data_7YA9 # _entry.id 7YA9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7YA9 pdb_00007ya9 10.2210/pdb7ya9/pdb WWPDB D_1300030551 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7YA9 _pdbx_database_status.recvd_initial_deposition_date 2022-06-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Duc, N.M.' 1 ? 'Bong, S.M.' 2 ? 'Lee, B.I.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Insight into the Mitochondria-ER tethering revealed by the crystal structure of Fis1-Bap31 complex' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Duc, N.M.' 1 ? primary 'Bong, S.M.' 2 ? primary 'Lee, B.I.' 3 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7YA9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 56.066 _cell.length_a_esd ? _cell.length_b 56.066 _cell.length_b_esd ? _cell.length_c 97.661 _cell.length_c_esd ? _cell.volume 306987.232 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7YA9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall 'P 4abw 2nw' _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitochondrial fission 1 protein' 14493.609 1 ? ? ? ? 2 non-polymer syn BETA-MERCAPTOETHANOL 78.133 2 ? ? ? ? 3 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 2 ? ? ? ? 4 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 5 water nat water 18.015 62 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FIS1 homolog,hFis1,Tetratricopeptide repeat protein 11,TPR repeat protein 11' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLA VGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGL ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLA VGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 GLU n 1 5 ALA n 1 6 VAL n 1 7 LEU n 1 8 ASN n 1 9 GLU n 1 10 LEU n 1 11 VAL n 1 12 SER n 1 13 VAL n 1 14 GLU n 1 15 ASP n 1 16 LEU n 1 17 LEU n 1 18 LYS n 1 19 PHE n 1 20 GLU n 1 21 LYS n 1 22 LYS n 1 23 PHE n 1 24 GLN n 1 25 SER n 1 26 GLU n 1 27 LYS n 1 28 ALA n 1 29 ALA n 1 30 GLY n 1 31 SER n 1 32 VAL n 1 33 SER n 1 34 LYS n 1 35 SER n 1 36 THR n 1 37 GLN n 1 38 PHE n 1 39 GLU n 1 40 TYR n 1 41 ALA n 1 42 TRP n 1 43 CYS n 1 44 LEU n 1 45 VAL n 1 46 ARG n 1 47 SER n 1 48 LYS n 1 49 TYR n 1 50 ASN n 1 51 ASP n 1 52 ASP n 1 53 ILE n 1 54 ARG n 1 55 LYS n 1 56 GLY n 1 57 ILE n 1 58 VAL n 1 59 LEU n 1 60 LEU n 1 61 GLU n 1 62 GLU n 1 63 LEU n 1 64 LEU n 1 65 PRO n 1 66 LYS n 1 67 GLY n 1 68 SER n 1 69 LYS n 1 70 GLU n 1 71 GLU n 1 72 GLN n 1 73 ARG n 1 74 ASP n 1 75 TYR n 1 76 VAL n 1 77 PHE n 1 78 TYR n 1 79 LEU n 1 80 ALA n 1 81 VAL n 1 82 GLY n 1 83 ASN n 1 84 TYR n 1 85 ARG n 1 86 LEU n 1 87 LYS n 1 88 GLU n 1 89 TYR n 1 90 GLU n 1 91 LYS n 1 92 ALA n 1 93 LEU n 1 94 LYS n 1 95 TYR n 1 96 VAL n 1 97 ARG n 1 98 GLY n 1 99 LEU n 1 100 LEU n 1 101 GLN n 1 102 THR n 1 103 GLU n 1 104 PRO n 1 105 GLN n 1 106 ASN n 1 107 ASN n 1 108 GLN n 1 109 ALA n 1 110 LYS n 1 111 GLU n 1 112 LEU n 1 113 GLU n 1 114 ARG n 1 115 LEU n 1 116 ILE n 1 117 ASP n 1 118 LYS n 1 119 ALA n 1 120 MET n 1 121 LYS n 1 122 LYS n 1 123 ASP n 1 124 GLY n 1 125 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 125 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FIS1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FIS1_HUMAN _struct_ref.pdbx_db_accession Q9Y3D6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVG NYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7YA9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 125 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y3D6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 123 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 123 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7YA9 GLY A 1 ? UNP Q9Y3D6 ? ? 'expression tag' -1 1 1 7YA9 SER A 2 ? UNP Q9Y3D6 ? ? 'expression tag' 0 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BME non-polymer . BETA-MERCAPTOETHANOL ? 'C2 H6 O S' 78.133 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7YA9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.64 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 287 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M CAPS pH 10.5 30% PEG 400 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-05-19 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate 11.98 _reflns.entry_id 7YA9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.7 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17973 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.2 _reflns.pdbx_Rmerge_I_obs 0.074 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 1.70 _reflns_shell.d_res_low 1.73 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 872 _reflns_shell.percent_possible_all 99.9 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.969 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 17.38 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7YA9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.70 _refine.ls_d_res_low 48.64 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17758 _refine.ls_number_reflns_R_free 870 _refine.ls_number_reflns_R_work 16888 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.71 _refine.ls_percent_reflns_R_free 4.90 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1892 _refine.ls_R_factor_R_free 0.2215 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1876 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1NZN _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.2523 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1589 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 48.64 _refine_hist.number_atoms_solvent 62 _refine_hist.number_atoms_total 1103 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1036 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0180 ? 1050 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.5624 ? 1394 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0904 ? 149 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0093 ? 176 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.1276 ? 650 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.70 1.81 . . 140 2731 99.00 . . . 0.2977 . 0.2102 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.81 1.95 . . 145 2750 99.97 . . . 0.2482 . 0.1883 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.95 2.14 . . 150 2763 99.79 . . . 0.2175 . 0.1712 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.14 2.45 . . 141 2803 99.86 . . . 0.2092 . 0.1618 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.45 3.09 . . 148 2830 99.93 . . . 0.1961 . 0.1902 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.09 48.64 . . 146 3011 99.72 . . . 0.2206 . 0.1990 . . . . . . . . . . . # _struct.entry_id 7YA9 _struct.title 'Fis1 (Mitochondrial fission 1 protein)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7YA9 _struct_keywords.text apoptosis _struct_keywords.pdbx_keywords APOPTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 2 ? E N N 3 ? F N N 4 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? ASN A 8 ? SER A 0 ASN A 6 1 ? 7 HELX_P HELX_P2 AA2 SER A 12 ? GLY A 30 ? SER A 10 GLY A 28 1 ? 19 HELX_P HELX_P3 AA3 SER A 33 ? VAL A 45 ? SER A 31 VAL A 43 1 ? 13 HELX_P HELX_P4 AA4 TYR A 49 ? LEU A 64 ? TYR A 47 LEU A 62 1 ? 16 HELX_P HELX_P5 AA5 PRO A 65 ? GLY A 67 ? PRO A 63 GLY A 65 5 ? 3 HELX_P HELX_P6 AA6 SER A 68 ? LEU A 86 ? SER A 66 LEU A 84 1 ? 19 HELX_P HELX_P7 AA7 GLU A 88 ? GLU A 103 ? GLU A 86 GLU A 101 1 ? 16 HELX_P HELX_P8 AA8 ASN A 106 ? ASP A 123 ? ASN A 104 ASP A 121 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 7YA9 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017836 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017836 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010240 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? NA ? ? 9.38062 1.54875 ? ? 3.38349 72.32734 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 -1 GLY GLY A . n A 1 2 SER 2 0 0 SER SER A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 GLU 4 2 2 GLU GLU A . n A 1 5 ALA 5 3 3 ALA ALA A . n A 1 6 VAL 6 4 4 VAL VAL A . n A 1 7 LEU 7 5 5 LEU LEU A . n A 1 8 ASN 8 6 6 ASN ASN A . n A 1 9 GLU 9 7 7 GLU GLU A . n A 1 10 LEU 10 8 8 LEU LEU A . n A 1 11 VAL 11 9 9 VAL VAL A . n A 1 12 SER 12 10 10 SER SER A . n A 1 13 VAL 13 11 11 VAL VAL A . n A 1 14 GLU 14 12 12 GLU GLU A . n A 1 15 ASP 15 13 13 ASP ASP A . n A 1 16 LEU 16 14 14 LEU LEU A . n A 1 17 LEU 17 15 15 LEU LEU A . n A 1 18 LYS 18 16 16 LYS LYS A . n A 1 19 PHE 19 17 17 PHE PHE A . n A 1 20 GLU 20 18 18 GLU GLU A . n A 1 21 LYS 21 19 19 LYS LYS A . n A 1 22 LYS 22 20 20 LYS LYS A . n A 1 23 PHE 23 21 21 PHE PHE A . n A 1 24 GLN 24 22 22 GLN GLN A . n A 1 25 SER 25 23 23 SER SER A . n A 1 26 GLU 26 24 24 GLU GLU A . n A 1 27 LYS 27 25 25 LYS LYS A . n A 1 28 ALA 28 26 26 ALA ALA A . n A 1 29 ALA 29 27 27 ALA ALA A . n A 1 30 GLY 30 28 28 GLY GLY A . n A 1 31 SER 31 29 29 SER SER A . n A 1 32 VAL 32 30 30 VAL VAL A . n A 1 33 SER 33 31 31 SER SER A . n A 1 34 LYS 34 32 32 LYS LYS A . n A 1 35 SER 35 33 33 SER SER A . n A 1 36 THR 36 34 34 THR THR A . n A 1 37 GLN 37 35 35 GLN GLN A . n A 1 38 PHE 38 36 36 PHE PHE A . n A 1 39 GLU 39 37 37 GLU GLU A . n A 1 40 TYR 40 38 38 TYR TYR A . n A 1 41 ALA 41 39 39 ALA ALA A . n A 1 42 TRP 42 40 40 TRP TRP A . n A 1 43 CYS 43 41 41 CYS CYS A . n A 1 44 LEU 44 42 42 LEU LEU A . n A 1 45 VAL 45 43 43 VAL VAL A . n A 1 46 ARG 46 44 44 ARG ARG A . n A 1 47 SER 47 45 45 SER SER A . n A 1 48 LYS 48 46 46 LYS LYS A . n A 1 49 TYR 49 47 47 TYR TYR A . n A 1 50 ASN 50 48 48 ASN ASN A . n A 1 51 ASP 51 49 49 ASP ASP A . n A 1 52 ASP 52 50 50 ASP ASP A . n A 1 53 ILE 53 51 51 ILE ILE A . n A 1 54 ARG 54 52 52 ARG ARG A . n A 1 55 LYS 55 53 53 LYS LYS A . n A 1 56 GLY 56 54 54 GLY GLY A . n A 1 57 ILE 57 55 55 ILE ILE A . n A 1 58 VAL 58 56 56 VAL VAL A . n A 1 59 LEU 59 57 57 LEU LEU A . n A 1 60 LEU 60 58 58 LEU LEU A . n A 1 61 GLU 61 59 59 GLU GLU A . n A 1 62 GLU 62 60 60 GLU GLU A . n A 1 63 LEU 63 61 61 LEU LEU A . n A 1 64 LEU 64 62 62 LEU LEU A . n A 1 65 PRO 65 63 63 PRO PRO A . n A 1 66 LYS 66 64 64 LYS LYS A . n A 1 67 GLY 67 65 65 GLY GLY A . n A 1 68 SER 68 66 66 SER SER A . n A 1 69 LYS 69 67 67 LYS LYS A . n A 1 70 GLU 70 68 68 GLU GLU A . n A 1 71 GLU 71 69 69 GLU GLU A . n A 1 72 GLN 72 70 70 GLN GLN A . n A 1 73 ARG 73 71 71 ARG ARG A . n A 1 74 ASP 74 72 72 ASP ASP A . n A 1 75 TYR 75 73 73 TYR TYR A . n A 1 76 VAL 76 74 74 VAL VAL A . n A 1 77 PHE 77 75 75 PHE PHE A . n A 1 78 TYR 78 76 76 TYR TYR A . n A 1 79 LEU 79 77 77 LEU LEU A . n A 1 80 ALA 80 78 78 ALA ALA A . n A 1 81 VAL 81 79 79 VAL VAL A . n A 1 82 GLY 82 80 80 GLY GLY A . n A 1 83 ASN 83 81 81 ASN ASN A . n A 1 84 TYR 84 82 82 TYR TYR A . n A 1 85 ARG 85 83 83 ARG ARG A . n A 1 86 LEU 86 84 84 LEU LEU A . n A 1 87 LYS 87 85 85 LYS LYS A . n A 1 88 GLU 88 86 86 GLU GLU A . n A 1 89 TYR 89 87 87 TYR TYR A . n A 1 90 GLU 90 88 88 GLU GLU A . n A 1 91 LYS 91 89 89 LYS LYS A . n A 1 92 ALA 92 90 90 ALA ALA A . n A 1 93 LEU 93 91 91 LEU LEU A . n A 1 94 LYS 94 92 92 LYS LYS A . n A 1 95 TYR 95 93 93 TYR TYR A . n A 1 96 VAL 96 94 94 VAL VAL A . n A 1 97 ARG 97 95 95 ARG ARG A . n A 1 98 GLY 98 96 96 GLY GLY A . n A 1 99 LEU 99 97 97 LEU LEU A . n A 1 100 LEU 100 98 98 LEU LEU A . n A 1 101 GLN 101 99 99 GLN GLN A . n A 1 102 THR 102 100 100 THR THR A . n A 1 103 GLU 103 101 101 GLU GLU A . n A 1 104 PRO 104 102 102 PRO PRO A . n A 1 105 GLN 105 103 103 GLN GLN A . n A 1 106 ASN 106 104 104 ASN ASN A . n A 1 107 ASN 107 105 105 ASN ASN A . n A 1 108 GLN 108 106 106 GLN GLN A . n A 1 109 ALA 109 107 107 ALA ALA A . n A 1 110 LYS 110 108 108 LYS LYS A . n A 1 111 GLU 111 109 109 GLU GLU A . n A 1 112 LEU 112 110 110 LEU LEU A . n A 1 113 GLU 113 111 111 GLU GLU A . n A 1 114 ARG 114 112 112 ARG ARG A . n A 1 115 LEU 115 113 113 LEU LEU A . n A 1 116 ILE 116 114 114 ILE ILE A . n A 1 117 ASP 117 115 115 ASP ASP A . n A 1 118 LYS 118 116 116 LYS LYS A . n A 1 119 ALA 119 117 117 ALA ALA A . n A 1 120 MET 120 118 118 MET MET A . n A 1 121 LYS 121 119 119 LYS LYS A . n A 1 122 LYS 122 120 120 LYS LYS A . n A 1 123 ASP 123 121 121 ASP ASP A . n A 1 124 GLY 124 122 122 GLY GLY A . n A 1 125 LEU 125 123 123 LEU LEU A . n # _pdbx_contact_author.id 3 _pdbx_contact_author.email bilee@ncc.re.kr _pdbx_contact_author.name_first 'BYUNG IL' _pdbx_contact_author.name_last LEE _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1270-8439 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BME 1 701 701 BME BME A . C 3 PEG 1 702 201 PEG PEG A . D 2 BME 1 703 501 BME BME A . E 3 PEG 1 704 601 PEG PEG A . F 4 NA 1 705 1 NA NA A . G 5 HOH 1 801 84 HOH HOH A . G 5 HOH 2 802 40 HOH HOH A . G 5 HOH 3 803 8 HOH HOH A . G 5 HOH 4 804 63 HOH HOH A . G 5 HOH 5 805 38 HOH HOH A . G 5 HOH 6 806 80 HOH HOH A . G 5 HOH 7 807 34 HOH HOH A . G 5 HOH 8 808 16 HOH HOH A . G 5 HOH 9 809 7 HOH HOH A . G 5 HOH 10 810 17 HOH HOH A . G 5 HOH 11 811 93 HOH HOH A . G 5 HOH 12 812 81 HOH HOH A . G 5 HOH 13 813 22 HOH HOH A . G 5 HOH 14 814 6 HOH HOH A . G 5 HOH 15 815 12 HOH HOH A . G 5 HOH 16 816 19 HOH HOH A . G 5 HOH 17 817 82 HOH HOH A . G 5 HOH 18 818 36 HOH HOH A . G 5 HOH 19 819 5 HOH HOH A . G 5 HOH 20 820 24 HOH HOH A . G 5 HOH 21 821 83 HOH HOH A . G 5 HOH 22 822 27 HOH HOH A . G 5 HOH 23 823 18 HOH HOH A . G 5 HOH 24 824 28 HOH HOH A . G 5 HOH 25 825 62 HOH HOH A . G 5 HOH 26 826 32 HOH HOH A . G 5 HOH 27 827 1 HOH HOH A . G 5 HOH 28 828 23 HOH HOH A . G 5 HOH 29 829 4 HOH HOH A . G 5 HOH 30 830 9 HOH HOH A . G 5 HOH 31 831 2 HOH HOH A . G 5 HOH 32 832 20 HOH HOH A . G 5 HOH 33 833 26 HOH HOH A . G 5 HOH 34 834 21 HOH HOH A . G 5 HOH 35 835 64 HOH HOH A . G 5 HOH 36 836 30 HOH HOH A . G 5 HOH 37 837 3 HOH HOH A . G 5 HOH 38 838 14 HOH HOH A . G 5 HOH 39 839 49 HOH HOH A . G 5 HOH 40 840 45 HOH HOH A . G 5 HOH 41 841 44 HOH HOH A . G 5 HOH 42 842 89 HOH HOH A . G 5 HOH 43 843 86 HOH HOH A . G 5 HOH 44 844 68 HOH HOH A . G 5 HOH 45 845 92 HOH HOH A . G 5 HOH 46 846 42 HOH HOH A . G 5 HOH 47 847 29 HOH HOH A . G 5 HOH 48 848 67 HOH HOH A . G 5 HOH 49 849 54 HOH HOH A . G 5 HOH 50 850 73 HOH HOH A . G 5 HOH 51 851 90 HOH HOH A . G 5 HOH 52 852 65 HOH HOH A . G 5 HOH 53 853 35 HOH HOH A . G 5 HOH 54 854 61 HOH HOH A . G 5 HOH 55 855 85 HOH HOH A . G 5 HOH 56 856 55 HOH HOH A . G 5 HOH 57 857 33 HOH HOH A . G 5 HOH 58 858 58 HOH HOH A . G 5 HOH 59 859 91 HOH HOH A . G 5 HOH 60 860 88 HOH HOH A . G 5 HOH 61 861 87 HOH HOH A . G 5 HOH 62 862 70 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3880 ? 1 MORE -5 ? 1 'SSA (A^2)' 12800 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A NA 705 ? F NA . 2 1 A HOH 831 ? G HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-07-05 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/4 3 y+1/2,-x+1/2,z+3/4 4 x+1/2,-y+1/2,-z+3/4 5 -x+1/2,y+1/2,-z+1/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15_3459 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_entry_details.entry_id 7YA9 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 803 ? ? O A HOH 825 ? ? 1.77 2 1 O A HOH 851 ? ? O A HOH 852 ? ? 1.98 3 1 O A HOH 854 ? ? O A HOH 861 ? ? 2.04 4 1 O A HOH 860 ? ? O A HOH 861 ? ? 2.07 5 1 O A HOH 841 ? ? O A HOH 862 ? ? 2.18 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A TYR 82 ? ? CG A TYR 82 ? ? CD2 A TYR 82 ? ? 116.24 121.00 -4.76 0.60 N 2 1 NE A ARG 83 ? ? CZ A ARG 83 ? ? NH2 A ARG 83 ? ? 115.11 120.30 -5.19 0.50 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 104 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -67.69 _pdbx_validate_torsion.psi 92.08 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BME C1 C N N 74 BME C2 C N N 75 BME O1 O N N 76 BME S2 S N N 77 BME H11 H N N 78 BME H12 H N N 79 BME H21 H N N 80 BME H22 H N N 81 BME HO1 H N N 82 BME HS2 H N N 83 CYS N N N N 84 CYS CA C N R 85 CYS C C N N 86 CYS O O N N 87 CYS CB C N N 88 CYS SG S N N 89 CYS OXT O N N 90 CYS H H N N 91 CYS H2 H N N 92 CYS HA H N N 93 CYS HB2 H N N 94 CYS HB3 H N N 95 CYS HG H N N 96 CYS HXT H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HOH O O N N 147 HOH H1 H N N 148 HOH H2 H N N 149 ILE N N N N 150 ILE CA C N S 151 ILE C C N N 152 ILE O O N N 153 ILE CB C N S 154 ILE CG1 C N N 155 ILE CG2 C N N 156 ILE CD1 C N N 157 ILE OXT O N N 158 ILE H H N N 159 ILE H2 H N N 160 ILE HA H N N 161 ILE HB H N N 162 ILE HG12 H N N 163 ILE HG13 H N N 164 ILE HG21 H N N 165 ILE HG22 H N N 166 ILE HG23 H N N 167 ILE HD11 H N N 168 ILE HD12 H N N 169 ILE HD13 H N N 170 ILE HXT H N N 171 LEU N N N N 172 LEU CA C N S 173 LEU C C N N 174 LEU O O N N 175 LEU CB C N N 176 LEU CG C N N 177 LEU CD1 C N N 178 LEU CD2 C N N 179 LEU OXT O N N 180 LEU H H N N 181 LEU H2 H N N 182 LEU HA H N N 183 LEU HB2 H N N 184 LEU HB3 H N N 185 LEU HG H N N 186 LEU HD11 H N N 187 LEU HD12 H N N 188 LEU HD13 H N N 189 LEU HD21 H N N 190 LEU HD22 H N N 191 LEU HD23 H N N 192 LEU HXT H N N 193 LYS N N N N 194 LYS CA C N S 195 LYS C C N N 196 LYS O O N N 197 LYS CB C N N 198 LYS CG C N N 199 LYS CD C N N 200 LYS CE C N N 201 LYS NZ N N N 202 LYS OXT O N N 203 LYS H H N N 204 LYS H2 H N N 205 LYS HA H N N 206 LYS HB2 H N N 207 LYS HB3 H N N 208 LYS HG2 H N N 209 LYS HG3 H N N 210 LYS HD2 H N N 211 LYS HD3 H N N 212 LYS HE2 H N N 213 LYS HE3 H N N 214 LYS HZ1 H N N 215 LYS HZ2 H N N 216 LYS HZ3 H N N 217 LYS HXT H N N 218 MET N N N N 219 MET CA C N S 220 MET C C N N 221 MET O O N N 222 MET CB C N N 223 MET CG C N N 224 MET SD S N N 225 MET CE C N N 226 MET OXT O N N 227 MET H H N N 228 MET H2 H N N 229 MET HA H N N 230 MET HB2 H N N 231 MET HB3 H N N 232 MET HG2 H N N 233 MET HG3 H N N 234 MET HE1 H N N 235 MET HE2 H N N 236 MET HE3 H N N 237 MET HXT H N N 238 NA NA NA N N 239 PEG C1 C N N 240 PEG O1 O N N 241 PEG C2 C N N 242 PEG O2 O N N 243 PEG C3 C N N 244 PEG C4 C N N 245 PEG O4 O N N 246 PEG H11 H N N 247 PEG H12 H N N 248 PEG HO1 H N N 249 PEG H21 H N N 250 PEG H22 H N N 251 PEG H31 H N N 252 PEG H32 H N N 253 PEG H41 H N N 254 PEG H42 H N N 255 PEG HO4 H N N 256 PHE N N N N 257 PHE CA C N S 258 PHE C C N N 259 PHE O O N N 260 PHE CB C N N 261 PHE CG C Y N 262 PHE CD1 C Y N 263 PHE CD2 C Y N 264 PHE CE1 C Y N 265 PHE CE2 C Y N 266 PHE CZ C Y N 267 PHE OXT O N N 268 PHE H H N N 269 PHE H2 H N N 270 PHE HA H N N 271 PHE HB2 H N N 272 PHE HB3 H N N 273 PHE HD1 H N N 274 PHE HD2 H N N 275 PHE HE1 H N N 276 PHE HE2 H N N 277 PHE HZ H N N 278 PHE HXT H N N 279 PRO N N N N 280 PRO CA C N S 281 PRO C C N N 282 PRO O O N N 283 PRO CB C N N 284 PRO CG C N N 285 PRO CD C N N 286 PRO OXT O N N 287 PRO H H N N 288 PRO HA H N N 289 PRO HB2 H N N 290 PRO HB3 H N N 291 PRO HG2 H N N 292 PRO HG3 H N N 293 PRO HD2 H N N 294 PRO HD3 H N N 295 PRO HXT H N N 296 SER N N N N 297 SER CA C N S 298 SER C C N N 299 SER O O N N 300 SER CB C N N 301 SER OG O N N 302 SER OXT O N N 303 SER H H N N 304 SER H2 H N N 305 SER HA H N N 306 SER HB2 H N N 307 SER HB3 H N N 308 SER HG H N N 309 SER HXT H N N 310 THR N N N N 311 THR CA C N S 312 THR C C N N 313 THR O O N N 314 THR CB C N R 315 THR OG1 O N N 316 THR CG2 C N N 317 THR OXT O N N 318 THR H H N N 319 THR H2 H N N 320 THR HA H N N 321 THR HB H N N 322 THR HG1 H N N 323 THR HG21 H N N 324 THR HG22 H N N 325 THR HG23 H N N 326 THR HXT H N N 327 TRP N N N N 328 TRP CA C N S 329 TRP C C N N 330 TRP O O N N 331 TRP CB C N N 332 TRP CG C Y N 333 TRP CD1 C Y N 334 TRP CD2 C Y N 335 TRP NE1 N Y N 336 TRP CE2 C Y N 337 TRP CE3 C Y N 338 TRP CZ2 C Y N 339 TRP CZ3 C Y N 340 TRP CH2 C Y N 341 TRP OXT O N N 342 TRP H H N N 343 TRP H2 H N N 344 TRP HA H N N 345 TRP HB2 H N N 346 TRP HB3 H N N 347 TRP HD1 H N N 348 TRP HE1 H N N 349 TRP HE3 H N N 350 TRP HZ2 H N N 351 TRP HZ3 H N N 352 TRP HH2 H N N 353 TRP HXT H N N 354 TYR N N N N 355 TYR CA C N S 356 TYR C C N N 357 TYR O O N N 358 TYR CB C N N 359 TYR CG C Y N 360 TYR CD1 C Y N 361 TYR CD2 C Y N 362 TYR CE1 C Y N 363 TYR CE2 C Y N 364 TYR CZ C Y N 365 TYR OH O N N 366 TYR OXT O N N 367 TYR H H N N 368 TYR H2 H N N 369 TYR HA H N N 370 TYR HB2 H N N 371 TYR HB3 H N N 372 TYR HD1 H N N 373 TYR HD2 H N N 374 TYR HE1 H N N 375 TYR HE2 H N N 376 TYR HH H N N 377 TYR HXT H N N 378 VAL N N N N 379 VAL CA C N S 380 VAL C C N N 381 VAL O O N N 382 VAL CB C N N 383 VAL CG1 C N N 384 VAL CG2 C N N 385 VAL OXT O N N 386 VAL H H N N 387 VAL H2 H N N 388 VAL HA H N N 389 VAL HB H N N 390 VAL HG11 H N N 391 VAL HG12 H N N 392 VAL HG13 H N N 393 VAL HG21 H N N 394 VAL HG22 H N N 395 VAL HG23 H N N 396 VAL HXT H N N 397 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BME C1 C2 sing N N 70 BME C1 O1 sing N N 71 BME C1 H11 sing N N 72 BME C1 H12 sing N N 73 BME C2 S2 sing N N 74 BME C2 H21 sing N N 75 BME C2 H22 sing N N 76 BME O1 HO1 sing N N 77 BME S2 HS2 sing N N 78 CYS N CA sing N N 79 CYS N H sing N N 80 CYS N H2 sing N N 81 CYS CA C sing N N 82 CYS CA CB sing N N 83 CYS CA HA sing N N 84 CYS C O doub N N 85 CYS C OXT sing N N 86 CYS CB SG sing N N 87 CYS CB HB2 sing N N 88 CYS CB HB3 sing N N 89 CYS SG HG sing N N 90 CYS OXT HXT sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HOH O H1 sing N N 138 HOH O H2 sing N N 139 ILE N CA sing N N 140 ILE N H sing N N 141 ILE N H2 sing N N 142 ILE CA C sing N N 143 ILE CA CB sing N N 144 ILE CA HA sing N N 145 ILE C O doub N N 146 ILE C OXT sing N N 147 ILE CB CG1 sing N N 148 ILE CB CG2 sing N N 149 ILE CB HB sing N N 150 ILE CG1 CD1 sing N N 151 ILE CG1 HG12 sing N N 152 ILE CG1 HG13 sing N N 153 ILE CG2 HG21 sing N N 154 ILE CG2 HG22 sing N N 155 ILE CG2 HG23 sing N N 156 ILE CD1 HD11 sing N N 157 ILE CD1 HD12 sing N N 158 ILE CD1 HD13 sing N N 159 ILE OXT HXT sing N N 160 LEU N CA sing N N 161 LEU N H sing N N 162 LEU N H2 sing N N 163 LEU CA C sing N N 164 LEU CA CB sing N N 165 LEU CA HA sing N N 166 LEU C O doub N N 167 LEU C OXT sing N N 168 LEU CB CG sing N N 169 LEU CB HB2 sing N N 170 LEU CB HB3 sing N N 171 LEU CG CD1 sing N N 172 LEU CG CD2 sing N N 173 LEU CG HG sing N N 174 LEU CD1 HD11 sing N N 175 LEU CD1 HD12 sing N N 176 LEU CD1 HD13 sing N N 177 LEU CD2 HD21 sing N N 178 LEU CD2 HD22 sing N N 179 LEU CD2 HD23 sing N N 180 LEU OXT HXT sing N N 181 LYS N CA sing N N 182 LYS N H sing N N 183 LYS N H2 sing N N 184 LYS CA C sing N N 185 LYS CA CB sing N N 186 LYS CA HA sing N N 187 LYS C O doub N N 188 LYS C OXT sing N N 189 LYS CB CG sing N N 190 LYS CB HB2 sing N N 191 LYS CB HB3 sing N N 192 LYS CG CD sing N N 193 LYS CG HG2 sing N N 194 LYS CG HG3 sing N N 195 LYS CD CE sing N N 196 LYS CD HD2 sing N N 197 LYS CD HD3 sing N N 198 LYS CE NZ sing N N 199 LYS CE HE2 sing N N 200 LYS CE HE3 sing N N 201 LYS NZ HZ1 sing N N 202 LYS NZ HZ2 sing N N 203 LYS NZ HZ3 sing N N 204 LYS OXT HXT sing N N 205 MET N CA sing N N 206 MET N H sing N N 207 MET N H2 sing N N 208 MET CA C sing N N 209 MET CA CB sing N N 210 MET CA HA sing N N 211 MET C O doub N N 212 MET C OXT sing N N 213 MET CB CG sing N N 214 MET CB HB2 sing N N 215 MET CB HB3 sing N N 216 MET CG SD sing N N 217 MET CG HG2 sing N N 218 MET CG HG3 sing N N 219 MET SD CE sing N N 220 MET CE HE1 sing N N 221 MET CE HE2 sing N N 222 MET CE HE3 sing N N 223 MET OXT HXT sing N N 224 PEG C1 O1 sing N N 225 PEG C1 C2 sing N N 226 PEG C1 H11 sing N N 227 PEG C1 H12 sing N N 228 PEG O1 HO1 sing N N 229 PEG C2 O2 sing N N 230 PEG C2 H21 sing N N 231 PEG C2 H22 sing N N 232 PEG O2 C3 sing N N 233 PEG C3 C4 sing N N 234 PEG C3 H31 sing N N 235 PEG C3 H32 sing N N 236 PEG C4 O4 sing N N 237 PEG C4 H41 sing N N 238 PEG C4 H42 sing N N 239 PEG O4 HO4 sing N N 240 PHE N CA sing N N 241 PHE N H sing N N 242 PHE N H2 sing N N 243 PHE CA C sing N N 244 PHE CA CB sing N N 245 PHE CA HA sing N N 246 PHE C O doub N N 247 PHE C OXT sing N N 248 PHE CB CG sing N N 249 PHE CB HB2 sing N N 250 PHE CB HB3 sing N N 251 PHE CG CD1 doub Y N 252 PHE CG CD2 sing Y N 253 PHE CD1 CE1 sing Y N 254 PHE CD1 HD1 sing N N 255 PHE CD2 CE2 doub Y N 256 PHE CD2 HD2 sing N N 257 PHE CE1 CZ doub Y N 258 PHE CE1 HE1 sing N N 259 PHE CE2 CZ sing Y N 260 PHE CE2 HE2 sing N N 261 PHE CZ HZ sing N N 262 PHE OXT HXT sing N N 263 PRO N CA sing N N 264 PRO N CD sing N N 265 PRO N H sing N N 266 PRO CA C sing N N 267 PRO CA CB sing N N 268 PRO CA HA sing N N 269 PRO C O doub N N 270 PRO C OXT sing N N 271 PRO CB CG sing N N 272 PRO CB HB2 sing N N 273 PRO CB HB3 sing N N 274 PRO CG CD sing N N 275 PRO CG HG2 sing N N 276 PRO CG HG3 sing N N 277 PRO CD HD2 sing N N 278 PRO CD HD3 sing N N 279 PRO OXT HXT sing N N 280 SER N CA sing N N 281 SER N H sing N N 282 SER N H2 sing N N 283 SER CA C sing N N 284 SER CA CB sing N N 285 SER CA HA sing N N 286 SER C O doub N N 287 SER C OXT sing N N 288 SER CB OG sing N N 289 SER CB HB2 sing N N 290 SER CB HB3 sing N N 291 SER OG HG sing N N 292 SER OXT HXT sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Research Foundation (NRF, Korea)' 'Korea, Republic Of' NRF-2019R1A2C1002545 1 'National Research Foundation (NRF, Korea)' 'Korea, Republic Of' NRF-2018R1A5A2023127 2 'National Research Foundation (NRF, Korea)' 'Korea, Republic Of' NRF-2021R1F1A1060596 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 BETA-MERCAPTOETHANOL BME 3 'DI(HYDROXYETHYL)ETHER' PEG 4 'SODIUM ION' NA 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1NZN _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Analytical ultracentrifuge (AUC)' # _space_group.name_H-M_alt 'P 41 21 2' _space_group.name_Hall 'P 4abw 2nw' _space_group.IT_number 92 _space_group.crystal_system tetragonal _space_group.id 1 #