data_7Y90 # _entry.id 7Y90 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7Y90 pdb_00007y90 10.2210/pdb7y90/pdb WWPDB D_1300030500 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-11-15 2 'Structure model' 1 1 2024-02-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7Y90 _pdbx_database_status.recvd_initial_deposition_date 2022-06-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email lifengwei@sdu.edu.cn _pdbx_contact_author.name_first Fengwei _pdbx_contact_author.name_last Li _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7143-4151 # _audit_author.name 'Li, F.W.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-7143-4151 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 15 _citation.language ? _citation.page_first 1476 _citation.page_last 1476 _citation.title 'Cyclic peptides discriminate BCL-2 and its clinical mutants from BCL-X L by engaging a single-residue discrepancy.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-024-45848-1 _citation.pdbx_database_id_PubMed 38368459 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, F.' 1 0000-0002-7143-4151 primary 'Liu, J.' 2 ? primary 'Liu, C.' 3 ? primary 'Liu, Z.' 4 ? primary 'Peng, X.' 5 ? primary 'Huang, Y.' 6 ? primary 'Chen, X.' 7 ? primary 'Sun, X.' 8 ? primary 'Wang, S.' 9 ? primary 'Chen, W.' 10 ? primary 'Xiong, D.' 11 ? primary 'Diao, X.' 12 0000-0001-8449-6688 primary 'Wang, S.' 13 ? primary 'Zhuang, J.' 14 ? primary 'Wu, C.' 15 0000-0003-2946-7299 primary 'Wu, D.' 16 0000-0003-1817-7229 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Apoptosis regulator Bcl-2' 19427.646 1 ? ? ? ? 2 polymer syn 'cp1 peptide' 1361.506 1 ? ? ? ? 3 non-polymer syn ;(2R)-3-[2-(aminomethyl)-3-azanyl-1-[4-[2-(2-chloranylethanoylamino)ethylcarbamoyl]phenyl]prop-1-enyl]sulfanyl-2-(carboxyamino)propanoic acid ; 487.958 1 ? ? ? ? 4 water nat water 18.015 87 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDDVEENRTEAPEGTESEVVHLTLRQAGDDFERRYRRDFAEMSSQLHL TPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDVFVEL YGPSMR ; ;MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDDVEENRTEAPEGTESEVVHLTLRQAGDDFERRYRRDFAEMSSQLHL TPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDVFVEL YGPSMR ; A ? 2 'polypeptide(L)' no yes 'CPARYGWDYEC(NH2)' CPARYGWDYECX B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 ;(2R)-3-[2-(aminomethyl)-3-azanyl-1-[4-[2-(2-chloranylethanoylamino)ethylcarbamoyl]phenyl]prop-1-enyl]sulfanyl-2-(carboxyamino)propanoic acid ; JFF 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 ALA n 1 5 GLY n 1 6 ARG n 1 7 THR n 1 8 GLY n 1 9 TYR n 1 10 ASP n 1 11 ASN n 1 12 ARG n 1 13 GLU n 1 14 ILE n 1 15 VAL n 1 16 MET n 1 17 LYS n 1 18 TYR n 1 19 ILE n 1 20 HIS n 1 21 TYR n 1 22 LYS n 1 23 LEU n 1 24 SER n 1 25 GLN n 1 26 ARG n 1 27 GLY n 1 28 TYR n 1 29 GLU n 1 30 TRP n 1 31 ASP n 1 32 ALA n 1 33 GLY n 1 34 ASP n 1 35 ASP n 1 36 VAL n 1 37 GLU n 1 38 GLU n 1 39 ASN n 1 40 ARG n 1 41 THR n 1 42 GLU n 1 43 ALA n 1 44 PRO n 1 45 GLU n 1 46 GLY n 1 47 THR n 1 48 GLU n 1 49 SER n 1 50 GLU n 1 51 VAL n 1 52 VAL n 1 53 HIS n 1 54 LEU n 1 55 THR n 1 56 LEU n 1 57 ARG n 1 58 GLN n 1 59 ALA n 1 60 GLY n 1 61 ASP n 1 62 ASP n 1 63 PHE n 1 64 GLU n 1 65 ARG n 1 66 ARG n 1 67 TYR n 1 68 ARG n 1 69 ARG n 1 70 ASP n 1 71 PHE n 1 72 ALA n 1 73 GLU n 1 74 MET n 1 75 SER n 1 76 SER n 1 77 GLN n 1 78 LEU n 1 79 HIS n 1 80 LEU n 1 81 THR n 1 82 PRO n 1 83 PHE n 1 84 THR n 1 85 ALA n 1 86 ARG n 1 87 GLY n 1 88 ARG n 1 89 PHE n 1 90 ALA n 1 91 THR n 1 92 VAL n 1 93 VAL n 1 94 GLU n 1 95 GLU n 1 96 LEU n 1 97 PHE n 1 98 ARG n 1 99 ASP n 1 100 GLY n 1 101 VAL n 1 102 ASN n 1 103 TRP n 1 104 GLY n 1 105 ARG n 1 106 ILE n 1 107 VAL n 1 108 ALA n 1 109 PHE n 1 110 PHE n 1 111 GLU n 1 112 PHE n 1 113 GLY n 1 114 GLY n 1 115 VAL n 1 116 MET n 1 117 CYS n 1 118 VAL n 1 119 GLU n 1 120 SER n 1 121 VAL n 1 122 ASN n 1 123 ARG n 1 124 GLU n 1 125 MET n 1 126 SER n 1 127 PRO n 1 128 LEU n 1 129 VAL n 1 130 ASP n 1 131 ASN n 1 132 ILE n 1 133 ALA n 1 134 LEU n 1 135 TRP n 1 136 MET n 1 137 THR n 1 138 GLU n 1 139 TYR n 1 140 LEU n 1 141 ASN n 1 142 ARG n 1 143 HIS n 1 144 LEU n 1 145 HIS n 1 146 THR n 1 147 TRP n 1 148 ILE n 1 149 GLN n 1 150 ASP n 1 151 ASN n 1 152 GLY n 1 153 GLY n 1 154 TRP n 1 155 ASP n 1 156 VAL n 1 157 PHE n 1 158 VAL n 1 159 GLU n 1 160 LEU n 1 161 TYR n 1 162 GLY n 1 163 PRO n 1 164 SER n 1 165 MET n 1 166 ARG n 2 1 CYS n 2 2 PRO n 2 3 ALA n 2 4 ARG n 2 5 TYR n 2 6 GLY n 2 7 TRP n 2 8 ASP n 2 9 TYR n 2 10 GLU n 2 11 CYS n 2 12 NH2 n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 50 human ? BCL2 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia phage EcSzw_1' 2419742 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 51 166 human ? BCL2 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia phage EcSzw_1' 2419742 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 12 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 JFF non-polymer . ;(2R)-3-[2-(aminomethyl)-3-azanyl-1-[4-[2-(2-chloranylethanoylamino)ethylcarbamoyl]phenyl]prop-1-enyl]sulfanyl-2-(carboxyamino)propanoic acid ; ? 'C19 H26 Cl N5 O6 S' 487.958 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 ALA 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 ARG 6 6 ? ? ? A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 GLU 29 70 ? ? ? A . n A 1 30 TRP 30 71 ? ? ? A . n A 1 31 ASP 31 72 ? ? ? A . n A 1 32 ALA 32 73 ? ? ? A . n A 1 33 GLY 33 74 ? ? ? A . n A 1 34 ASP 34 75 ? ? ? A . n A 1 35 ASP 35 76 ? ? ? A . n A 1 36 VAL 36 77 ? ? ? A . n A 1 37 GLU 37 78 ? ? ? A . n A 1 38 GLU 38 79 ? ? ? A . n A 1 39 ASN 39 80 ? ? ? A . n A 1 40 ARG 40 81 ? ? ? A . n A 1 41 THR 41 82 ? ? ? A . n A 1 42 GLU 42 83 ? ? ? A . n A 1 43 ALA 43 84 ? ? ? A . n A 1 44 PRO 44 85 ? ? ? A . n A 1 45 GLU 45 86 ? ? ? A . n A 1 46 GLY 46 87 ? ? ? A . n A 1 47 THR 47 88 88 THR THR A . n A 1 48 GLU 48 89 89 GLU GLU A . n A 1 49 SER 49 90 90 SER SER A . n A 1 50 GLU 50 91 91 GLU GLU A . n A 1 51 VAL 51 92 92 VAL VAL A . n A 1 52 VAL 52 93 93 VAL VAL A . n A 1 53 HIS 53 94 94 HIS HIS A . n A 1 54 LEU 54 95 95 LEU LEU A . n A 1 55 THR 55 96 96 THR THR A . n A 1 56 LEU 56 97 97 LEU LEU A . n A 1 57 ARG 57 98 98 ARG ARG A . n A 1 58 GLN 58 99 99 GLN GLN A . n A 1 59 ALA 59 100 100 ALA ALA A . n A 1 60 GLY 60 101 101 GLY GLY A . n A 1 61 ASP 61 102 102 ASP ASP A . n A 1 62 ASP 62 103 103 ASP ASP A . n A 1 63 PHE 63 104 104 PHE PHE A . n A 1 64 GLU 64 105 105 GLU GLU A . n A 1 65 ARG 65 106 106 ARG ARG A . n A 1 66 ARG 66 107 107 ARG ARG A . n A 1 67 TYR 67 108 108 TYR TYR A . n A 1 68 ARG 68 109 109 ARG ARG A . n A 1 69 ARG 69 110 110 ARG ARG A . n A 1 70 ASP 70 111 111 ASP ASP A . n A 1 71 PHE 71 112 112 PHE PHE A . n A 1 72 ALA 72 113 113 ALA ALA A . n A 1 73 GLU 73 114 114 GLU GLU A . n A 1 74 MET 74 115 115 MET MET A . n A 1 75 SER 75 116 116 SER SER A . n A 1 76 SER 76 117 117 SER SER A . n A 1 77 GLN 77 118 118 GLN GLN A . n A 1 78 LEU 78 119 119 LEU LEU A . n A 1 79 HIS 79 120 120 HIS HIS A . n A 1 80 LEU 80 121 121 LEU LEU A . n A 1 81 THR 81 122 122 THR THR A . n A 1 82 PRO 82 123 123 PRO PRO A . n A 1 83 PHE 83 124 124 PHE PHE A . n A 1 84 THR 84 125 125 THR THR A . n A 1 85 ALA 85 126 126 ALA ALA A . n A 1 86 ARG 86 127 127 ARG ARG A . n A 1 87 GLY 87 128 128 GLY GLY A . n A 1 88 ARG 88 129 129 ARG ARG A . n A 1 89 PHE 89 130 130 PHE PHE A . n A 1 90 ALA 90 131 131 ALA ALA A . n A 1 91 THR 91 132 132 THR THR A . n A 1 92 VAL 92 133 133 VAL VAL A . n A 1 93 VAL 93 134 134 VAL VAL A . n A 1 94 GLU 94 135 135 GLU GLU A . n A 1 95 GLU 95 136 136 GLU GLU A . n A 1 96 LEU 96 137 137 LEU LEU A . n A 1 97 PHE 97 138 138 PHE PHE A . n A 1 98 ARG 98 139 139 ARG ARG A . n A 1 99 ASP 99 140 140 ASP ASP A . n A 1 100 GLY 100 141 141 GLY GLY A . n A 1 101 VAL 101 142 142 VAL VAL A . n A 1 102 ASN 102 143 143 ASN ASN A . n A 1 103 TRP 103 144 144 TRP TRP A . n A 1 104 GLY 104 145 145 GLY GLY A . n A 1 105 ARG 105 146 146 ARG ARG A . n A 1 106 ILE 106 147 147 ILE ILE A . n A 1 107 VAL 107 148 148 VAL VAL A . n A 1 108 ALA 108 149 149 ALA ALA A . n A 1 109 PHE 109 150 150 PHE PHE A . n A 1 110 PHE 110 151 151 PHE PHE A . n A 1 111 GLU 111 152 152 GLU GLU A . n A 1 112 PHE 112 153 153 PHE PHE A . n A 1 113 GLY 113 154 154 GLY GLY A . n A 1 114 GLY 114 155 155 GLY GLY A . n A 1 115 VAL 115 156 156 VAL VAL A . n A 1 116 MET 116 157 157 MET MET A . n A 1 117 CYS 117 158 158 CYS CYS A . n A 1 118 VAL 118 159 159 VAL VAL A . n A 1 119 GLU 119 160 160 GLU GLU A . n A 1 120 SER 120 161 161 SER SER A . n A 1 121 VAL 121 162 162 VAL VAL A . n A 1 122 ASN 122 163 163 ASN ASN A . n A 1 123 ARG 123 164 164 ARG ARG A . n A 1 124 GLU 124 165 165 GLU GLU A . n A 1 125 MET 125 166 166 MET MET A . n A 1 126 SER 126 167 167 SER SER A . n A 1 127 PRO 127 168 168 PRO PRO A . n A 1 128 LEU 128 169 169 LEU LEU A . n A 1 129 VAL 129 170 170 VAL VAL A . n A 1 130 ASP 130 171 171 ASP ASP A . n A 1 131 ASN 131 172 172 ASN ASN A . n A 1 132 ILE 132 173 173 ILE ILE A . n A 1 133 ALA 133 174 174 ALA ALA A . n A 1 134 LEU 134 175 175 LEU LEU A . n A 1 135 TRP 135 176 176 TRP TRP A . n A 1 136 MET 136 177 177 MET MET A . n A 1 137 THR 137 178 178 THR THR A . n A 1 138 GLU 138 179 179 GLU GLU A . n A 1 139 TYR 139 180 180 TYR TYR A . n A 1 140 LEU 140 181 181 LEU LEU A . n A 1 141 ASN 141 182 182 ASN ASN A . n A 1 142 ARG 142 183 183 ARG ARG A . n A 1 143 HIS 143 184 184 HIS HIS A . n A 1 144 LEU 144 185 185 LEU LEU A . n A 1 145 HIS 145 186 186 HIS HIS A . n A 1 146 THR 146 187 187 THR THR A . n A 1 147 TRP 147 188 188 TRP TRP A . n A 1 148 ILE 148 189 189 ILE ILE A . n A 1 149 GLN 149 190 190 GLN GLN A . n A 1 150 ASP 150 191 191 ASP ASP A . n A 1 151 ASN 151 192 192 ASN ASN A . n A 1 152 GLY 152 193 193 GLY GLY A . n A 1 153 GLY 153 194 194 GLY GLY A . n A 1 154 TRP 154 195 195 TRP TRP A . n A 1 155 ASP 155 196 196 ASP ASP A . n A 1 156 VAL 156 197 197 VAL VAL A . n A 1 157 PHE 157 198 198 PHE PHE A . n A 1 158 VAL 158 199 199 VAL VAL A . n A 1 159 GLU 159 200 200 GLU GLU A . n A 1 160 LEU 160 201 201 LEU LEU A . n A 1 161 TYR 161 202 202 TYR TYR A . n A 1 162 GLY 162 203 203 GLY GLY A . n A 1 163 PRO 163 204 ? ? ? A . n A 1 164 SER 164 205 ? ? ? A . n A 1 165 MET 165 206 ? ? ? A . n A 1 166 ARG 166 207 ? ? ? A . n B 2 1 CYS 1 1 1 CYS LIG B . n B 2 2 PRO 2 2 1 PRO LIG B . n B 2 3 ALA 3 3 1 ALA LIG B . n B 2 4 ARG 4 4 1 ARG LIG B . n B 2 5 TYR 5 5 1 TYR LIG B . n B 2 6 GLY 6 6 1 GLY LIG B . n B 2 7 TRP 7 7 1 TRP LIG B . n B 2 8 ASP 8 8 1 ASP LIG B . n B 2 9 TYR 9 9 1 TYR LIG B . n B 2 10 GLU 10 10 1 GLU LIG B . n B 2 11 CYS 11 11 1 CYS LIG B . n B 2 12 NH2 12 12 1 NH2 LIG B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 JFF 1 101 1 JFF LIG B . D 4 HOH 1 301 43 HOH HOH A . D 4 HOH 2 302 8 HOH HOH A . D 4 HOH 3 303 87 HOH HOH A . D 4 HOH 4 304 71 HOH HOH A . D 4 HOH 5 305 53 HOH HOH A . D 4 HOH 6 306 17 HOH HOH A . D 4 HOH 7 307 47 HOH HOH A . D 4 HOH 8 308 13 HOH HOH A . D 4 HOH 9 309 10 HOH HOH A . D 4 HOH 10 310 14 HOH HOH A . D 4 HOH 11 311 28 HOH HOH A . D 4 HOH 12 312 70 HOH HOH A . D 4 HOH 13 313 4 HOH HOH A . D 4 HOH 14 314 80 HOH HOH A . D 4 HOH 15 315 88 HOH HOH A . D 4 HOH 16 316 30 HOH HOH A . D 4 HOH 17 317 73 HOH HOH A . D 4 HOH 18 318 5 HOH HOH A . D 4 HOH 19 319 35 HOH HOH A . D 4 HOH 20 320 33 HOH HOH A . D 4 HOH 21 321 81 HOH HOH A . D 4 HOH 22 322 1 HOH HOH A . D 4 HOH 23 323 83 HOH HOH A . D 4 HOH 24 324 24 HOH HOH A . D 4 HOH 25 325 65 HOH HOH A . D 4 HOH 26 326 32 HOH HOH A . D 4 HOH 27 327 57 HOH HOH A . D 4 HOH 28 328 21 HOH HOH A . D 4 HOH 29 329 67 HOH HOH A . D 4 HOH 30 330 6 HOH HOH A . D 4 HOH 31 331 22 HOH HOH A . D 4 HOH 32 332 29 HOH HOH A . D 4 HOH 33 333 9 HOH HOH A . D 4 HOH 34 334 25 HOH HOH A . D 4 HOH 35 335 84 HOH HOH A . D 4 HOH 36 336 82 HOH HOH A . D 4 HOH 37 337 72 HOH HOH A . D 4 HOH 38 338 3 HOH HOH A . D 4 HOH 39 339 31 HOH HOH A . D 4 HOH 40 340 44 HOH HOH A . D 4 HOH 41 341 36 HOH HOH A . D 4 HOH 42 342 20 HOH HOH A . D 4 HOH 43 343 76 HOH HOH A . D 4 HOH 44 344 38 HOH HOH A . D 4 HOH 45 345 34 HOH HOH A . D 4 HOH 46 346 68 HOH HOH A . D 4 HOH 47 347 18 HOH HOH A . D 4 HOH 48 348 51 HOH HOH A . D 4 HOH 49 349 41 HOH HOH A . D 4 HOH 50 350 75 HOH HOH A . D 4 HOH 51 351 37 HOH HOH A . D 4 HOH 52 352 55 HOH HOH A . D 4 HOH 53 353 45 HOH HOH A . D 4 HOH 54 354 66 HOH HOH A . D 4 HOH 55 355 2 HOH HOH A . D 4 HOH 56 356 49 HOH HOH A . D 4 HOH 57 357 79 HOH HOH A . D 4 HOH 58 358 7 HOH HOH A . D 4 HOH 59 359 16 HOH HOH A . D 4 HOH 60 360 50 HOH HOH A . D 4 HOH 61 361 69 HOH HOH A . D 4 HOH 62 362 61 HOH HOH A . D 4 HOH 63 363 42 HOH HOH A . D 4 HOH 64 364 48 HOH HOH A . D 4 HOH 65 365 59 HOH HOH A . D 4 HOH 66 366 23 HOH HOH A . D 4 HOH 67 367 11 HOH HOH A . D 4 HOH 68 368 56 HOH HOH A . D 4 HOH 69 369 26 HOH HOH A . D 4 HOH 70 370 58 HOH HOH A . D 4 HOH 71 371 63 HOH HOH A . D 4 HOH 72 372 40 HOH HOH A . D 4 HOH 73 373 46 HOH HOH A . D 4 HOH 74 374 54 HOH HOH A . D 4 HOH 75 375 52 HOH HOH A . D 4 HOH 76 376 19 HOH HOH A . D 4 HOH 77 377 64 HOH HOH A . D 4 HOH 78 378 85 HOH HOH A . D 4 HOH 79 379 60 HOH HOH A . D 4 HOH 80 380 62 HOH HOH A . D 4 HOH 81 381 77 HOH HOH A . E 4 HOH 1 201 12 HOH HOH B . E 4 HOH 2 202 86 HOH HOH B . E 4 HOH 3 203 15 HOH HOH B . E 4 HOH 4 204 39 HOH HOH B . E 4 HOH 5 205 27 HOH HOH B . E 4 HOH 6 206 74 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 7 ? OG1 ? A THR 7 OG1 2 1 Y 1 A THR 7 ? CG2 ? A THR 7 CG2 3 1 Y 1 A TYR 9 ? CG ? A TYR 9 CG 4 1 Y 1 A TYR 9 ? CD1 ? A TYR 9 CD1 5 1 Y 1 A TYR 9 ? CD2 ? A TYR 9 CD2 6 1 Y 1 A TYR 9 ? CE1 ? A TYR 9 CE1 7 1 Y 1 A TYR 9 ? CE2 ? A TYR 9 CE2 8 1 Y 1 A TYR 9 ? CZ ? A TYR 9 CZ 9 1 Y 1 A TYR 9 ? OH ? A TYR 9 OH 10 1 Y 1 A MET 16 ? CG ? A MET 16 CG 11 1 Y 1 A MET 16 ? SD ? A MET 16 SD 12 1 Y 1 A MET 16 ? CE ? A MET 16 CE 13 1 Y 1 A HIS 20 ? CG ? A HIS 20 CG 14 1 Y 1 A HIS 20 ? ND1 ? A HIS 20 ND1 15 1 Y 1 A HIS 20 ? CD2 ? A HIS 20 CD2 16 1 Y 1 A HIS 20 ? CE1 ? A HIS 20 CE1 17 1 Y 1 A HIS 20 ? NE2 ? A HIS 20 NE2 18 1 Y 1 A GLU 89 ? CG ? A GLU 48 CG 19 1 Y 1 A GLU 89 ? CD ? A GLU 48 CD 20 1 Y 1 A GLU 89 ? OE1 ? A GLU 48 OE1 21 1 Y 1 A GLU 89 ? OE2 ? A GLU 48 OE2 22 1 Y 1 A ARG 106 ? CZ ? A ARG 65 CZ 23 1 Y 1 A ARG 106 ? NH1 ? A ARG 65 NH1 24 1 Y 1 A ARG 106 ? NH2 ? A ARG 65 NH2 25 1 Y 1 A ARG 110 ? CG ? A ARG 69 CG 26 1 Y 1 A ARG 110 ? CD ? A ARG 69 CD 27 1 Y 1 A ARG 110 ? NE ? A ARG 69 NE 28 1 Y 1 A ARG 110 ? CZ ? A ARG 69 CZ 29 1 Y 1 A ARG 110 ? NH1 ? A ARG 69 NH1 30 1 Y 1 A ARG 110 ? NH2 ? A ARG 69 NH2 31 1 Y 1 A PHE 124 ? CG ? A PHE 83 CG 32 1 Y 1 A PHE 124 ? CD1 ? A PHE 83 CD1 33 1 Y 1 A PHE 124 ? CD2 ? A PHE 83 CD2 34 1 Y 1 A PHE 124 ? CE1 ? A PHE 83 CE1 35 1 Y 1 A PHE 124 ? CE2 ? A PHE 83 CE2 36 1 Y 1 A PHE 124 ? CZ ? A PHE 83 CZ 37 1 Y 1 A GLU 152 ? OE1 ? A GLU 111 OE1 38 1 Y 1 A GLU 152 ? OE2 ? A GLU 111 OE2 39 1 Y 1 A GLU 179 ? CD ? A GLU 138 CD 40 1 Y 1 A GLU 179 ? OE1 ? A GLU 138 OE1 41 1 Y 1 A GLU 179 ? OE2 ? A GLU 138 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7Y90 _cell.details ? _cell.formula_units_Z ? _cell.length_a 65.602 _cell.length_a_esd ? _cell.length_b 99.611 _cell.length_b_esd ? _cell.length_c 52.456 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7Y90 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7Y90 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.21 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.23 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Bis-Tris pH6.5, 2.0M Ammonium Sulfate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-08 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Ni FILTER' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.987 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.987 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7Y90 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.09 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10380 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.978 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.109 _reflns.pdbx_Rpim_I_all 0.031 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.983 _reflns.pdbx_CC_star 0.996 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.105 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.10 2.14 ? ? ? ? ? ? 513 ? ? ? ? ? ? ? ? ? ? ? 10.5 0.958 ? ? 0.471 0.141 ? 1 1 0.975 0.994 ? 100.0 ? 0.448 ? ? ? ? ? ? ? ? ? 2.14 2.18 ? ? ? ? ? ? 488 ? ? ? ? ? ? ? ? ? ? ? 10.6 0.943 ? ? 0.429 0.130 ? 2 1 0.974 0.993 ? 100.0 ? 0.408 ? ? ? ? ? ? ? ? ? 2.18 2.22 ? ? ? ? ? ? 526 ? ? ? ? ? ? ? ? ? ? ? 11.4 0.980 ? ? 0.376 0.110 ? 3 1 0.979 0.995 ? 100.0 ? 0.360 ? ? ? ? ? ? ? ? ? 2.22 2.26 ? ? ? ? ? ? 500 ? ? ? ? ? ? ? ? ? ? ? 12.8 1.037 ? ? 0.349 0.097 ? 4 1 0.989 0.997 ? 100.0 ? 0.335 ? ? ? ? ? ? ? ? ? 2.26 2.31 ? ? ? ? ? ? 500 ? ? ? ? ? ? ? ? ? ? ? 13.1 1.015 ? ? 0.366 0.101 ? 5 1 0.981 0.995 ? 100.0 ? 0.351 ? ? ? ? ? ? ? ? ? 2.31 2.37 ? ? ? ? ? ? 502 ? ? ? ? ? ? ? ? ? ? ? 13.3 1.019 ? ? 0.318 0.087 ? 6 1 0.986 0.996 ? 100.0 ? 0.306 ? ? ? ? ? ? ? ? ? 2.37 2.42 ? ? ? ? ? ? 523 ? ? ? ? ? ? ? ? ? ? ? 13.2 1.008 ? ? 0.278 0.077 ? 7 1 0.989 0.997 ? 100.0 ? 0.267 ? ? ? ? ? ? ? ? ? 2.42 2.49 ? ? ? ? ? ? 522 ? ? ? ? ? ? ? ? ? ? ? 13.2 1.019 ? ? 0.261 0.072 ? 8 1 0.989 0.997 ? 100.0 ? 0.251 ? ? ? ? ? ? ? ? ? 2.49 2.56 ? ? ? ? ? ? 505 ? ? ? ? ? ? ? ? ? ? ? 13.3 1.053 ? ? 0.246 0.068 ? 9 1 0.991 0.998 ? 100.0 ? 0.236 ? ? ? ? ? ? ? ? ? 2.56 2.65 ? ? ? ? ? ? 508 ? ? ? ? ? ? ? ? ? ? ? 12.9 1.003 ? ? 0.202 0.056 ? 10 1 0.992 0.998 ? 100.0 ? 0.194 ? ? ? ? ? ? ? ? ? 2.65 2.74 ? ? ? ? ? ? 523 ? ? ? ? ? ? ? ? ? ? ? 12.1 1.100 ? ? 0.174 0.050 ? 11 1 0.996 0.999 ? 100.0 ? 0.167 ? ? ? ? ? ? ? ? ? 2.74 2.85 ? ? ? ? ? ? 518 ? ? ? ? ? ? ? ? ? ? ? 11.9 1.045 ? ? 0.163 0.047 ? 12 1 0.993 0.998 ? 100.0 ? 0.156 ? ? ? ? ? ? ? ? ? 2.85 2.98 ? ? ? ? ? ? 515 ? ? ? ? ? ? ? ? ? ? ? 13.4 1.016 ? ? 0.143 0.039 ? 13 1 0.993 0.998 ? 100.0 ? 0.138 ? ? ? ? ? ? ? ? ? 2.98 3.14 ? ? ? ? ? ? 519 ? ? ? ? ? ? ? ? ? ? ? 13.5 1.023 ? ? 0.127 0.035 ? 14 1 0.995 0.999 ? 100.0 ? 0.122 ? ? ? ? ? ? ? ? ? 3.14 3.33 ? ? ? ? ? ? 522 ? ? ? ? ? ? ? ? ? ? ? 13.2 0.960 ? ? 0.109 0.030 ? 15 1 0.997 0.999 ? 100.0 ? 0.105 ? ? ? ? ? ? ? ? ? 3.33 3.59 ? ? ? ? ? ? 516 ? ? ? ? ? ? ? ? ? ? ? 13.1 0.982 ? ? 0.096 0.027 ? 16 1 0.996 0.999 ? 100.0 ? 0.092 ? ? ? ? ? ? ? ? ? 3.59 3.95 ? ? ? ? ? ? 528 ? ? ? ? ? ? ? ? ? ? ? 12.1 1.009 ? ? 0.091 0.026 ? 17 1 0.998 0.999 ? 100.0 ? 0.087 ? ? ? ? ? ? ? ? ? 3.95 4.52 ? ? ? ? ? ? 530 ? ? ? ? ? ? ? ? ? ? ? 12.0 0.834 ? ? 0.082 0.024 ? 18 1 0.998 0.999 ? 100.0 ? 0.078 ? ? ? ? ? ? ? ? ? 4.52 5.70 ? ? ? ? ? ? 541 ? ? ? ? ? ? ? ? ? ? ? 13.0 0.743 ? ? 0.077 0.021 ? 19 1 0.995 0.999 ? 100.0 ? 0.074 ? ? ? ? ? ? ? ? ? 5.70 50.00 ? ? ? ? ? ? 581 ? ? ? ? ? ? ? ? ? ? ? 11.4 0.821 ? ? 0.084 0.025 ? 20 1 0.993 0.998 ? 100.0 ? 0.080 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 0.68 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -0.10 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.58 _refine.B_iso_max ? _refine.B_iso_mean 25.136 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.921 _refine.correlation_coeff_Fo_to_Fc_free 0.861 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7Y90 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.09 _refine.ls_d_res_low 32.82 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9132 _refine.ls_number_reflns_R_free 488 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.07 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.22281 _refine.ls_R_factor_R_free 0.27562 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.22002 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.279 _refine.pdbx_overall_ESU_R_Free 0.228 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.383 _refine.overall_SU_ML 0.148 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.09 _refine_hist.d_res_low 32.82 _refine_hist.number_atoms_solvent 87 _refine_hist.number_atoms_total 1308 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1110 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 111 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.013 1254 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.018 1111 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.869 1.770 1699 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.401 1.689 2527 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.967 5.000 136 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.196 20.704 71 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.730 15.000 177 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 22.865 15.000 11 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.080 0.200 149 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 1417 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 340 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.946 2.428 549 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.947 2.428 547 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.962 3.619 684 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.961 3.619 684 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.354 2.828 704 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.351 2.827 705 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.059 4.119 1016 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.558 46.361 5313 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 7.559 46.358 5311 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.094 _refine_ls_shell.d_res_low 2.148 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 22 _refine_ls_shell.number_reflns_R_work 471 _refine_ls_shell.percent_reflns_obs 66.09 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.217 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.246 # _struct.entry_id 7Y90 _struct.title 'Crystal Structure Analysis of cp1 bound BCL2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7Y90 _struct_keywords.text 'BCL2, cp1, complex, APOPTOSIS' _struct_keywords.pdbx_keywords APOPTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP BCL2_HUMAN P10415 ? 1 MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGD 1 2 UNP BCL2_HUMAN P10415 ? 1 ;VVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVD NIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMR ; 92 3 PDB 7Y90 7Y90 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7Y90 A 1 ? 34 ? P10415 1 ? 34 ? 1 75 2 2 7Y90 A 51 ? 166 ? P10415 92 ? 207 ? 92 207 3 3 7Y90 B 1 ? 12 ? 7Y90 1 ? 12 ? 1 12 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7Y90 ASP A 35 ? UNP P10415 ? ? linker 76 1 1 7Y90 VAL A 36 ? UNP P10415 ? ? linker 77 2 1 7Y90 GLU A 37 ? UNP P10415 ? ? linker 78 3 1 7Y90 GLU A 38 ? UNP P10415 ? ? linker 79 4 1 7Y90 ASN A 39 ? UNP P10415 ? ? linker 80 5 1 7Y90 ARG A 40 ? UNP P10415 ? ? linker 81 6 1 7Y90 THR A 41 ? UNP P10415 ? ? linker 82 7 1 7Y90 GLU A 42 ? UNP P10415 ? ? linker 83 8 1 7Y90 ALA A 43 ? UNP P10415 ? ? linker 84 9 1 7Y90 PRO A 44 ? UNP P10415 ? ? linker 85 10 1 7Y90 GLU A 45 ? UNP P10415 ? ? linker 86 11 1 7Y90 GLY A 46 ? UNP P10415 ? ? linker 87 12 1 7Y90 THR A 47 ? UNP P10415 ? ? linker 88 13 1 7Y90 GLU A 48 ? UNP P10415 ? ? linker 89 14 1 7Y90 SER A 49 ? UNP P10415 ? ? linker 90 15 1 7Y90 GLU A 50 ? UNP P10415 ? ? linker 91 16 2 7Y90 GLU A 64 ? UNP P10415 SER 105 conflict 105 17 2 7Y90 VAL A 156 ? UNP P10415 ALA 197 conflict 197 18 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1370 ? 1 MORE -1 ? 1 'SSA (A^2)' 7630 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 7 ? ARG A 26 ? THR A 7 ARG A 26 1 ? 20 HELX_P HELX_P2 AA2 SER A 49 ? TYR A 67 ? SER A 90 TYR A 108 1 ? 19 HELX_P HELX_P3 AA3 TYR A 67 ? SER A 76 ? TYR A 108 SER A 117 1 ? 10 HELX_P HELX_P4 AA4 ALA A 85 ? PHE A 97 ? ALA A 126 PHE A 138 1 ? 13 HELX_P HELX_P5 AA5 ASN A 102 ? ARG A 123 ? ASN A 143 ARG A 164 1 ? 22 HELX_P HELX_P6 AA6 PRO A 127 ? LEU A 144 ? PRO A 168 LEU A 185 1 ? 18 HELX_P HELX_P7 AA7 LEU A 144 ? GLN A 149 ? LEU A 185 GLN A 190 1 ? 6 HELX_P HELX_P8 AA8 GLY A 152 ? GLY A 162 ? GLY A 193 GLY A 203 1 ? 11 HELX_P HELX_P9 AA9 TYR B 5 ? CYS B 11 ? TYR B 5 CYS B 11 5 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? B CYS 1 N ? ? ? 1_555 C JFF . C1 ? ? B CYS 1 B JFF 101 1_555 ? ? ? ? ? ? ? 1.407 ? ? covale2 covale none ? B CYS 1 SG ? ? ? 1_555 C JFF . C1 ? ? B CYS 1 B JFF 101 1_555 ? ? ? ? ? ? ? 1.624 ? ? covale3 covale both ? B CYS 11 C ? ? ? 1_555 B NH2 12 N ? ? B CYS 11 B NH2 12 1_555 ? ? ? ? ? ? ? 1.432 ? ? covale4 covale none ? B CYS 11 SG ? ? ? 1_555 C JFF . C19 ? ? B CYS 11 B JFF 101 1_555 ? ? ? ? ? ? ? 1.839 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB B CYS 1 ? ? SG B CYS 1 ? ? 1.712 1.812 -0.100 0.016 N 2 1 CA B CYS 1 ? ? C B CYS 1 ? ? 1.362 1.525 -0.163 0.026 N 3 1 NE B ARG 4 ? ? CZ B ARG 4 ? ? 1.428 1.326 0.102 0.013 N 4 1 CZ B ARG 4 ? ? NH2 B ARG 4 ? ? 1.460 1.326 0.134 0.013 N 5 1 CG B TYR 5 ? ? CD2 B TYR 5 ? ? 1.524 1.387 0.137 0.013 N 6 1 CG B TYR 5 ? ? CD1 B TYR 5 ? ? 1.530 1.387 0.143 0.013 N 7 1 CD1 B TYR 5 ? ? CE1 B TYR 5 ? ? 1.524 1.389 0.135 0.015 N 8 1 CE1 B TYR 5 ? ? CZ B TYR 5 ? ? 1.518 1.381 0.137 0.013 N 9 1 CZ B TYR 5 ? ? CE2 B TYR 5 ? ? 1.541 1.381 0.160 0.013 N 10 1 CE2 B TYR 5 ? ? CD2 B TYR 5 ? ? 1.509 1.389 0.120 0.015 N 11 1 CE2 B TRP 7 ? ? CZ2 B TRP 7 ? ? 1.562 1.393 0.169 0.017 N 12 1 CD2 B TRP 7 ? ? CE3 B TRP 7 ? ? 1.572 1.399 0.173 0.015 N 13 1 CE3 B TRP 7 ? ? CZ3 B TRP 7 ? ? 1.495 1.380 0.115 0.017 N 14 1 CG B TYR 9 ? ? CD2 B TYR 9 ? ? 1.516 1.387 0.129 0.013 N 15 1 CG B TYR 9 ? ? CD1 B TYR 9 ? ? 1.513 1.387 0.126 0.013 N 16 1 CD1 B TYR 9 ? ? CE1 B TYR 9 ? ? 1.511 1.389 0.122 0.015 N 17 1 CE1 B TYR 9 ? ? CZ B TYR 9 ? ? 1.514 1.381 0.133 0.013 N 18 1 CZ B TYR 9 ? ? CE2 B TYR 9 ? ? 1.508 1.381 0.127 0.013 N 19 1 CE2 B TYR 9 ? ? CD2 B TYR 9 ? ? 1.508 1.389 0.119 0.015 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ARG 127 ? ? CG A ARG 127 ? ? CD A ARG 127 ? ? 129.70 111.60 18.10 2.60 N 2 1 CB A GLU 135 ? ? CA A GLU 135 ? ? C A GLU 135 ? ? 98.13 110.40 -12.27 2.00 N 3 1 NE B ARG 4 ? ? CZ B ARG 4 ? ? NH2 B ARG 4 ? ? 116.66 120.30 -3.64 0.50 N 4 1 CA B TYR 9 ? ? CB B TYR 9 ? ? CG B TYR 9 ? ? 101.51 113.40 -11.89 1.90 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 90 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 78.34 _pdbx_validate_torsion.psi -5.20 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 368 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_entry_details.entry_id 7Y90 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 381 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.23 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A ALA 4 ? A ALA 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A ARG 6 ? A ARG 6 7 1 Y 1 A GLU 70 ? A GLU 29 8 1 Y 1 A TRP 71 ? A TRP 30 9 1 Y 1 A ASP 72 ? A ASP 31 10 1 Y 1 A ALA 73 ? A ALA 32 11 1 Y 1 A GLY 74 ? A GLY 33 12 1 Y 1 A ASP 75 ? A ASP 34 13 1 Y 1 A ASP 76 ? A ASP 35 14 1 Y 1 A VAL 77 ? A VAL 36 15 1 Y 1 A GLU 78 ? A GLU 37 16 1 Y 1 A GLU 79 ? A GLU 38 17 1 Y 1 A ASN 80 ? A ASN 39 18 1 Y 1 A ARG 81 ? A ARG 40 19 1 Y 1 A THR 82 ? A THR 41 20 1 Y 1 A GLU 83 ? A GLU 42 21 1 Y 1 A ALA 84 ? A ALA 43 22 1 Y 1 A PRO 85 ? A PRO 44 23 1 Y 1 A GLU 86 ? A GLU 45 24 1 Y 1 A GLY 87 ? A GLY 46 25 1 Y 1 A PRO 204 ? A PRO 163 26 1 Y 1 A SER 205 ? A SER 164 27 1 Y 1 A MET 206 ? A MET 165 28 1 Y 1 A ARG 207 ? A ARG 166 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 JFF C1 C N N 183 JFF C9 C Y N 184 JFF C10 C Y N 185 JFF C11 C Y N 186 JFF C12 C Y N 187 JFF C13 C Y N 188 JFF C14 C Y N 189 JFF C15 C N N 190 JFF O5 O N N 191 JFF N4 N N N 192 JFF C16 C N N 193 JFF C17 C N N 194 JFF N5 N N N 195 JFF C18 C N N 196 JFF O6 O N N 197 JFF C19 C N N 198 JFF H4 H N N 199 JFF H5 H N N 200 JFF H6 H N N 201 JFF H7 H N N 202 JFF H8 H N N 203 JFF H9 H N N 204 JFF H10 H N N 205 JFF H11 H N N 206 JFF H12 H N N 207 JFF H13 H N N 208 JFF H14 H N N 209 JFF H15 H N N 210 JFF S1 S N N 211 JFF C2 C N N 212 JFF C3 C N N 213 JFF C4 C N N 214 JFF N2 N N N 215 JFF N3 N N N 216 JFF C5 C N N 217 JFF C6 C N R 218 JFF C7 C N N 219 JFF O4 O N N 220 JFF O3 O N N 221 JFF N1 N N N 222 JFF C8 C N N 223 JFF O1 O N N 224 JFF O2 O N N 225 JFF CL1 CL N N 226 JFF H1 H N N 227 JFF H2 H N N 228 JFF H3 H N N 229 JFF H16 H N N 230 JFF H17 H N N 231 JFF H18 H N N 232 JFF H19 H N N 233 JFF H20 H N N 234 JFF H21 H N N 235 JFF H22 H N N 236 JFF H23 H N N 237 JFF H24 H N N 238 JFF H25 H N N 239 JFF H26 H N N 240 LEU N N N N 241 LEU CA C N S 242 LEU C C N N 243 LEU O O N N 244 LEU CB C N N 245 LEU CG C N N 246 LEU CD1 C N N 247 LEU CD2 C N N 248 LEU OXT O N N 249 LEU H H N N 250 LEU H2 H N N 251 LEU HA H N N 252 LEU HB2 H N N 253 LEU HB3 H N N 254 LEU HG H N N 255 LEU HD11 H N N 256 LEU HD12 H N N 257 LEU HD13 H N N 258 LEU HD21 H N N 259 LEU HD22 H N N 260 LEU HD23 H N N 261 LEU HXT H N N 262 LYS N N N N 263 LYS CA C N S 264 LYS C C N N 265 LYS O O N N 266 LYS CB C N N 267 LYS CG C N N 268 LYS CD C N N 269 LYS CE C N N 270 LYS NZ N N N 271 LYS OXT O N N 272 LYS H H N N 273 LYS H2 H N N 274 LYS HA H N N 275 LYS HB2 H N N 276 LYS HB3 H N N 277 LYS HG2 H N N 278 LYS HG3 H N N 279 LYS HD2 H N N 280 LYS HD3 H N N 281 LYS HE2 H N N 282 LYS HE3 H N N 283 LYS HZ1 H N N 284 LYS HZ2 H N N 285 LYS HZ3 H N N 286 LYS HXT H N N 287 MET N N N N 288 MET CA C N S 289 MET C C N N 290 MET O O N N 291 MET CB C N N 292 MET CG C N N 293 MET SD S N N 294 MET CE C N N 295 MET OXT O N N 296 MET H H N N 297 MET H2 H N N 298 MET HA H N N 299 MET HB2 H N N 300 MET HB3 H N N 301 MET HG2 H N N 302 MET HG3 H N N 303 MET HE1 H N N 304 MET HE2 H N N 305 MET HE3 H N N 306 MET HXT H N N 307 NH2 N N N N 308 NH2 HN1 H N N 309 NH2 HN2 H N N 310 PHE N N N N 311 PHE CA C N S 312 PHE C C N N 313 PHE O O N N 314 PHE CB C N N 315 PHE CG C Y N 316 PHE CD1 C Y N 317 PHE CD2 C Y N 318 PHE CE1 C Y N 319 PHE CE2 C Y N 320 PHE CZ C Y N 321 PHE OXT O N N 322 PHE H H N N 323 PHE H2 H N N 324 PHE HA H N N 325 PHE HB2 H N N 326 PHE HB3 H N N 327 PHE HD1 H N N 328 PHE HD2 H N N 329 PHE HE1 H N N 330 PHE HE2 H N N 331 PHE HZ H N N 332 PHE HXT H N N 333 PRO N N N N 334 PRO CA C N S 335 PRO C C N N 336 PRO O O N N 337 PRO CB C N N 338 PRO CG C N N 339 PRO CD C N N 340 PRO OXT O N N 341 PRO H H N N 342 PRO HA H N N 343 PRO HB2 H N N 344 PRO HB3 H N N 345 PRO HG2 H N N 346 PRO HG3 H N N 347 PRO HD2 H N N 348 PRO HD3 H N N 349 PRO HXT H N N 350 SER N N N N 351 SER CA C N S 352 SER C C N N 353 SER O O N N 354 SER CB C N N 355 SER OG O N N 356 SER OXT O N N 357 SER H H N N 358 SER H2 H N N 359 SER HA H N N 360 SER HB2 H N N 361 SER HB3 H N N 362 SER HG H N N 363 SER HXT H N N 364 THR N N N N 365 THR CA C N S 366 THR C C N N 367 THR O O N N 368 THR CB C N R 369 THR OG1 O N N 370 THR CG2 C N N 371 THR OXT O N N 372 THR H H N N 373 THR H2 H N N 374 THR HA H N N 375 THR HB H N N 376 THR HG1 H N N 377 THR HG21 H N N 378 THR HG22 H N N 379 THR HG23 H N N 380 THR HXT H N N 381 TRP N N N N 382 TRP CA C N S 383 TRP C C N N 384 TRP O O N N 385 TRP CB C N N 386 TRP CG C Y N 387 TRP CD1 C Y N 388 TRP CD2 C Y N 389 TRP NE1 N Y N 390 TRP CE2 C Y N 391 TRP CE3 C Y N 392 TRP CZ2 C Y N 393 TRP CZ3 C Y N 394 TRP CH2 C Y N 395 TRP OXT O N N 396 TRP H H N N 397 TRP H2 H N N 398 TRP HA H N N 399 TRP HB2 H N N 400 TRP HB3 H N N 401 TRP HD1 H N N 402 TRP HE1 H N N 403 TRP HE3 H N N 404 TRP HZ2 H N N 405 TRP HZ3 H N N 406 TRP HH2 H N N 407 TRP HXT H N N 408 TYR N N N N 409 TYR CA C N S 410 TYR C C N N 411 TYR O O N N 412 TYR CB C N N 413 TYR CG C Y N 414 TYR CD1 C Y N 415 TYR CD2 C Y N 416 TYR CE1 C Y N 417 TYR CE2 C Y N 418 TYR CZ C Y N 419 TYR OH O N N 420 TYR OXT O N N 421 TYR H H N N 422 TYR H2 H N N 423 TYR HA H N N 424 TYR HB2 H N N 425 TYR HB3 H N N 426 TYR HD1 H N N 427 TYR HD2 H N N 428 TYR HE1 H N N 429 TYR HE2 H N N 430 TYR HH H N N 431 TYR HXT H N N 432 VAL N N N N 433 VAL CA C N S 434 VAL C C N N 435 VAL O O N N 436 VAL CB C N N 437 VAL CG1 C N N 438 VAL CG2 C N N 439 VAL OXT O N N 440 VAL H H N N 441 VAL H2 H N N 442 VAL HA H N N 443 VAL HB H N N 444 VAL HG11 H N N 445 VAL HG12 H N N 446 VAL HG13 H N N 447 VAL HG21 H N N 448 VAL HG22 H N N 449 VAL HG23 H N N 450 VAL HXT H N N 451 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 JFF C14 C13 doub Y N 173 JFF C14 C9 sing Y N 174 JFF C13 C12 sing Y N 175 JFF O5 C15 doub N N 176 JFF C9 C1 sing N N 177 JFF C9 C10 doub Y N 178 JFF C12 C15 sing N N 179 JFF C12 C11 doub Y N 180 JFF C15 N4 sing N N 181 JFF C16 N4 sing N N 182 JFF C16 C17 sing N N 183 JFF C10 C11 sing Y N 184 JFF C17 N5 sing N N 185 JFF N5 C18 sing N N 186 JFF C18 C19 sing N N 187 JFF C18 O6 doub N N 188 JFF C10 H4 sing N N 189 JFF C11 H5 sing N N 190 JFF C13 H6 sing N N 191 JFF C14 H7 sing N N 192 JFF N4 H8 sing N N 193 JFF C16 H9 sing N N 194 JFF C16 H10 sing N N 195 JFF C17 H11 sing N N 196 JFF C17 H12 sing N N 197 JFF N5 H13 sing N N 198 JFF C19 H14 sing N N 199 JFF C19 H15 sing N N 200 JFF C1 S1 sing N N 201 JFF C1 C2 doub N N 202 JFF C2 C3 sing N N 203 JFF C2 C4 sing N N 204 JFF C3 N2 sing N N 205 JFF C4 N3 sing N N 206 JFF S1 C5 sing N N 207 JFF C5 C6 sing N N 208 JFF C6 C7 sing N N 209 JFF C7 O4 doub N N 210 JFF C7 O3 sing N N 211 JFF C6 N1 sing N N 212 JFF N1 C8 sing N N 213 JFF C8 O1 sing N N 214 JFF C8 O2 doub N N 215 JFF C19 CL1 sing N N 216 JFF C3 H1 sing N N 217 JFF C3 H2 sing N N 218 JFF C4 H3 sing N N 219 JFF C4 H16 sing N N 220 JFF N2 H17 sing N N 221 JFF N2 H18 sing N N 222 JFF N3 H19 sing N N 223 JFF N3 H20 sing N N 224 JFF C5 H21 sing N N 225 JFF C5 H22 sing N N 226 JFF C6 H23 sing N N 227 JFF O3 H24 sing N N 228 JFF N1 H25 sing N N 229 JFF O1 H26 sing N N 230 LEU N CA sing N N 231 LEU N H sing N N 232 LEU N H2 sing N N 233 LEU CA C sing N N 234 LEU CA CB sing N N 235 LEU CA HA sing N N 236 LEU C O doub N N 237 LEU C OXT sing N N 238 LEU CB CG sing N N 239 LEU CB HB2 sing N N 240 LEU CB HB3 sing N N 241 LEU CG CD1 sing N N 242 LEU CG CD2 sing N N 243 LEU CG HG sing N N 244 LEU CD1 HD11 sing N N 245 LEU CD1 HD12 sing N N 246 LEU CD1 HD13 sing N N 247 LEU CD2 HD21 sing N N 248 LEU CD2 HD22 sing N N 249 LEU CD2 HD23 sing N N 250 LEU OXT HXT sing N N 251 LYS N CA sing N N 252 LYS N H sing N N 253 LYS N H2 sing N N 254 LYS CA C sing N N 255 LYS CA CB sing N N 256 LYS CA HA sing N N 257 LYS C O doub N N 258 LYS C OXT sing N N 259 LYS CB CG sing N N 260 LYS CB HB2 sing N N 261 LYS CB HB3 sing N N 262 LYS CG CD sing N N 263 LYS CG HG2 sing N N 264 LYS CG HG3 sing N N 265 LYS CD CE sing N N 266 LYS CD HD2 sing N N 267 LYS CD HD3 sing N N 268 LYS CE NZ sing N N 269 LYS CE HE2 sing N N 270 LYS CE HE3 sing N N 271 LYS NZ HZ1 sing N N 272 LYS NZ HZ2 sing N N 273 LYS NZ HZ3 sing N N 274 LYS OXT HXT sing N N 275 MET N CA sing N N 276 MET N H sing N N 277 MET N H2 sing N N 278 MET CA C sing N N 279 MET CA CB sing N N 280 MET CA HA sing N N 281 MET C O doub N N 282 MET C OXT sing N N 283 MET CB CG sing N N 284 MET CB HB2 sing N N 285 MET CB HB3 sing N N 286 MET CG SD sing N N 287 MET CG HG2 sing N N 288 MET CG HG3 sing N N 289 MET SD CE sing N N 290 MET CE HE1 sing N N 291 MET CE HE2 sing N N 292 MET CE HE3 sing N N 293 MET OXT HXT sing N N 294 NH2 N HN1 sing N N 295 NH2 N HN2 sing N N 296 PHE N CA sing N N 297 PHE N H sing N N 298 PHE N H2 sing N N 299 PHE CA C sing N N 300 PHE CA CB sing N N 301 PHE CA HA sing N N 302 PHE C O doub N N 303 PHE C OXT sing N N 304 PHE CB CG sing N N 305 PHE CB HB2 sing N N 306 PHE CB HB3 sing N N 307 PHE CG CD1 doub Y N 308 PHE CG CD2 sing Y N 309 PHE CD1 CE1 sing Y N 310 PHE CD1 HD1 sing N N 311 PHE CD2 CE2 doub Y N 312 PHE CD2 HD2 sing N N 313 PHE CE1 CZ doub Y N 314 PHE CE1 HE1 sing N N 315 PHE CE2 CZ sing Y N 316 PHE CE2 HE2 sing N N 317 PHE CZ HZ sing N N 318 PHE OXT HXT sing N N 319 PRO N CA sing N N 320 PRO N CD sing N N 321 PRO N H sing N N 322 PRO CA C sing N N 323 PRO CA CB sing N N 324 PRO CA HA sing N N 325 PRO C O doub N N 326 PRO C OXT sing N N 327 PRO CB CG sing N N 328 PRO CB HB2 sing N N 329 PRO CB HB3 sing N N 330 PRO CG CD sing N N 331 PRO CG HG2 sing N N 332 PRO CG HG3 sing N N 333 PRO CD HD2 sing N N 334 PRO CD HD3 sing N N 335 PRO OXT HXT sing N N 336 SER N CA sing N N 337 SER N H sing N N 338 SER N H2 sing N N 339 SER CA C sing N N 340 SER CA CB sing N N 341 SER CA HA sing N N 342 SER C O doub N N 343 SER C OXT sing N N 344 SER CB OG sing N N 345 SER CB HB2 sing N N 346 SER CB HB3 sing N N 347 SER OG HG sing N N 348 SER OXT HXT sing N N 349 THR N CA sing N N 350 THR N H sing N N 351 THR N H2 sing N N 352 THR CA C sing N N 353 THR CA CB sing N N 354 THR CA HA sing N N 355 THR C O doub N N 356 THR C OXT sing N N 357 THR CB OG1 sing N N 358 THR CB CG2 sing N N 359 THR CB HB sing N N 360 THR OG1 HG1 sing N N 361 THR CG2 HG21 sing N N 362 THR CG2 HG22 sing N N 363 THR CG2 HG23 sing N N 364 THR OXT HXT sing N N 365 TRP N CA sing N N 366 TRP N H sing N N 367 TRP N H2 sing N N 368 TRP CA C sing N N 369 TRP CA CB sing N N 370 TRP CA HA sing N N 371 TRP C O doub N N 372 TRP C OXT sing N N 373 TRP CB CG sing N N 374 TRP CB HB2 sing N N 375 TRP CB HB3 sing N N 376 TRP CG CD1 doub Y N 377 TRP CG CD2 sing Y N 378 TRP CD1 NE1 sing Y N 379 TRP CD1 HD1 sing N N 380 TRP CD2 CE2 doub Y N 381 TRP CD2 CE3 sing Y N 382 TRP NE1 CE2 sing Y N 383 TRP NE1 HE1 sing N N 384 TRP CE2 CZ2 sing Y N 385 TRP CE3 CZ3 doub Y N 386 TRP CE3 HE3 sing N N 387 TRP CZ2 CH2 doub Y N 388 TRP CZ2 HZ2 sing N N 389 TRP CZ3 CH2 sing Y N 390 TRP CZ3 HZ3 sing N N 391 TRP CH2 HH2 sing N N 392 TRP OXT HXT sing N N 393 TYR N CA sing N N 394 TYR N H sing N N 395 TYR N H2 sing N N 396 TYR CA C sing N N 397 TYR CA CB sing N N 398 TYR CA HA sing N N 399 TYR C O doub N N 400 TYR C OXT sing N N 401 TYR CB CG sing N N 402 TYR CB HB2 sing N N 403 TYR CB HB3 sing N N 404 TYR CG CD1 doub Y N 405 TYR CG CD2 sing Y N 406 TYR CD1 CE1 sing Y N 407 TYR CD1 HD1 sing N N 408 TYR CD2 CE2 doub Y N 409 TYR CD2 HD2 sing N N 410 TYR CE1 CZ doub Y N 411 TYR CE1 HE1 sing N N 412 TYR CE2 CZ sing Y N 413 TYR CE2 HE2 sing N N 414 TYR CZ OH sing N N 415 TYR OH HH sing N N 416 TYR OXT HXT sing N N 417 VAL N CA sing N N 418 VAL N H sing N N 419 VAL N H2 sing N N 420 VAL CA C sing N N 421 VAL CA CB sing N N 422 VAL CA HA sing N N 423 VAL C O doub N N 424 VAL C OXT sing N N 425 VAL CB CG1 sing N N 426 VAL CB CG2 sing N N 427 VAL CB HB sing N N 428 VAL CG1 HG11 sing N N 429 VAL CG1 HG12 sing N N 430 VAL CG1 HG13 sing N N 431 VAL CG2 HG21 sing N N 432 VAL CG2 HG22 sing N N 433 VAL CG2 HG23 sing N N 434 VAL OXT HXT sing N N 435 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 NH2 ? ? NH2 ? ? 'SUBJECT OF INVESTIGATION' ? 2 JFF ? ? JFF ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7Y90 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.015243 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010039 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019064 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_