data_7XP1 # _entry.id 7XP1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7XP1 pdb_00007xp1 10.2210/pdb7xp1/pdb WWPDB D_1300029324 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7XP1 _pdbx_database_status.recvd_initial_deposition_date 2022-05-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhang, Y.X.' 1 ? 'Liang, H.H.' 2 ? 'Gan, J.H.' 3 0000-0002-8438-8852 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Adv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2375-2548 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first eadd4220 _citation.page_last eadd4220 _citation.title 'PmiR senses 2-methylisocitrate levels to regulate bacterial virulence in Pseudomonas aeruginosa.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/sciadv.add4220 _citation.pdbx_database_id_PubMed 36475801 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cui, G.' 1 0000-0003-0599-828X primary 'Zhang, Y.' 2 0000-0001-9860-3114 primary 'Xu, X.' 3 0000-0001-7738-1583 primary 'Liu, Y.' 4 0000-0002-8284-325X primary 'Li, Z.' 5 0000-0001-8106-6455 primary 'Wu, M.' 6 ? primary 'Liu, J.' 7 0000-0001-5487-959X primary 'Gan, J.' 8 0000-0002-8438-8852 primary 'Liang, H.' 9 0000-0001-9639-1867 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7XP1 _cell.details ? _cell.formula_units_Z ? _cell.length_a 74.021 _cell.length_a_esd ? _cell.length_b 74.021 _cell.length_b_esd ? _cell.length_c 186.543 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7XP1 _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Probable transcriptional regulator' 25027.408 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'ALPHA-METHYLISOCITRIC ACID' 206.150 1 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 5 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 6 water nat water 18.015 6 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PmiR # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GETLSEHVFRKIQSAIVSGEIAPGSKISEPELARTYGISRGPLREAIHRLEGLRLLVRVPHVGARVVSLSHAELIELYEI RESLEGMACRLAAERMSQAEIDELRRVLDTHERDEAFQAGRGYYQQEGDYDFHYRIIQGSGNATLTRMLCGELYQLVRMY RIQYSTTPNRPRQAFAEHHRILDAIADRDGELAELLMRRHISASRRNIERQLEPQPAK ; _entity_poly.pdbx_seq_one_letter_code_can ;GETLSEHVFRKIQSAIVSGEIAPGSKISEPELARTYGISRGPLREAIHRLEGLRLLVRVPHVGARVVSLSHAELIELYEI RESLEGMACRLAAERMSQAEIDELRRVLDTHERDEAFQAGRGYYQQEGDYDFHYRIIQGSGNATLTRMLCGELYQLVRMY RIQYSTTPNRPRQAFAEHHRILDAIADRDGELAELLMRRHISASRRNIERQLEPQPAK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLU n 1 3 THR n 1 4 LEU n 1 5 SER n 1 6 GLU n 1 7 HIS n 1 8 VAL n 1 9 PHE n 1 10 ARG n 1 11 LYS n 1 12 ILE n 1 13 GLN n 1 14 SER n 1 15 ALA n 1 16 ILE n 1 17 VAL n 1 18 SER n 1 19 GLY n 1 20 GLU n 1 21 ILE n 1 22 ALA n 1 23 PRO n 1 24 GLY n 1 25 SER n 1 26 LYS n 1 27 ILE n 1 28 SER n 1 29 GLU n 1 30 PRO n 1 31 GLU n 1 32 LEU n 1 33 ALA n 1 34 ARG n 1 35 THR n 1 36 TYR n 1 37 GLY n 1 38 ILE n 1 39 SER n 1 40 ARG n 1 41 GLY n 1 42 PRO n 1 43 LEU n 1 44 ARG n 1 45 GLU n 1 46 ALA n 1 47 ILE n 1 48 HIS n 1 49 ARG n 1 50 LEU n 1 51 GLU n 1 52 GLY n 1 53 LEU n 1 54 ARG n 1 55 LEU n 1 56 LEU n 1 57 VAL n 1 58 ARG n 1 59 VAL n 1 60 PRO n 1 61 HIS n 1 62 VAL n 1 63 GLY n 1 64 ALA n 1 65 ARG n 1 66 VAL n 1 67 VAL n 1 68 SER n 1 69 LEU n 1 70 SER n 1 71 HIS n 1 72 ALA n 1 73 GLU n 1 74 LEU n 1 75 ILE n 1 76 GLU n 1 77 LEU n 1 78 TYR n 1 79 GLU n 1 80 ILE n 1 81 ARG n 1 82 GLU n 1 83 SER n 1 84 LEU n 1 85 GLU n 1 86 GLY n 1 87 MET n 1 88 ALA n 1 89 CYS n 1 90 ARG n 1 91 LEU n 1 92 ALA n 1 93 ALA n 1 94 GLU n 1 95 ARG n 1 96 MET n 1 97 SER n 1 98 GLN n 1 99 ALA n 1 100 GLU n 1 101 ILE n 1 102 ASP n 1 103 GLU n 1 104 LEU n 1 105 ARG n 1 106 ARG n 1 107 VAL n 1 108 LEU n 1 109 ASP n 1 110 THR n 1 111 HIS n 1 112 GLU n 1 113 ARG n 1 114 ASP n 1 115 GLU n 1 116 ALA n 1 117 PHE n 1 118 GLN n 1 119 ALA n 1 120 GLY n 1 121 ARG n 1 122 GLY n 1 123 TYR n 1 124 TYR n 1 125 GLN n 1 126 GLN n 1 127 GLU n 1 128 GLY n 1 129 ASP n 1 130 TYR n 1 131 ASP n 1 132 PHE n 1 133 HIS n 1 134 TYR n 1 135 ARG n 1 136 ILE n 1 137 ILE n 1 138 GLN n 1 139 GLY n 1 140 SER n 1 141 GLY n 1 142 ASN n 1 143 ALA n 1 144 THR n 1 145 LEU n 1 146 THR n 1 147 ARG n 1 148 MET n 1 149 LEU n 1 150 CYS n 1 151 GLY n 1 152 GLU n 1 153 LEU n 1 154 TYR n 1 155 GLN n 1 156 LEU n 1 157 VAL n 1 158 ARG n 1 159 MET n 1 160 TYR n 1 161 ARG n 1 162 ILE n 1 163 GLN n 1 164 TYR n 1 165 SER n 1 166 THR n 1 167 THR n 1 168 PRO n 1 169 ASN n 1 170 ARG n 1 171 PRO n 1 172 ARG n 1 173 GLN n 1 174 ALA n 1 175 PHE n 1 176 ALA n 1 177 GLU n 1 178 HIS n 1 179 HIS n 1 180 ARG n 1 181 ILE n 1 182 LEU n 1 183 ASP n 1 184 ALA n 1 185 ILE n 1 186 ALA n 1 187 ASP n 1 188 ARG n 1 189 ASP n 1 190 GLY n 1 191 GLU n 1 192 LEU n 1 193 ALA n 1 194 GLU n 1 195 LEU n 1 196 LEU n 1 197 MET n 1 198 ARG n 1 199 ARG n 1 200 HIS n 1 201 ILE n 1 202 SER n 1 203 ALA n 1 204 SER n 1 205 ARG n 1 206 ARG n 1 207 ASN n 1 208 ILE n 1 209 GLU n 1 210 ARG n 1 211 GLN n 1 212 LEU n 1 213 GLU n 1 214 PRO n 1 215 GLN n 1 216 PRO n 1 217 ALA n 1 218 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 218 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PA0797 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa PAO1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 208964 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9I5E1_PSEAE _struct_ref.pdbx_db_accession Q9I5E1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GETLSEHVFRKIQSAIVSGEIAPGSKISEPELARTYGISRGPLREAIHRLEGLRLLVRVPHVGARVVSLSHAELIELYEI RESLEGMACRLAAERMSQAEIDELRRVLDTHERDEAFQAGRGYYQQEGDYDFHYRIIQGSGNATLTRMLCGELYQLVRMY RIQYSTTPNRPRQAFAEHHRILDAIADRDGELAELLMRRHISASRRNIERQLEPQPAK ; _struct_ref.pdbx_align_begin 15 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7XP1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 218 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9I5E1 _struct_ref_seq.db_align_beg 15 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 232 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 15 _struct_ref_seq.pdbx_auth_seq_align_end 232 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MIC non-polymer . 'ALPHA-METHYLISOCITRIC ACID' ? 'C7 H10 O7' 206.150 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7XP1 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.66 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54 _exptl_crystal.description block _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'MES/Sodium hydroxide, Magnesium sulfate' _exptl_crystal_grow.pdbx_pH_range 5.6-6.0 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 325 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-11-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9793 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 30.550 _reflns.entry_id 7XP1 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.500 _reflns.d_resolution_low 30.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9006 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 17.700 _reflns.pdbx_Rmerge_I_obs 0.047 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.971 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.048 _reflns.pdbx_Rpim_I_all 0.010 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 159703 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.500 2.590 ? ? ? ? ? ? 646 71.600 ? ? ? ? 0.393 ? ? ? ? ? ? ? ? 8.100 ? 0.892 ? ? 0.416 0.127 ? 1 1 0.925 ? ? ? ? ? ? ? ? ? ? 2.590 2.690 ? ? ? ? ? ? 842 92.500 ? ? ? ? 0.417 ? ? ? ? ? ? ? ? 9.800 ? 0.846 ? ? 0.438 0.128 ? 2 1 0.844 ? ? ? ? ? ? ? ? ? ? 2.690 2.820 ? ? ? ? ? ? 913 99.200 ? ? ? ? 0.397 ? ? ? ? ? ? ? ? 13.300 ? 0.832 ? ? 0.412 0.109 ? 3 1 0.943 ? ? ? ? ? ? ? ? ? ? 2.820 2.960 ? ? ? ? ? ? 912 100.000 ? ? ? ? 0.290 ? ? ? ? ? ? ? ? 15.400 ? 0.902 ? ? 0.300 0.074 ? 4 1 0.986 ? ? ? ? ? ? ? ? ? ? 2.960 3.150 ? ? ? ? ? ? 921 100.000 ? ? ? ? 0.197 ? ? ? ? ? ? ? ? 15.800 ? 0.967 ? ? 0.203 0.049 ? 5 1 0.997 ? ? ? ? ? ? ? ? ? ? 3.150 3.390 ? ? ? ? ? ? 923 100.000 ? ? ? ? 0.159 ? ? ? ? ? ? ? ? 19.500 ? 1.045 ? ? 0.163 0.036 ? 6 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.390 3.730 ? ? ? ? ? ? 931 99.900 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 21.600 ? 1.107 ? ? 0.080 0.017 ? 7 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.730 4.270 ? ? ? ? ? ? 936 99.900 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 22.300 ? 1.133 ? ? 0.052 0.011 ? 8 1 0.999 ? ? ? ? ? ? ? ? ? ? 4.270 5.380 ? ? ? ? ? ? 953 99.900 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 24.800 ? 1.000 ? ? 0.039 0.008 ? 9 1 1.000 ? ? ? ? ? ? ? ? ? ? 5.380 30.000 ? ? ? ? ? ? 1029 99.600 ? ? ? ? 0.030 ? ? ? ? ? ? ? ? 22.300 ? 0.788 ? ? 0.031 0.007 ? 10 1 1.000 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 129.710 _refine.B_iso_mean 47.4535 _refine.B_iso_min 10.820 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7XP1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5000 _refine.ls_d_res_low 29.2200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7747 _refine.ls_number_reflns_R_free 360 _refine.ls_number_reflns_R_work 7387 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 82.9200 _refine.ls_percent_reflns_R_free 4.6500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2143 _refine.ls_R_factor_R_free 0.2682 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2117 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.560 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7XP0 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.2800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5000 _refine_hist.d_res_low 29.2200 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 1633 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 198 _refine_hist.pdbx_B_iso_mean_ligand 66.49 _refine_hist.pdbx_B_iso_mean_solvent 25.60 _refine_hist.pdbx_number_atoms_protein 1592 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 35 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5000 2.8600 1467 . 72 1395 48.0000 . . . 0.2972 0.0000 0.2643 . . . . . . . 3 . . . 'X-RAY DIFFRACTION' 2.8600 3.6100 3049 . 150 2899 99.0000 . . . 0.3182 0.0000 0.2391 . . . . . . . 3 . . . 'X-RAY DIFFRACTION' 3.6100 29.2200 3231 . 138 3093 100.0000 . . . 0.2314 0.0000 0.1862 . . . . . . . 3 . . . # _struct.entry_id 7XP1 _struct.title 'Crystal structure of PmiR from Pseudomonas aeruginosa' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7XP1 _struct_keywords.text 'PmiR, 2-methylcitrate cycle, bacterial virulence, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 5 ? H N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 3 ? SER A 18 ? THR A 17 SER A 32 1 ? 16 HELX_P HELX_P2 AA2 SER A 28 ? GLY A 37 ? SER A 42 GLY A 51 1 ? 10 HELX_P HELX_P3 AA3 SER A 39 ? LEU A 53 ? SER A 53 LEU A 67 1 ? 15 HELX_P HELX_P4 AA4 SER A 70 ? MET A 96 ? SER A 84 MET A 110 1 ? 27 HELX_P HELX_P5 AA5 SER A 97 ? HIS A 111 ? SER A 111 HIS A 125 1 ? 15 HELX_P HELX_P6 AA6 ASP A 129 ? SER A 140 ? ASP A 143 SER A 154 1 ? 12 HELX_P HELX_P7 AA7 ASN A 142 ? GLY A 151 ? ASN A 156 GLY A 165 1 ? 10 HELX_P HELX_P8 AA8 GLU A 152 ? TYR A 164 ? GLU A 166 TYR A 178 1 ? 13 HELX_P HELX_P9 AA9 ASN A 169 ? ASP A 187 ? ASN A 183 ASP A 201 1 ? 19 HELX_P HELX_P10 AB1 ASP A 189 ? ARG A 210 ? ASP A 203 ARG A 224 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 133 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 147 A ZN 301 1_555 ? ? ? ? ? ? ? 2.291 ? ? metalc2 metalc ? ? A HIS 178 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 192 A ZN 301 1_555 ? ? ? ? ? ? ? 2.298 ? ? metalc3 metalc ? ? A HIS 200 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 214 A ZN 301 1_555 ? ? ? ? ? ? ? 2.305 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 C MIC . O2 ? ? A ZN 301 A MIC 302 1_555 ? ? ? ? ? ? ? 2.255 ? ? metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 C MIC . O7 ? ? A ZN 301 A MIC 302 1_555 ? ? ? ? ? ? ? 2.033 ? ? metalc6 metalc ? ? B ZN . ZN ? ? ? 1_555 C MIC . O6 ? ? A ZN 301 A MIC 302 1_555 ? ? ? ? ? ? ? 2.370 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 56 ? ARG A 58 ? LEU A 70 ARG A 72 AA1 2 ALA A 64 ? VAL A 66 ? ALA A 78 VAL A 80 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 57 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 71 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ARG _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 65 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 79 # _atom_sites.entry_id 7XP1 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013510 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013510 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005361 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 15 ? ? ? A . n A 1 2 GLU 2 16 16 GLU GLU A . n A 1 3 THR 3 17 17 THR THR A . n A 1 4 LEU 4 18 18 LEU LEU A . n A 1 5 SER 5 19 19 SER SER A . n A 1 6 GLU 6 20 20 GLU GLU A . n A 1 7 HIS 7 21 21 HIS HIS A . n A 1 8 VAL 8 22 22 VAL VAL A . n A 1 9 PHE 9 23 23 PHE PHE A . n A 1 10 ARG 10 24 24 ARG ARG A . n A 1 11 LYS 11 25 25 LYS LYS A . n A 1 12 ILE 12 26 26 ILE ILE A . n A 1 13 GLN 13 27 27 GLN GLN A . n A 1 14 SER 14 28 28 SER SER A . n A 1 15 ALA 15 29 29 ALA ALA A . n A 1 16 ILE 16 30 30 ILE ILE A . n A 1 17 VAL 17 31 31 VAL VAL A . n A 1 18 SER 18 32 32 SER SER A . n A 1 19 GLY 19 33 33 GLY GLY A . n A 1 20 GLU 20 34 34 GLU GLU A . n A 1 21 ILE 21 35 35 ILE ILE A . n A 1 22 ALA 22 36 36 ALA ALA A . n A 1 23 PRO 23 37 37 PRO PRO A . n A 1 24 GLY 24 38 38 GLY GLY A . n A 1 25 SER 25 39 39 SER SER A . n A 1 26 LYS 26 40 40 LYS LYS A . n A 1 27 ILE 27 41 41 ILE ILE A . n A 1 28 SER 28 42 42 SER SER A . n A 1 29 GLU 29 43 43 GLU GLU A . n A 1 30 PRO 30 44 44 PRO PRO A . n A 1 31 GLU 31 45 45 GLU GLU A . n A 1 32 LEU 32 46 46 LEU LEU A . n A 1 33 ALA 33 47 47 ALA ALA A . n A 1 34 ARG 34 48 48 ARG ARG A . n A 1 35 THR 35 49 49 THR THR A . n A 1 36 TYR 36 50 50 TYR TYR A . n A 1 37 GLY 37 51 51 GLY GLY A . n A 1 38 ILE 38 52 52 ILE ILE A . n A 1 39 SER 39 53 53 SER SER A . n A 1 40 ARG 40 54 54 ARG ARG A . n A 1 41 GLY 41 55 55 GLY GLY A . n A 1 42 PRO 42 56 56 PRO PRO A . n A 1 43 LEU 43 57 57 LEU LEU A . n A 1 44 ARG 44 58 58 ARG ARG A . n A 1 45 GLU 45 59 59 GLU GLU A . n A 1 46 ALA 46 60 60 ALA ALA A . n A 1 47 ILE 47 61 61 ILE ILE A . n A 1 48 HIS 48 62 62 HIS HIS A . n A 1 49 ARG 49 63 63 ARG ARG A . n A 1 50 LEU 50 64 64 LEU LEU A . n A 1 51 GLU 51 65 65 GLU GLU A . n A 1 52 GLY 52 66 66 GLY GLY A . n A 1 53 LEU 53 67 67 LEU LEU A . n A 1 54 ARG 54 68 68 ARG ARG A . n A 1 55 LEU 55 69 69 LEU LEU A . n A 1 56 LEU 56 70 70 LEU LEU A . n A 1 57 VAL 57 71 71 VAL VAL A . n A 1 58 ARG 58 72 72 ARG ARG A . n A 1 59 VAL 59 73 73 VAL VAL A . n A 1 60 PRO 60 74 74 PRO PRO A . n A 1 61 HIS 61 75 75 HIS HIS A . n A 1 62 VAL 62 76 76 VAL VAL A . n A 1 63 GLY 63 77 77 GLY GLY A . n A 1 64 ALA 64 78 78 ALA ALA A . n A 1 65 ARG 65 79 79 ARG ARG A . n A 1 66 VAL 66 80 80 VAL VAL A . n A 1 67 VAL 67 81 81 VAL VAL A . n A 1 68 SER 68 82 82 SER SER A . n A 1 69 LEU 69 83 83 LEU LEU A . n A 1 70 SER 70 84 84 SER SER A . n A 1 71 HIS 71 85 85 HIS HIS A . n A 1 72 ALA 72 86 86 ALA ALA A . n A 1 73 GLU 73 87 87 GLU GLU A . n A 1 74 LEU 74 88 88 LEU LEU A . n A 1 75 ILE 75 89 89 ILE ILE A . n A 1 76 GLU 76 90 90 GLU GLU A . n A 1 77 LEU 77 91 91 LEU LEU A . n A 1 78 TYR 78 92 92 TYR TYR A . n A 1 79 GLU 79 93 93 GLU GLU A . n A 1 80 ILE 80 94 94 ILE ILE A . n A 1 81 ARG 81 95 95 ARG ARG A . n A 1 82 GLU 82 96 96 GLU GLU A . n A 1 83 SER 83 97 97 SER SER A . n A 1 84 LEU 84 98 98 LEU LEU A . n A 1 85 GLU 85 99 99 GLU GLU A . n A 1 86 GLY 86 100 100 GLY GLY A . n A 1 87 MET 87 101 101 MET MET A . n A 1 88 ALA 88 102 102 ALA ALA A . n A 1 89 CYS 89 103 103 CYS CYS A . n A 1 90 ARG 90 104 104 ARG ARG A . n A 1 91 LEU 91 105 105 LEU LEU A . n A 1 92 ALA 92 106 106 ALA ALA A . n A 1 93 ALA 93 107 107 ALA ALA A . n A 1 94 GLU 94 108 108 GLU GLU A . n A 1 95 ARG 95 109 109 ARG ARG A . n A 1 96 MET 96 110 110 MET MET A . n A 1 97 SER 97 111 111 SER SER A . n A 1 98 GLN 98 112 112 GLN GLN A . n A 1 99 ALA 99 113 113 ALA ALA A . n A 1 100 GLU 100 114 114 GLU GLU A . n A 1 101 ILE 101 115 115 ILE ILE A . n A 1 102 ASP 102 116 116 ASP ASP A . n A 1 103 GLU 103 117 117 GLU GLU A . n A 1 104 LEU 104 118 118 LEU LEU A . n A 1 105 ARG 105 119 119 ARG ARG A . n A 1 106 ARG 106 120 120 ARG ARG A . n A 1 107 VAL 107 121 121 VAL VAL A . n A 1 108 LEU 108 122 122 LEU LEU A . n A 1 109 ASP 109 123 123 ASP ASP A . n A 1 110 THR 110 124 124 THR THR A . n A 1 111 HIS 111 125 125 HIS HIS A . n A 1 112 GLU 112 126 ? ? ? A . n A 1 113 ARG 113 127 ? ? ? A . n A 1 114 ASP 114 128 ? ? ? A . n A 1 115 GLU 115 129 ? ? ? A . n A 1 116 ALA 116 130 ? ? ? A . n A 1 117 PHE 117 131 ? ? ? A . n A 1 118 GLN 118 132 ? ? ? A . n A 1 119 ALA 119 133 ? ? ? A . n A 1 120 GLY 120 134 ? ? ? A . n A 1 121 ARG 121 135 ? ? ? A . n A 1 122 GLY 122 136 ? ? ? A . n A 1 123 TYR 123 137 ? ? ? A . n A 1 124 TYR 124 138 ? ? ? A . n A 1 125 GLN 125 139 139 GLN GLN A . n A 1 126 GLN 126 140 140 GLN GLN A . n A 1 127 GLU 127 141 141 GLU GLU A . n A 1 128 GLY 128 142 142 GLY GLY A . n A 1 129 ASP 129 143 143 ASP ASP A . n A 1 130 TYR 130 144 144 TYR TYR A . n A 1 131 ASP 131 145 145 ASP ASP A . n A 1 132 PHE 132 146 146 PHE PHE A . n A 1 133 HIS 133 147 147 HIS HIS A . n A 1 134 TYR 134 148 148 TYR TYR A . n A 1 135 ARG 135 149 149 ARG ARG A . n A 1 136 ILE 136 150 150 ILE ILE A . n A 1 137 ILE 137 151 151 ILE ILE A . n A 1 138 GLN 138 152 152 GLN GLN A . n A 1 139 GLY 139 153 153 GLY GLY A . n A 1 140 SER 140 154 154 SER SER A . n A 1 141 GLY 141 155 155 GLY GLY A . n A 1 142 ASN 142 156 156 ASN ASN A . n A 1 143 ALA 143 157 157 ALA ALA A . n A 1 144 THR 144 158 158 THR THR A . n A 1 145 LEU 145 159 159 LEU LEU A . n A 1 146 THR 146 160 160 THR THR A . n A 1 147 ARG 147 161 161 ARG ARG A . n A 1 148 MET 148 162 162 MET MET A . n A 1 149 LEU 149 163 163 LEU LEU A . n A 1 150 CYS 150 164 164 CYS CYS A . n A 1 151 GLY 151 165 165 GLY GLY A . n A 1 152 GLU 152 166 166 GLU GLU A . n A 1 153 LEU 153 167 167 LEU LEU A . n A 1 154 TYR 154 168 168 TYR TYR A . n A 1 155 GLN 155 169 169 GLN GLN A . n A 1 156 LEU 156 170 170 LEU LEU A . n A 1 157 VAL 157 171 171 VAL VAL A . n A 1 158 ARG 158 172 172 ARG ARG A . n A 1 159 MET 159 173 173 MET MET A . n A 1 160 TYR 160 174 174 TYR TYR A . n A 1 161 ARG 161 175 175 ARG ARG A . n A 1 162 ILE 162 176 176 ILE ILE A . n A 1 163 GLN 163 177 177 GLN GLN A . n A 1 164 TYR 164 178 178 TYR TYR A . n A 1 165 SER 165 179 179 SER SER A . n A 1 166 THR 166 180 180 THR THR A . n A 1 167 THR 167 181 181 THR THR A . n A 1 168 PRO 168 182 182 PRO PRO A . n A 1 169 ASN 169 183 183 ASN ASN A . n A 1 170 ARG 170 184 184 ARG ARG A . n A 1 171 PRO 171 185 185 PRO PRO A . n A 1 172 ARG 172 186 186 ARG ARG A . n A 1 173 GLN 173 187 187 GLN GLN A . n A 1 174 ALA 174 188 188 ALA ALA A . n A 1 175 PHE 175 189 189 PHE PHE A . n A 1 176 ALA 176 190 190 ALA ALA A . n A 1 177 GLU 177 191 191 GLU GLU A . n A 1 178 HIS 178 192 192 HIS HIS A . n A 1 179 HIS 179 193 193 HIS HIS A . n A 1 180 ARG 180 194 194 ARG ARG A . n A 1 181 ILE 181 195 195 ILE ILE A . n A 1 182 LEU 182 196 196 LEU LEU A . n A 1 183 ASP 183 197 197 ASP ASP A . n A 1 184 ALA 184 198 198 ALA ALA A . n A 1 185 ILE 185 199 199 ILE ILE A . n A 1 186 ALA 186 200 200 ALA ALA A . n A 1 187 ASP 187 201 201 ASP ASP A . n A 1 188 ARG 188 202 202 ARG ARG A . n A 1 189 ASP 189 203 203 ASP ASP A . n A 1 190 GLY 190 204 204 GLY GLY A . n A 1 191 GLU 191 205 205 GLU GLU A . n A 1 192 LEU 192 206 206 LEU LEU A . n A 1 193 ALA 193 207 207 ALA ALA A . n A 1 194 GLU 194 208 208 GLU GLU A . n A 1 195 LEU 195 209 209 LEU LEU A . n A 1 196 LEU 196 210 210 LEU LEU A . n A 1 197 MET 197 211 211 MET MET A . n A 1 198 ARG 198 212 212 ARG ARG A . n A 1 199 ARG 199 213 213 ARG ARG A . n A 1 200 HIS 200 214 214 HIS HIS A . n A 1 201 ILE 201 215 215 ILE ILE A . n A 1 202 SER 202 216 216 SER SER A . n A 1 203 ALA 203 217 217 ALA ALA A . n A 1 204 SER 204 218 218 SER SER A . n A 1 205 ARG 205 219 219 ARG ARG A . n A 1 206 ARG 206 220 220 ARG ARG A . n A 1 207 ASN 207 221 221 ASN ASN A . n A 1 208 ILE 208 222 222 ILE ILE A . n A 1 209 GLU 209 223 223 GLU GLU A . n A 1 210 ARG 210 224 224 ARG ARG A . n A 1 211 GLN 211 225 225 GLN GLN A . n A 1 212 LEU 212 226 226 LEU LEU A . n A 1 213 GLU 213 227 ? ? ? A . n A 1 214 PRO 214 228 ? ? ? A . n A 1 215 GLN 215 229 ? ? ? A . n A 1 216 PRO 216 230 ? ? ? A . n A 1 217 ALA 217 231 ? ? ? A . n A 1 218 LYS 218 232 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email ganjhh@fudan.edu.cn _pdbx_contact_author.name_first Jianhua _pdbx_contact_author.name_last Gan _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8438-8852 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 1 ZN ZN A . C 3 MIC 1 302 1 MIC MIC A . D 4 SO4 1 303 1 SO4 SO4 A . E 4 SO4 1 304 2 SO4 SO4 A . F 4 SO4 1 305 3 SO4 SO4 A . G 5 GOL 1 306 1 GOL GOL A . H 6 HOH 1 401 2 HOH HOH A . H 6 HOH 2 402 4 HOH HOH A . H 6 HOH 3 403 1 HOH HOH A . H 6 HOH 4 404 3 HOH HOH A . H 6 HOH 5 405 6 HOH HOH A . H 6 HOH 6 406 5 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5330 ? 1 MORE -141 ? 1 'SSA (A^2)' 18180 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 133 ? A HIS 147 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 178 ? A HIS 192 ? 1_555 85.7 ? 2 NE2 ? A HIS 133 ? A HIS 147 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 200 ? A HIS 214 ? 1_555 91.6 ? 3 NE2 ? A HIS 178 ? A HIS 192 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 200 ? A HIS 214 ? 1_555 87.6 ? 4 NE2 ? A HIS 133 ? A HIS 147 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O2 ? C MIC . ? A MIC 302 ? 1_555 96.9 ? 5 NE2 ? A HIS 178 ? A HIS 192 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O2 ? C MIC . ? A MIC 302 ? 1_555 101.1 ? 6 NE2 ? A HIS 200 ? A HIS 214 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O2 ? C MIC . ? A MIC 302 ? 1_555 168.2 ? 7 NE2 ? A HIS 133 ? A HIS 147 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O7 ? C MIC . ? A MIC 302 ? 1_555 171.8 ? 8 NE2 ? A HIS 178 ? A HIS 192 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O7 ? C MIC . ? A MIC 302 ? 1_555 95.5 ? 9 NE2 ? A HIS 200 ? A HIS 214 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O7 ? C MIC . ? A MIC 302 ? 1_555 96.6 ? 10 O2 ? C MIC . ? A MIC 302 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O7 ? C MIC . ? A MIC 302 ? 1_555 74.9 ? 11 NE2 ? A HIS 133 ? A HIS 147 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O6 ? C MIC . ? A MIC 302 ? 1_555 95.2 ? 12 NE2 ? A HIS 178 ? A HIS 192 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O6 ? C MIC . ? A MIC 302 ? 1_555 178.9 ? 13 NE2 ? A HIS 200 ? A HIS 214 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O6 ? C MIC . ? A MIC 302 ? 1_555 91.9 ? 14 O2 ? C MIC . ? A MIC 302 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O6 ? C MIC . ? A MIC 302 ? 1_555 79.3 ? 15 O7 ? C MIC . ? A MIC 302 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O6 ? C MIC . ? A MIC 302 ? 1_555 83.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-04-12 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 4.5557 _pdbx_refine_tls.origin_y 10.8511 _pdbx_refine_tls.origin_z -23.2557 _pdbx_refine_tls.T[1][1] 0.1263 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0627 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0918 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.2793 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.1396 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.2588 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.3228 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.2164 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.3664 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.0380 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.2091 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 3.1907 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.1272 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.5349 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.5054 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.1453 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0602 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.1651 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.5992 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.4355 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.1855 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 16 ? ? ? A 226 ? ? all 2 'X-RAY DIFFRACTION' 1 ? ? C 1 ? ? ? C 1 ? ? all 3 'X-RAY DIFFRACTION' 1 ? ? D 1 ? ? ? D 1 ? ? all 4 'X-RAY DIFFRACTION' 1 ? ? E 1 ? ? ? E 3 ? ? all 5 'X-RAY DIFFRACTION' 1 ? ? B 1 ? ? ? B 6 ? ? all 6 'X-RAY DIFFRACTION' 1 ? ? F 1 ? ? ? F 1 ? ? all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.1_4122 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7XP1 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 76 ? ? -118.21 -82.28 2 1 ASP A 143 ? ? -118.09 55.81 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 59 ? CG ? A GLU 45 CG 2 1 Y 1 A GLU 59 ? CD ? A GLU 45 CD 3 1 Y 1 A GLU 59 ? OE1 ? A GLU 45 OE1 4 1 Y 1 A GLU 59 ? OE2 ? A GLU 45 OE2 5 1 N 1 A GOL 306 ? O1 ? G GOL 1 O1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 15 ? A GLY 1 2 1 Y 1 A GLU 126 ? A GLU 112 3 1 Y 1 A ARG 127 ? A ARG 113 4 1 Y 1 A ASP 128 ? A ASP 114 5 1 Y 1 A GLU 129 ? A GLU 115 6 1 Y 1 A ALA 130 ? A ALA 116 7 1 Y 1 A PHE 131 ? A PHE 117 8 1 Y 1 A GLN 132 ? A GLN 118 9 1 Y 1 A ALA 133 ? A ALA 119 10 1 Y 1 A GLY 134 ? A GLY 120 11 1 Y 1 A ARG 135 ? A ARG 121 12 1 Y 1 A GLY 136 ? A GLY 122 13 1 Y 1 A TYR 137 ? A TYR 123 14 1 Y 1 A TYR 138 ? A TYR 124 15 1 Y 1 A GLU 227 ? A GLU 213 16 1 Y 1 A PRO 228 ? A PRO 214 17 1 Y 1 A GLN 229 ? A GLN 215 18 1 Y 1 A PRO 230 ? A PRO 216 19 1 Y 1 A ALA 231 ? A ALA 217 20 1 Y 1 A LYS 232 ? A LYS 218 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MET N N N N 244 MET CA C N S 245 MET C C N N 246 MET O O N N 247 MET CB C N N 248 MET CG C N N 249 MET SD S N N 250 MET CE C N N 251 MET OXT O N N 252 MET H H N N 253 MET H2 H N N 254 MET HA H N N 255 MET HB2 H N N 256 MET HB3 H N N 257 MET HG2 H N N 258 MET HG3 H N N 259 MET HE1 H N N 260 MET HE2 H N N 261 MET HE3 H N N 262 MET HXT H N N 263 MIC C1 C N N 264 MIC O1 O N N 265 MIC O2 O N N 266 MIC C2 C N R 267 MIC CM2 C N N 268 MIC O7 O N N 269 MIC C3 C N S 270 MIC C4 C N N 271 MIC C5 C N N 272 MIC O3 O N N 273 MIC O4 O N N 274 MIC C6 C N N 275 MIC O5 O N N 276 MIC O6 O N N 277 MIC HO2 H N N 278 MIC HM21 H N N 279 MIC HM22 H N N 280 MIC HM23 H N N 281 MIC HO7 H N N 282 MIC H3 H N N 283 MIC H41 H N N 284 MIC H42 H N N 285 MIC HO4 H N N 286 MIC HO6 H N N 287 PHE N N N N 288 PHE CA C N S 289 PHE C C N N 290 PHE O O N N 291 PHE CB C N N 292 PHE CG C Y N 293 PHE CD1 C Y N 294 PHE CD2 C Y N 295 PHE CE1 C Y N 296 PHE CE2 C Y N 297 PHE CZ C Y N 298 PHE OXT O N N 299 PHE H H N N 300 PHE H2 H N N 301 PHE HA H N N 302 PHE HB2 H N N 303 PHE HB3 H N N 304 PHE HD1 H N N 305 PHE HD2 H N N 306 PHE HE1 H N N 307 PHE HE2 H N N 308 PHE HZ H N N 309 PHE HXT H N N 310 PRO N N N N 311 PRO CA C N S 312 PRO C C N N 313 PRO O O N N 314 PRO CB C N N 315 PRO CG C N N 316 PRO CD C N N 317 PRO OXT O N N 318 PRO H H N N 319 PRO HA H N N 320 PRO HB2 H N N 321 PRO HB3 H N N 322 PRO HG2 H N N 323 PRO HG3 H N N 324 PRO HD2 H N N 325 PRO HD3 H N N 326 PRO HXT H N N 327 SER N N N N 328 SER CA C N S 329 SER C C N N 330 SER O O N N 331 SER CB C N N 332 SER OG O N N 333 SER OXT O N N 334 SER H H N N 335 SER H2 H N N 336 SER HA H N N 337 SER HB2 H N N 338 SER HB3 H N N 339 SER HG H N N 340 SER HXT H N N 341 SO4 S S N N 342 SO4 O1 O N N 343 SO4 O2 O N N 344 SO4 O3 O N N 345 SO4 O4 O N N 346 THR N N N N 347 THR CA C N S 348 THR C C N N 349 THR O O N N 350 THR CB C N R 351 THR OG1 O N N 352 THR CG2 C N N 353 THR OXT O N N 354 THR H H N N 355 THR H2 H N N 356 THR HA H N N 357 THR HB H N N 358 THR HG1 H N N 359 THR HG21 H N N 360 THR HG22 H N N 361 THR HG23 H N N 362 THR HXT H N N 363 TYR N N N N 364 TYR CA C N S 365 TYR C C N N 366 TYR O O N N 367 TYR CB C N N 368 TYR CG C Y N 369 TYR CD1 C Y N 370 TYR CD2 C Y N 371 TYR CE1 C Y N 372 TYR CE2 C Y N 373 TYR CZ C Y N 374 TYR OH O N N 375 TYR OXT O N N 376 TYR H H N N 377 TYR H2 H N N 378 TYR HA H N N 379 TYR HB2 H N N 380 TYR HB3 H N N 381 TYR HD1 H N N 382 TYR HD2 H N N 383 TYR HE1 H N N 384 TYR HE2 H N N 385 TYR HH H N N 386 TYR HXT H N N 387 VAL N N N N 388 VAL CA C N S 389 VAL C C N N 390 VAL O O N N 391 VAL CB C N N 392 VAL CG1 C N N 393 VAL CG2 C N N 394 VAL OXT O N N 395 VAL H H N N 396 VAL H2 H N N 397 VAL HA H N N 398 VAL HB H N N 399 VAL HG11 H N N 400 VAL HG12 H N N 401 VAL HG13 H N N 402 VAL HG21 H N N 403 VAL HG22 H N N 404 VAL HG23 H N N 405 VAL HXT H N N 406 ZN ZN ZN N N 407 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 MIC C1 O1 doub N N 250 MIC C1 O2 sing N N 251 MIC C1 C2 sing N N 252 MIC O2 HO2 sing N N 253 MIC C2 CM2 sing N N 254 MIC C2 O7 sing N N 255 MIC C2 C3 sing N N 256 MIC CM2 HM21 sing N N 257 MIC CM2 HM22 sing N N 258 MIC CM2 HM23 sing N N 259 MIC O7 HO7 sing N N 260 MIC C3 C4 sing N N 261 MIC C3 C6 sing N N 262 MIC C3 H3 sing N N 263 MIC C4 C5 sing N N 264 MIC C4 H41 sing N N 265 MIC C4 H42 sing N N 266 MIC C5 O3 doub N N 267 MIC C5 O4 sing N N 268 MIC O4 HO4 sing N N 269 MIC C6 O5 doub N N 270 MIC C6 O6 sing N N 271 MIC O6 HO6 sing N N 272 PHE N CA sing N N 273 PHE N H sing N N 274 PHE N H2 sing N N 275 PHE CA C sing N N 276 PHE CA CB sing N N 277 PHE CA HA sing N N 278 PHE C O doub N N 279 PHE C OXT sing N N 280 PHE CB CG sing N N 281 PHE CB HB2 sing N N 282 PHE CB HB3 sing N N 283 PHE CG CD1 doub Y N 284 PHE CG CD2 sing Y N 285 PHE CD1 CE1 sing Y N 286 PHE CD1 HD1 sing N N 287 PHE CD2 CE2 doub Y N 288 PHE CD2 HD2 sing N N 289 PHE CE1 CZ doub Y N 290 PHE CE1 HE1 sing N N 291 PHE CE2 CZ sing Y N 292 PHE CE2 HE2 sing N N 293 PHE CZ HZ sing N N 294 PHE OXT HXT sing N N 295 PRO N CA sing N N 296 PRO N CD sing N N 297 PRO N H sing N N 298 PRO CA C sing N N 299 PRO CA CB sing N N 300 PRO CA HA sing N N 301 PRO C O doub N N 302 PRO C OXT sing N N 303 PRO CB CG sing N N 304 PRO CB HB2 sing N N 305 PRO CB HB3 sing N N 306 PRO CG CD sing N N 307 PRO CG HG2 sing N N 308 PRO CG HG3 sing N N 309 PRO CD HD2 sing N N 310 PRO CD HD3 sing N N 311 PRO OXT HXT sing N N 312 SER N CA sing N N 313 SER N H sing N N 314 SER N H2 sing N N 315 SER CA C sing N N 316 SER CA CB sing N N 317 SER CA HA sing N N 318 SER C O doub N N 319 SER C OXT sing N N 320 SER CB OG sing N N 321 SER CB HB2 sing N N 322 SER CB HB3 sing N N 323 SER OG HG sing N N 324 SER OXT HXT sing N N 325 SO4 S O1 doub N N 326 SO4 S O2 doub N N 327 SO4 S O3 sing N N 328 SO4 S O4 sing N N 329 THR N CA sing N N 330 THR N H sing N N 331 THR N H2 sing N N 332 THR CA C sing N N 333 THR CA CB sing N N 334 THR CA HA sing N N 335 THR C O doub N N 336 THR C OXT sing N N 337 THR CB OG1 sing N N 338 THR CB CG2 sing N N 339 THR CB HB sing N N 340 THR OG1 HG1 sing N N 341 THR CG2 HG21 sing N N 342 THR CG2 HG22 sing N N 343 THR CG2 HG23 sing N N 344 THR OXT HXT sing N N 345 TYR N CA sing N N 346 TYR N H sing N N 347 TYR N H2 sing N N 348 TYR CA C sing N N 349 TYR CA CB sing N N 350 TYR CA HA sing N N 351 TYR C O doub N N 352 TYR C OXT sing N N 353 TYR CB CG sing N N 354 TYR CB HB2 sing N N 355 TYR CB HB3 sing N N 356 TYR CG CD1 doub Y N 357 TYR CG CD2 sing Y N 358 TYR CD1 CE1 sing Y N 359 TYR CD1 HD1 sing N N 360 TYR CD2 CE2 doub Y N 361 TYR CD2 HD2 sing N N 362 TYR CE1 CZ doub Y N 363 TYR CE1 HE1 sing N N 364 TYR CE2 CZ sing Y N 365 TYR CE2 HE2 sing N N 366 TYR CZ OH sing N N 367 TYR OH HH sing N N 368 TYR OXT HXT sing N N 369 VAL N CA sing N N 370 VAL N H sing N N 371 VAL N H2 sing N N 372 VAL CA C sing N N 373 VAL CA CB sing N N 374 VAL CA HA sing N N 375 VAL C O doub N N 376 VAL C OXT sing N N 377 VAL CB CG1 sing N N 378 VAL CB CG2 sing N N 379 VAL CB HB sing N N 380 VAL CG1 HG11 sing N N 381 VAL CG1 HG12 sing N N 382 VAL CG1 HG13 sing N N 383 VAL CG2 HG21 sing N N 384 VAL CG2 HG22 sing N N 385 VAL CG2 HG23 sing N N 386 VAL OXT HXT sing N N 387 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 GOL ? ? GOL ? ? 'SUBJECT OF INVESTIGATION' ? 2 MIC ? ? MIC ? ? 'SUBJECT OF INVESTIGATION' ? 3 SO4 ? ? SO4 ? ? 'SUBJECT OF INVESTIGATION' ? 4 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'ALPHA-METHYLISOCITRIC ACID' MIC 4 'SULFATE ION' SO4 5 GLYCEROL GOL 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7XP0 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #