS A . n A 1 21 ASP 21 17 17 ASP ASP A . n A 1 22 ASP 22 18 18 ASP ASP A . n A 1 23 CYS 23 19 19 CYS CYS A . n A 1 24 CYS 24 20 20 CYS CYS A . n A 1 25 GLY 25 21 21 GLY GLY A . n A 1 26 GLY 26 22 22 GLY GLY A . n A 1 27 LYS 27 23 23 LYS LYS A . n A 1 28 GLY 28 24 24 GLY GLY A . n A 1 29 ARG 29 25 25 ARG ARG A . n A 1 30 GLY 30 26 26 GLY GLY A . n A 1 31 LYS 31 27 27 LYS LYS A . n A 1 32 CYS 32 28 28 CYS CYS A . n A 1 33 TYR 33 29 29 TYR TYR A . n A 1 34 GLY 34 30 30 GLY GLY A . n A 1 35 PRO 35 31 31 PRO PRO A . n A 1 36 GLN 36 32 32 GLN GLN A . n A 1 37 CYS 37 33 33 CYS CYS A . n A 1 38 LEU 38 34 34 LEU LEU A . n A 1 39 CYS 39 35 35 CYS CYS A . n A 1 40 ARG 40 36 36 ARG ARG A . n # _pdbx_contact_author.id 1 _pdbx_contact_author.email wjcnmr@mail.ncku.edu.tw _pdbx_contact_author.name_first Woei-Jer _pdbx_contact_author.name_last Chuang _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-8670-2799 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 101 40 HOH HOH A . B 2 HOH 2 102 6 HOH HOH A . B 2 HOH 3 103 36 HOH HOH A . B 2 HOH 4 104 24 HOH HOH A . B 2 HOH 5 105 27 HOH HOH A . B 2 HOH 6 106 22 HOH HOH A . B 2 HOH 7 107 19 HOH HOH A . B 2 HOH 8 108 16 HOH HOH A . B 2 HOH 9 109 28 HOH HOH A . B 2 HOH 10 110 26 HOH HOH A . B 2 HOH 11 111 4 HOH HOH A . B 2 HOH 12 112 2 HOH HOH A . B 2 HOH 13 113 25 HOH HOH A . B 2 HOH 14 114 9 HOH HOH A . B 2 HOH 15 115 29 HOH HOH A . B 2 HOH 16 116 7 HOH HOH A . B 2 HOH 17 117 14 HOH HOH A . B 2 HOH 18 118 38 HOH HOH A . B 2 HOH 19 119 8 HOH HOH A . B 2 HOH 20 120 11 HOH HOH A . B 2 HOH 21 121 5 HOH HOH A . B 2 HOH 22 122 1 HOH HOH A . B 2 HOH 23 123 18 HOH HOH A . B 2 HOH 24 124 3 HOH HOH A . B 2 HOH 25 125 10 HOH HOH A . B 2 HOH 26 126 21 HOH HOH A . B 2 HOH 27 127 12 HOH HOH A . B 2 HOH 28 128 13 HOH HOH A . B 2 HOH 29 129 20 HOH HOH A . B 2 HOH 30 130 15 HOH HOH A . B 2 HOH 31 131 34 HOH HOH A . B 2 HOH 32 132 41 HOH HOH A . B 2 HOH 33 133 39 HOH HOH A . B 2 HOH 34 134 17 HOH HOH A . B 2 HOH 35 135 33 HOH HOH A . B 2 HOH 36 136 42 HOH HOH A . B 2 HOH 37 137 23 HOH HOH A . B 2 HOH 38 138 37 HOH HOH A . B 2 HOH 39 139 30 HOH HOH A . B 2 HOH 40 140 35 HOH HOH A . B 2 HOH 41 141 31 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 2890 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-03-08 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 3.7746 _pdbx_refine_tls.origin_y -4.1429 _pdbx_refine_tls.origin_z -6.8749 _pdbx_refine_tls.T[1][1] 0.0030 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0032 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0031 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0094 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0029 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0122 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.6610 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.1514 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.1286 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.0589 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.0261 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.6593 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0121 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0127 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0052 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0009 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0140 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0135 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.0223 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0030 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0019 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 0 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 36 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ALL _pdbx_refine_tls_group.selection_details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? 2.3.10 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? 2.3.10 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? 2.3.10 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU -3 ? A GLU 1 2 1 Y 1 A ALA -2 ? A ALA 2 3 1 Y 1 A GLU -1 ? A GLU 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 HOH O O N N 141 HOH H1 H N N 142 HOH H2 H N N 143 LEU N N N N 144 LEU CA C N S 145 LEU C C N N 146 LEU O O N N 147 LEU CB C N N 148 LEU CG C N N 149 LEU CD1 C N N 150 LEU CD2 C N N 151 LEU OXT O N N 152 LEU H H N N 153 LEU H2 H N N 154 LEU HA H N N 155 LEU HB2 H N N 156 LEU HB3 H N N 157 LEU HG H N N 158 LEU HD11 H N N 159 LEU HD12 H N N 160 LEU HD13 H N N 161 LEU HD21 H N N 162 LEU HD22 H N N 163 LEU HD23 H N N 164 LEU HXT H N N 165 LYS N N N N 166 LYS CA C N S 167 LYS C C N N 168 LYS O O N N 169 LYS CB C N N 170 LYS CG C N N 171 LYS CD C N N 172 LYS CE C N N 173 LYS NZ N N N 174 LYS OXT O N N 175 LYS H H N N 176 LYS H2 H N N 177 LYS HA H N N 178 LYS HB2 H N N 179 LYS HB3 H N N 180 LYS HG2 H N N 181 LYS HG3 H N N 182 LYS HD2 H N N 183 LYS HD3 H N N 184 LYS HE2 H N N 185 LYS HE3 H N N 186 LYS HZ1 H N N 187 LYS HZ2 H N N 188 LYS HZ3 H N N 189 LYS HXT H N N 190 MET N N N N 191 MET CA C N S 192 MET C C N N 193 MET O O N N 194 MET CB C N N 195 MET CG C N N 196 MET SD S N N 197 MET CE C N N 198 MET OXT O N N 199 MET H H N N 200 MET H2 H N N 201 MET HA H N N 202 MET HB2 H N N 203 MET HB3 H N N 204 MET HG2 H N N 205 MET HG3 H N N 206 MET HE1 H N N 207 MET HE2 H N N 208 MET HE3 H N N 209 MET HXT H N N 210 PHE N N N N 211 PHE CA C N S 212 PHE C C N N 213 PHE O O N N 214 PHE CB C N N 215 PHE CG C Y N 216 PHE CD1 C Y N 217 PHE CD2 C Y N 218 PHE CE1 C Y N 219 PHE CE2 C Y N 220 PHE CZ C Y N 221 PHE OXT O N N 222 PHE H H N N 223 PHE H2 H N N 224 PHE HA H N N 225 PHE HB2 H N N 226 PHE HB3 H N N 227 PHE HD1 H N N 228 PHE HD2 H N N 229 PHE HE1 H N N 230 PHE HE2 H N N 231 PHE HZ H N N 232 PHE HXT H N N 233 PRO N N N N 234 PRO CA C N S 235 PRO C C N N 236 PRO O O N N 237 PRO CB C N N 238 PRO CG C N N 239 PRO CD C N N 240 PRO OXT O N N 241 PRO H H N N 242 PRO HA H N N 243 PRO HB2 H N N 244 PRO HB3 H N N 245 PRO HG2 H N N 246 PRO HG3 H N N 247 PRO HD2 H N N 248 PRO HD3 H N N 249 PRO HXT H N N 250 THR N N N N 251 THR CA C N S 252 THR C C N N 253 THR O O N N 254 THR CB C N R 255 THR OG1 O N N 256 THR CG2 C N N 257 THR OXT O N N 258 THR H H N N 259 THR H2 H N N 260 THR HA H N N 261 THR HB H N N 262 THR HG1 H N N 263 THR HG21 H N N 264 THR HG22 H N N 265 THR HG23 H N N 266 THR HXT H N N 267 TYR N N N N 268 TYR CA C N S 269 TYR C C N N 270 TYR O O N N 271 TYR CB C N N 272 TYR CG C Y N 273 TYR CD1 C Y N 274 TYR CD2 C Y N 275 TYR CE1 C Y N 276 TYR CE2 C Y N 277 TYR CZ C Y N 278 TYR OH O N N 279 TYR OXT O N N 280 TYR H H N N 281 TYR H2 H N N 282 TYR HA H N N 283 TYR HB2 H N N 284 TYR HB3 H N N 285 TYR HD1 H N N 286 TYR HD2 H N N 287 TYR HE1 H N N 288 TYR HE2 H N N 289 TYR HH H N N 290 TYR HXT H N N 291 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 HOH O H1 sing N N 134 HOH O H2 sing N N 135 LEU N CA sing N N 136 LEU N H sing N N 137 LEU N H2 sing N N 138 LEU CA C sing N N 139 LEU CA CB sing N N 140 LEU CA HA sing N N 141 LEU C O doub N N 142 LEU C OXT sing N N 143 LEU CB CG sing N N 144 LEU CB HB2 sing N N 145 LEU CB HB3 sing N N 146 LEU CG CD1 sing N N 147 LEU CG CD2 sing N N 148 LEU CG HG sing N N 149 LEU CD1 HD11 sing N N 150 LEU CD1 HD12 sing N N 151 LEU CD1 HD13 sing N N 152 LEU CD2 HD21 sing N N 153 LEU CD2 HD22 sing N N 154 LEU CD2 HD23 sing N N 155 LEU OXT HXT sing N N 156 LYS N CA sing N N 157 LYS N H sing N N 158 LYS N H2 sing N N 159 LYS CA C sing N N 160 LYS CA CB sing N N 161 LYS CA HA sing N N 162 LYS C O doub N N 163 LYS C OXT sing N N 164 LYS CB CG sing N N 165 LYS CB HB2 sing N N 166 LYS CB HB3 sing N N 167 LYS CG CD sing N N 168 LYS CG HG2 sing N N 169 LYS CG HG3 sing N N 170 LYS CD CE sing N N 171 LYS CD HD2 sing N N 172 LYS CD HD3 sing N N 173 LYS CE NZ sing N N 174 LYS CE HE2 sing N N 175 LYS CE HE3 sing N N 176 LYS NZ HZ1 sing N N 177 LYS NZ HZ2 sing N N 178 LYS NZ HZ3 sing N N 179 LYS OXT HXT sing N N 180 MET N CA sing N N 181 MET N H sing N N 182 MET N H2 sing N N 183 MET CA C sing N N 184 MET CA CB sing N N 185 MET CA HA sing N N 186 MET C O doub N N 187 MET C OXT sing N N 188 MET CB CG sing N N 189 MET CB HB2 sing N N 190 MET CB HB3 sing N N 191 MET CG SD sing N N 192 MET CG HG2 sing N N 193 MET CG HG3 sing N N 194 MET SD CE sing N N 195 MET CE HE1 sing N N 196 MET CE HE2 sing N N 197 MET CE HE3 sing N N 198 MET OXT HXT sing N N 199 PHE N CA sing N N 200 PHE N H sing N N 201 PHE N H2 sing N N 202 PHE CA C sing N N 203 PHE CA CB sing N N 204 PHE CA HA sing N N 205 PHE C O doub N N 206 PHE C OXT sing N N 207 PHE CB CG sing N N 208 PHE CB HB2 sing N N 209 PHE CB HB3 sing N N 210 PHE CG CD1 doub Y N 211 PHE CG CD2 sing Y N 212 PHE CD1 CE1 sing Y N 213 PHE CD1 HD1 sing N N 214 PHE CD2 CE2 doub Y N 215 PHE CD2 HD2 sing N N 216 PHE CE1 CZ doub Y N 217 PHE CE1 HE1 sing N N 218 PHE CE2 CZ sing Y N 219 PHE CE2 HE2 sing N N 220 PHE CZ HZ sing N N 221 PHE OXT HXT sing N N 222 PRO N CA sing N N 223 PRO N CD sing N N 224 PRO N H sing N N 225 PRO CA C sing N N 226 PRO CA CB sing N N 227 PRO CA HA sing N N 228 PRO C O doub N N 229 PRO C OXT sing N N 230 PRO CB CG sing N N 231 PRO CB HB2 sing N N 232 PRO CB HB3 sing N N 233 PRO CG CD sing N N 234 PRO CG HG2 sing N N 235 PRO CG HG3 sing N N 236 PRO CD HD2 sing N N 237 PRO CD HD3 sing N N 238 PRO OXT HXT sing N N 239 THR N CA sing N N 240 THR N H sing N N 241 THR N H2 sing N N 242 THR CA C sing N N 243 THR CA CB sing N N 244 THR CA HA sing N N 245 THR C O doub N N 246 THR C OXT sing N N 247 THR CB OG1 sing N N 248 THR CB CG2 sing N N 249 THR CB HB sing N N 250 THR OG1 HG1 sing N N 251 THR CG2 HG21 sing N N 252 THR CG2 HG22 sing N N 253 THR CG2 HG23 sing N N 254 THR OXT HXT sing N N 255 TYR N CA sing N N 256 TYR N H sing N N 257 TYR N H2 sing N N 258 TYR CA C sing N N 259 TYR CA CB sing N N 260 TYR CA HA sing N N 261 TYR C O doub N N 262 TYR C OXT sing N N 263 TYR CB CG sing N N 264 TYR CB HB2 sing N N 265 TYR CB HB3 sing N N 266 TYR CG CD1 doub Y N 267 TYR CG CD2 sing Y N 268 TYR CD1 CE1 sing Y N 269 TYR CD1 HD1 sing N N 270 TYR CD2 CE2 doub Y N 271 TYR CD2 HD2 sing N N 272 TYR CE1 CZ doub Y N 273 TYR CE1 HE1 sing N N 274 TYR CE2 CZ sing Y N 275 TYR CE2 HE2 sing N N 276 TYR CZ OH sing N N 277 TYR OH HH sing N N 278 TYR OXT HXT sing N N 279 # _pdbx_audit_support.funding_organization 'Ministry of Science and Technology (MoST, Taiwan)' _pdbx_audit_support.country Taiwan _pdbx_audit_support.grant_number 'MOST 109-2311-B-006-004-MY3' _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7X41 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #