data_7A5M # _entry.id 7A5M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7A5M pdb_00007a5m 10.2210/pdb7a5m/pdb WWPDB D_1292110649 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-10-07 2 'Structure model' 1 1 2020-11-25 3 'Structure model' 1 2 2020-12-02 4 'Structure model' 1 3 2021-02-10 5 'Structure model' 1 4 2021-02-17 6 'Structure model' 1 5 2022-10-26 7 'Structure model' 2 0 2023-08-16 8 'Structure model' 3 0 2023-11-15 9 'Structure model' 3 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Database references' 5 6 'Structure model' 'Database references' 6 7 'Structure model' 'Atomic model' 7 7 'Structure model' 'Author supporting evidence' 8 7 'Structure model' 'Data collection' 9 7 'Structure model' 'Database references' 10 7 'Structure model' 'Derived calculations' 11 7 'Structure model' 'Non-polymer description' 12 7 'Structure model' 'Polymer sequence' 13 7 'Structure model' 'Source and taxonomy' 14 7 'Structure model' 'Structure summary' 15 8 'Structure model' 'Atomic model' 16 8 'Structure model' 'Data collection' 17 8 'Structure model' 'Derived calculations' 18 9 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' citation 5 4 'Structure model' citation_author 6 5 'Structure model' citation 7 5 'Structure model' citation_author 8 6 'Structure model' citation_author 9 6 'Structure model' database_2 10 7 'Structure model' atom_site 11 7 'Structure model' atom_site_anisotrop 12 7 'Structure model' chem_comp 13 7 'Structure model' chem_comp_atom 14 7 'Structure model' chem_comp_bond 15 7 'Structure model' entity 16 7 'Structure model' entity_poly 17 7 'Structure model' entity_poly_seq 18 7 'Structure model' entity_src_gen 19 7 'Structure model' pdbx_entity_instance_feature 20 7 'Structure model' pdbx_entity_src_syn 21 7 'Structure model' pdbx_poly_seq_scheme 22 7 'Structure model' struct_conn 23 7 'Structure model' struct_ref_seq 24 8 'Structure model' atom_site 25 8 'Structure model' atom_site_anisotrop 26 8 'Structure model' chem_comp_atom 27 8 'Structure model' chem_comp_bond 28 8 'Structure model' struct_conn 29 9 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 4 'Structure model' '_citation.journal_volume' 14 4 'Structure model' '_citation.page_first' 15 4 'Structure model' '_citation.page_last' 16 4 'Structure model' '_citation.pdbx_database_id_PubMed' 17 4 'Structure model' '_citation.title' 18 5 'Structure model' '_citation.journal_volume' 19 5 'Structure model' '_citation.page_first' 20 5 'Structure model' '_citation.page_last' 21 5 'Structure model' '_citation.pdbx_database_id_PubMed' 22 5 'Structure model' '_citation.title' 23 6 'Structure model' '_citation_author.identifier_ORCID' 24 6 'Structure model' '_database_2.pdbx_DOI' 25 6 'Structure model' '_database_2.pdbx_database_accession' 26 7 'Structure model' '_atom_site.B_iso_or_equiv' 27 7 'Structure model' '_atom_site.Cartn_x' 28 7 'Structure model' '_atom_site.Cartn_y' 29 7 'Structure model' '_atom_site.Cartn_z' 30 7 'Structure model' '_atom_site.auth_atom_id' 31 7 'Structure model' '_atom_site.auth_comp_id' 32 7 'Structure model' '_atom_site.auth_seq_id' 33 7 'Structure model' '_atom_site.label_atom_id' 34 7 'Structure model' '_atom_site.label_comp_id' 35 7 'Structure model' '_atom_site.label_seq_id' 36 7 'Structure model' '_atom_site.type_symbol' 37 7 'Structure model' '_atom_site_anisotrop.id' 38 7 'Structure model' '_atom_site_anisotrop.pdbx_auth_comp_id' 39 7 'Structure model' '_atom_site_anisotrop.pdbx_auth_seq_id' 40 7 'Structure model' '_atom_site_anisotrop.pdbx_label_comp_id' 41 7 'Structure model' '_atom_site_anisotrop.pdbx_label_seq_id' 42 7 'Structure model' '_chem_comp.formula' 43 7 'Structure model' '_chem_comp.formula_weight' 44 7 'Structure model' '_chem_comp.id' 45 7 'Structure model' '_chem_comp.mon_nstd_flag' 46 7 'Structure model' '_chem_comp.name' 47 7 'Structure model' '_chem_comp.pdbx_synonyms' 48 7 'Structure model' '_chem_comp.type' 49 7 'Structure model' '_entity.formula_weight' 50 7 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 51 7 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 52 7 'Structure model' '_entity_src_gen.gene_src_common_name' 53 7 'Structure model' '_pdbx_entity_src_syn.pdbx_beg_seq_num' 54 7 'Structure model' '_pdbx_entity_src_syn.pdbx_end_seq_num' 55 7 'Structure model' '_struct_ref_seq.db_align_end' 56 7 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_end' 57 7 'Structure model' '_struct_ref_seq.seq_align_end' 58 8 'Structure model' '_atom_site.B_iso_or_equiv' 59 8 'Structure model' '_atom_site.Cartn_x' 60 8 'Structure model' '_atom_site.Cartn_y' 61 8 'Structure model' '_atom_site.Cartn_z' 62 8 'Structure model' '_atom_site.auth_atom_id' 63 8 'Structure model' '_atom_site.label_alt_id' 64 8 'Structure model' '_atom_site.label_atom_id' 65 8 'Structure model' '_atom_site.occupancy' 66 8 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id' 67 8 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id' 68 8 'Structure model' '_chem_comp_atom.atom_id' 69 8 'Structure model' '_chem_comp_bond.atom_id_1' 70 8 'Structure model' '_chem_comp_bond.atom_id_2' 71 8 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 72 8 'Structure model' '_struct_conn.ptnr1_label_atom_id' 73 8 'Structure model' '_struct_conn.ptnr2_label_atom_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7A5M _pdbx_database_status.recvd_initial_deposition_date 2020-08-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Barone, M.' 1 0000-0002-6554-6464 'Roske, Y.' 2 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary Proc.Natl.Acad.Sci.USA PNASA6 0040 1091-6490 ? ? 117 ? 29684 29690 'Designed nanomolar small-molecule inhibitors of Ena/VASP EVH1 interaction impair invasion and extravasation of breast cancer cells.' 2020 ? 10.1073/pnas.2007213117 33184177 ? ? ? ? ? ? ? ? US ? ? 1 'Proc. Natl. Acad. Sci. U.S.A.' PNASA6 0040 1091-6490 ? ? 112 ? 5011 5016 'A modular toolkit to inhibit proline-rich motif-mediated protein-protein interactions.' 2015 ? 10.1073/pnas.1422054112 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Barone, M.' 1 0000-0002-6554-6464 primary 'Muller, M.' 2 ? primary 'Chiha, S.' 3 ? primary 'Ren, J.' 4 ? primary 'Albat, D.' 5 ? primary 'Soicke, A.' 6 ? primary 'Dohmen, S.' 7 ? primary 'Klein, M.' 8 ? primary 'Bruns, J.' 9 ? primary 'van Dinther, M.' 10 ? primary 'Opitz, R.' 11 ? primary 'Lindemann, P.' 12 ? primary 'Beerbaum, M.' 13 ? primary 'Motzny, K.' 14 ? primary 'Roske, Y.' 15 ? primary 'Schmieder, P.' 16 0000-0001-9968-9327 primary 'Volkmer, R.' 17 ? primary 'Nazare, M.' 18 0000-0002-1602-2330 primary 'Heinemann, U.' 19 0000-0002-8191-3850 primary 'Oschkinat, H.' 20 ? primary 'Ten Dijke, P.' 21 ? primary 'Schmalz, H.G.' 22 0000-0003-0489-1827 primary 'Kuhne, R.' 23 ? 1 'Opitz, R.' 24 ? 1 'Muller, M.' 25 ? 1 'Reuter, C.' 26 ? 1 'Barone, M.' 27 ? 1 'Soicke, A.' 28 ? 1 'Roske, Y.' 29 ? 1 'Piotukh, K.' 30 ? 1 'Huy, P.' 31 ? 1 'Beerbaum, M.' 32 ? 1 'Wiesner, B.' 33 ? 1 'Beyermann, M.' 34 ? 1 'Schmieder, P.' 35 ? 1 'Freund, C.' 36 ? 1 'Volkmer, R.' 37 ? 1 'Oschkinat, H.' 38 ? 1 'Schmalz, H.G.' 39 ? 1 'Kuhne, R.' 40 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein enabled homolog' 12628.273 1 ? ? ? ? 2 polymer syn 'Ac-[2-Cl-F]-[ProM-2]-[ProM-17]-OMe' 706.271 2 ? ? ? ? 3 non-polymer syn 'NITRATE ION' 62.005 1 ? ? ? ? 4 water nat water 18.015 166 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFH QWRDARQVYGLNFGSKEDANVFASAMMHALEVL ; ;GSMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFH QWRDARQVYGLNFGSKEDANVFASAMMHALEVL ; A ? 2 'polypeptide(L)' no yes '(ACE)(2L5)(2L6)(JQ0)' XXXX B,C ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'NITRATE ION' NO3 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 SER n 1 5 GLU n 1 6 GLN n 1 7 SER n 1 8 ILE n 1 9 CYS n 1 10 GLN n 1 11 ALA n 1 12 ARG n 1 13 ALA n 1 14 ALA n 1 15 VAL n 1 16 MET n 1 17 VAL n 1 18 TYR n 1 19 ASP n 1 20 ASP n 1 21 ALA n 1 22 ASN n 1 23 LYS n 1 24 LYS n 1 25 TRP n 1 26 VAL n 1 27 PRO n 1 28 ALA n 1 29 GLY n 1 30 GLY n 1 31 SER n 1 32 THR n 1 33 GLY n 1 34 PHE n 1 35 SER n 1 36 ARG n 1 37 VAL n 1 38 HIS n 1 39 ILE n 1 40 TYR n 1 41 HIS n 1 42 HIS n 1 43 THR n 1 44 GLY n 1 45 ASN n 1 46 ASN n 1 47 THR n 1 48 PHE n 1 49 ARG n 1 50 VAL n 1 51 VAL n 1 52 GLY n 1 53 ARG n 1 54 LYS n 1 55 ILE n 1 56 GLN n 1 57 ASP n 1 58 HIS n 1 59 GLN n 1 60 VAL n 1 61 VAL n 1 62 ILE n 1 63 ASN n 1 64 CYS n 1 65 ALA n 1 66 ILE n 1 67 PRO n 1 68 LYS n 1 69 GLY n 1 70 LEU n 1 71 LYS n 1 72 TYR n 1 73 ASN n 1 74 GLN n 1 75 ALA n 1 76 THR n 1 77 GLN n 1 78 THR n 1 79 PHE n 1 80 HIS n 1 81 GLN n 1 82 TRP n 1 83 ARG n 1 84 ASP n 1 85 ALA n 1 86 ARG n 1 87 GLN n 1 88 VAL n 1 89 TYR n 1 90 GLY n 1 91 LEU n 1 92 ASN n 1 93 PHE n 1 94 GLY n 1 95 SER n 1 96 LYS n 1 97 GLU n 1 98 ASP n 1 99 ALA n 1 100 ASN n 1 101 VAL n 1 102 PHE n 1 103 ALA n 1 104 SER n 1 105 ALA n 1 106 MET n 1 107 MET n 1 108 HIS n 1 109 ALA n 1 110 LEU n 1 111 GLU n 1 112 VAL n 1 113 LEU n 2 1 ACE n 2 2 2L5 n 2 3 2L6 n 2 4 JQ0 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 113 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ENAH, MENA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 4 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2L5 'L-peptide linking' . 2-chloro-L-phenylalanine ? 'C9 H10 Cl N O2' 199.634 2L6 'L-peptide linking' . ;(3S,6R,8aS)-5-oxo-1,2,3,8a-tetrahydrospiro[indolizine-6,2'-pyrrolidine]-3-carboxylic acid ; ? 'C12 H16 N2 O3' 236.267 ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 JQ0 non-polymer . ;methyl 2-[(3~{a}~{R},6~{R},8~{a}~{S})-6-(2-methylpropyl)-8-oxidanylidene-1,2,3,3~{a},6,8~{a}-hexahydropyrrolo[2,3-c]azepin-7-yl]ethanoate ; ? 'C15 H24 N2 O3' 280.363 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NO3 non-polymer . 'NITRATE ION' ? 'N O3 -1' 62.005 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 SER 2 0 0 SER SER A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 SER 4 2 2 SER SER A . n A 1 5 GLU 5 3 3 GLU GLU A . n A 1 6 GLN 6 4 4 GLN GLN A . n A 1 7 SER 7 5 5 SER SER A . n A 1 8 ILE 8 6 6 ILE ILE A . n A 1 9 CYS 9 7 7 CYS CYS A . n A 1 10 GLN 10 8 8 GLN GLN A . n A 1 11 ALA 11 9 9 ALA ALA A . n A 1 12 ARG 12 10 10 ARG ARG A . n A 1 13 ALA 13 11 11 ALA ALA A . n A 1 14 ALA 14 12 12 ALA ALA A . n A 1 15 VAL 15 13 13 VAL VAL A . n A 1 16 MET 16 14 14 MET MET A . n A 1 17 VAL 17 15 15 VAL VAL A . n A 1 18 TYR 18 16 16 TYR TYR A . n A 1 19 ASP 19 17 17 ASP ASP A . n A 1 20 ASP 20 18 18 ASP ASP A . n A 1 21 ALA 21 19 19 ALA ALA A . n A 1 22 ASN 22 20 20 ASN ASN A . n A 1 23 LYS 23 21 21 LYS LYS A . n A 1 24 LYS 24 22 22 LYS LYS A . n A 1 25 TRP 25 23 23 TRP TRP A . n A 1 26 VAL 26 24 24 VAL VAL A . n A 1 27 PRO 27 25 25 PRO PRO A . n A 1 28 ALA 28 26 26 ALA ALA A . n A 1 29 GLY 29 27 27 GLY GLY A . n A 1 30 GLY 30 28 28 GLY GLY A . n A 1 31 SER 31 29 29 SER SER A . n A 1 32 THR 32 30 30 THR THR A . n A 1 33 GLY 33 31 31 GLY GLY A . n A 1 34 PHE 34 32 32 PHE PHE A . n A 1 35 SER 35 33 33 SER SER A . n A 1 36 ARG 36 34 34 ARG ARG A . n A 1 37 VAL 37 35 35 VAL VAL A . n A 1 38 HIS 38 36 36 HIS HIS A . n A 1 39 ILE 39 37 37 ILE ILE A . n A 1 40 TYR 40 38 38 TYR TYR A . n A 1 41 HIS 41 39 39 HIS HIS A . n A 1 42 HIS 42 40 40 HIS HIS A . n A 1 43 THR 43 41 41 THR THR A . n A 1 44 GLY 44 42 42 GLY GLY A . n A 1 45 ASN 45 43 43 ASN ASN A . n A 1 46 ASN 46 44 44 ASN ASN A . n A 1 47 THR 47 45 45 THR THR A . n A 1 48 PHE 48 46 46 PHE PHE A . n A 1 49 ARG 49 47 47 ARG ARG A . n A 1 50 VAL 50 48 48 VAL VAL A . n A 1 51 VAL 51 49 49 VAL VAL A . n A 1 52 GLY 52 50 50 GLY GLY A . n A 1 53 ARG 53 51 51 ARG ARG A . n A 1 54 LYS 54 52 52 LYS LYS A . n A 1 55 ILE 55 53 53 ILE ILE A . n A 1 56 GLN 56 54 54 GLN GLN A . n A 1 57 ASP 57 55 55 ASP ASP A . n A 1 58 HIS 58 56 56 HIS HIS A . n A 1 59 GLN 59 57 57 GLN GLN A . n A 1 60 VAL 60 58 58 VAL VAL A . n A 1 61 VAL 61 59 59 VAL VAL A . n A 1 62 ILE 62 60 60 ILE ILE A . n A 1 63 ASN 63 61 61 ASN ASN A . n A 1 64 CYS 64 62 62 CYS CYS A . n A 1 65 ALA 65 63 63 ALA ALA A . n A 1 66 ILE 66 64 64 ILE ILE A . n A 1 67 PRO 67 65 65 PRO PRO A . n A 1 68 LYS 68 66 66 LYS LYS A . n A 1 69 GLY 69 67 67 GLY GLY A . n A 1 70 LEU 70 68 68 LEU LEU A . n A 1 71 LYS 71 69 69 LYS LYS A . n A 1 72 TYR 72 70 70 TYR TYR A . n A 1 73 ASN 73 71 71 ASN ASN A . n A 1 74 GLN 74 72 72 GLN GLN A . n A 1 75 ALA 75 73 73 ALA ALA A . n A 1 76 THR 76 74 74 THR THR A . n A 1 77 GLN 77 75 75 GLN GLN A . n A 1 78 THR 78 76 76 THR THR A . n A 1 79 PHE 79 77 77 PHE PHE A . n A 1 80 HIS 80 78 78 HIS HIS A . n A 1 81 GLN 81 79 79 GLN GLN A . n A 1 82 TRP 82 80 80 TRP TRP A . n A 1 83 ARG 83 81 81 ARG ARG A . n A 1 84 ASP 84 82 82 ASP ASP A . n A 1 85 ALA 85 83 83 ALA ALA A . n A 1 86 ARG 86 84 84 ARG ARG A . n A 1 87 GLN 87 85 85 GLN GLN A . n A 1 88 VAL 88 86 86 VAL VAL A . n A 1 89 TYR 89 87 87 TYR TYR A . n A 1 90 GLY 90 88 88 GLY GLY A . n A 1 91 LEU 91 89 89 LEU LEU A . n A 1 92 ASN 92 90 90 ASN ASN A . n A 1 93 PHE 93 91 91 PHE PHE A . n A 1 94 GLY 94 92 92 GLY GLY A . n A 1 95 SER 95 93 93 SER SER A . n A 1 96 LYS 96 94 94 LYS LYS A . n A 1 97 GLU 97 95 95 GLU GLU A . n A 1 98 ASP 98 96 96 ASP ASP A . n A 1 99 ALA 99 97 97 ALA ALA A . n A 1 100 ASN 100 98 98 ASN ASN A . n A 1 101 VAL 101 99 99 VAL VAL A . n A 1 102 PHE 102 100 100 PHE PHE A . n A 1 103 ALA 103 101 101 ALA ALA A . n A 1 104 SER 104 102 102 SER SER A . n A 1 105 ALA 105 103 103 ALA ALA A . n A 1 106 MET 106 104 104 MET MET A . n A 1 107 MET 107 105 105 MET MET A . n A 1 108 HIS 108 106 106 HIS HIS A . n A 1 109 ALA 109 107 107 ALA ALA A . n A 1 110 LEU 110 108 108 LEU LEU A . n A 1 111 GLU 111 109 109 GLU GLU A . n A 1 112 VAL 112 110 110 VAL VAL A . n A 1 113 LEU 113 111 111 LEU LEU A . n B 2 1 ACE 1 1 1 ACE 217 B . n B 2 2 2L5 2 2 1 2L5 217 B . n B 2 3 2L6 3 3 1 2L6 217 B . n B 2 4 JQ0 4 4 1 JQ0 217 B . n C 2 1 ACE 1 1 2 ACE 217 C . n C 2 2 2L5 2 2 2 2L5 217 C . n C 2 3 2L6 3 3 2 2L6 217 C . n C 2 4 JQ0 4 4 2 JQ0 217 C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 3 NO3 1 201 1 NO3 NO3 A . E 4 HOH 1 301 91 HOH HOH A . E 4 HOH 2 302 155 HOH HOH A . E 4 HOH 3 303 174 HOH HOH A . E 4 HOH 4 304 87 HOH HOH A . E 4 HOH 5 305 29 HOH HOH A . E 4 HOH 6 306 20 HOH HOH A . E 4 HOH 7 307 71 HOH HOH A . E 4 HOH 8 308 121 HOH HOH A . E 4 HOH 9 309 175 HOH HOH A . E 4 HOH 10 310 183 HOH HOH A . E 4 HOH 11 311 136 HOH HOH A . E 4 HOH 12 312 162 HOH HOH A . E 4 HOH 13 313 41 HOH HOH A . E 4 HOH 14 314 119 HOH HOH A . E 4 HOH 15 315 75 HOH HOH A . E 4 HOH 16 316 73 HOH HOH A . E 4 HOH 17 317 161 HOH HOH A . E 4 HOH 18 318 39 HOH HOH A . E 4 HOH 19 319 28 HOH HOH A . E 4 HOH 20 320 85 HOH HOH A . E 4 HOH 21 321 17 HOH HOH A . E 4 HOH 22 322 52 HOH HOH A . E 4 HOH 23 323 16 HOH HOH A . E 4 HOH 24 324 193 HOH HOH A . E 4 HOH 25 325 107 HOH HOH A . E 4 HOH 26 326 2 HOH HOH A . E 4 HOH 27 327 6 HOH HOH A . E 4 HOH 28 328 46 HOH HOH A . E 4 HOH 29 329 124 HOH HOH A . E 4 HOH 30 330 56 HOH HOH A . E 4 HOH 31 331 9 HOH HOH A . E 4 HOH 32 332 202 HOH HOH A . E 4 HOH 33 333 19 HOH HOH A . E 4 HOH 34 334 12 HOH HOH A . E 4 HOH 35 335 44 HOH HOH A . E 4 HOH 36 336 116 HOH HOH A . E 4 HOH 37 337 186 HOH HOH A . E 4 HOH 38 338 98 HOH HOH A . E 4 HOH 39 339 11 HOH HOH A . E 4 HOH 40 340 59 HOH HOH A . E 4 HOH 41 341 94 HOH HOH A . E 4 HOH 42 342 112 HOH HOH A . E 4 HOH 43 343 23 HOH HOH A . E 4 HOH 44 344 90 HOH HOH A . E 4 HOH 45 345 49 HOH HOH A . E 4 HOH 46 346 156 HOH HOH A . E 4 HOH 47 347 66 HOH HOH A . E 4 HOH 48 348 18 HOH HOH A . E 4 HOH 49 349 25 HOH HOH A . E 4 HOH 50 350 142 HOH HOH A . E 4 HOH 51 351 160 HOH HOH A . E 4 HOH 52 352 32 HOH HOH A . E 4 HOH 53 353 31 HOH HOH A . E 4 HOH 54 354 37 HOH HOH A . E 4 HOH 55 355 68 HOH HOH A . E 4 HOH 56 356 1 HOH HOH A . E 4 HOH 57 357 58 HOH HOH A . E 4 HOH 58 358 164 HOH HOH A . E 4 HOH 59 359 154 HOH HOH A . E 4 HOH 60 360 111 HOH HOH A . E 4 HOH 61 361 74 HOH HOH A . E 4 HOH 62 362 113 HOH HOH A . E 4 HOH 63 363 110 HOH HOH A . E 4 HOH 64 364 10 HOH HOH A . E 4 HOH 65 365 15 HOH HOH A . E 4 HOH 66 366 54 HOH HOH A . E 4 HOH 67 367 122 HOH HOH A . E 4 HOH 68 368 45 HOH HOH A . E 4 HOH 69 369 88 HOH HOH A . E 4 HOH 70 370 189 HOH HOH A . E 4 HOH 71 371 151 HOH HOH A . E 4 HOH 72 372 114 HOH HOH A . E 4 HOH 73 373 27 HOH HOH A . E 4 HOH 74 374 47 HOH HOH A . E 4 HOH 75 375 5 HOH HOH A . E 4 HOH 76 376 82 HOH HOH A . E 4 HOH 77 377 22 HOH HOH A . E 4 HOH 78 378 138 HOH HOH A . E 4 HOH 79 379 64 HOH HOH A . E 4 HOH 80 380 40 HOH HOH A . E 4 HOH 81 381 50 HOH HOH A . E 4 HOH 82 382 95 HOH HOH A . E 4 HOH 83 383 42 HOH HOH A . E 4 HOH 84 384 83 HOH HOH A . E 4 HOH 85 385 8 HOH HOH A . E 4 HOH 86 386 13 HOH HOH A . E 4 HOH 87 387 152 HOH HOH A . E 4 HOH 88 388 96 HOH HOH A . E 4 HOH 89 389 4 HOH HOH A . E 4 HOH 90 390 36 HOH HOH A . E 4 HOH 91 391 159 HOH HOH A . E 4 HOH 92 392 84 HOH HOH A . E 4 HOH 93 393 67 HOH HOH A . E 4 HOH 94 394 53 HOH HOH A . E 4 HOH 95 395 203 HOH HOH A . E 4 HOH 96 396 3 HOH HOH A . E 4 HOH 97 397 115 HOH HOH A . E 4 HOH 98 398 34 HOH HOH A . E 4 HOH 99 399 14 HOH HOH A . E 4 HOH 100 400 86 HOH HOH A . E 4 HOH 101 401 35 HOH HOH A . E 4 HOH 102 402 81 HOH HOH A . E 4 HOH 103 403 145 HOH HOH A . E 4 HOH 104 404 55 HOH HOH A . E 4 HOH 105 405 24 HOH HOH A . E 4 HOH 106 406 51 HOH HOH A . E 4 HOH 107 407 78 HOH HOH A . E 4 HOH 108 408 26 HOH HOH A . E 4 HOH 109 409 178 HOH HOH A . E 4 HOH 110 410 60 HOH HOH A . E 4 HOH 111 411 158 HOH HOH A . E 4 HOH 112 412 62 HOH HOH A . E 4 HOH 113 413 184 HOH HOH A . E 4 HOH 114 414 191 HOH HOH A . E 4 HOH 115 415 105 HOH HOH A . E 4 HOH 116 416 99 HOH HOH A . E 4 HOH 117 417 57 HOH HOH A . E 4 HOH 118 418 199 HOH HOH A . E 4 HOH 119 419 197 HOH HOH A . E 4 HOH 120 420 128 HOH HOH A . E 4 HOH 121 421 63 HOH HOH A . E 4 HOH 122 422 168 HOH HOH A . E 4 HOH 123 423 77 HOH HOH A . E 4 HOH 124 424 133 HOH HOH A . E 4 HOH 125 425 108 HOH HOH A . E 4 HOH 126 426 169 HOH HOH A . E 4 HOH 127 427 163 HOH HOH A . E 4 HOH 128 428 80 HOH HOH A . E 4 HOH 129 429 43 HOH HOH A . E 4 HOH 130 430 118 HOH HOH A . E 4 HOH 131 431 65 HOH HOH A . E 4 HOH 132 432 180 HOH HOH A . E 4 HOH 133 433 92 HOH HOH A . E 4 HOH 134 434 126 HOH HOH A . E 4 HOH 135 435 33 HOH HOH A . E 4 HOH 136 436 201 HOH HOH A . E 4 HOH 137 437 97 HOH HOH A . E 4 HOH 138 438 104 HOH HOH A . E 4 HOH 139 439 137 HOH HOH A . E 4 HOH 140 440 38 HOH HOH A . E 4 HOH 141 441 135 HOH HOH A . E 4 HOH 142 442 179 HOH HOH A . E 4 HOH 143 443 103 HOH HOH A . E 4 HOH 144 444 89 HOH HOH A . E 4 HOH 145 445 166 HOH HOH A . E 4 HOH 146 446 30 HOH HOH A . E 4 HOH 147 447 130 HOH HOH A . E 4 HOH 148 448 127 HOH HOH A . E 4 HOH 149 449 146 HOH HOH A . E 4 HOH 150 450 192 HOH HOH A . E 4 HOH 151 451 117 HOH HOH A . E 4 HOH 152 452 100 HOH HOH A . E 4 HOH 153 453 196 HOH HOH A . E 4 HOH 154 454 176 HOH HOH A . E 4 HOH 155 455 147 HOH HOH A . F 4 HOH 1 101 69 HOH HOH B . F 4 HOH 2 102 21 HOH HOH B . F 4 HOH 3 103 185 HOH HOH B . F 4 HOH 4 104 79 HOH HOH B . F 4 HOH 5 105 70 HOH HOH B . F 4 HOH 6 106 7 HOH HOH B . F 4 HOH 7 107 48 HOH HOH B . F 4 HOH 8 108 141 HOH HOH B . G 4 HOH 1 101 171 HOH HOH C . G 4 HOH 2 102 134 HOH HOH C . G 4 HOH 3 103 182 HOH HOH C . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7A5M _cell.details ? _cell.formula_units_Z ? _cell.length_a 35.150 _cell.length_a_esd ? _cell.length_b 61.360 _cell.length_b_esd ? _cell.length_c 88.940 _cell.length_c_esd ? _cell.volume 191826.148 _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7A5M _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7A5M _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.91 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 35.51 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 300.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.90M ammonium sulfate, 360mM ammonium nitrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-01-29 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.82656 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.82656 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.2 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 9.26 _reflns.entry_id 7A5M _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 0.78 _reflns.d_resolution_low 30.68 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 106735 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.08 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.051 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 0.78 _reflns_shell.d_res_low 0.85 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.10 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 23284 _reflns_shell.percent_possible_all 94.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 16 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.81 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.539 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 15.86 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7A5M _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 0.78 _refine.ls_d_res_low 17.97 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 106735 _refine.ls_number_reflns_R_free 10302 _refine.ls_number_reflns_R_work 195866 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.39 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1202 _refine.ls_R_factor_R_free 0.1400 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1192 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.30 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5NCG _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 1.1000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 16.9610 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1062 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 0.78 _refine_hist.d_res_low 17.97 _refine_hist.number_atoms_solvent 166 _refine_hist.number_atoms_total 1155 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 883 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 106 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0217 ? 1488 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 2.3765 ? 2073 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.3114 ? 211 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0156 ? 274 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 18.6091 ? 702 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 0.78 0.79 . . 333 6280 93.31 . . . 0.3963 . 0.3849 . . . . . . . . . . . 'X-RAY DIFFRACTION' 0.79 0.80 . . 332 6277 93.39 . . . 0.3600 . 0.3787 . . . . . . . . . . . 'X-RAY DIFFRACTION' 0.80 0.81 . . 315 5918 89.06 . . . 0.4835 . 0.4735 . . . . . . . . . . . 'X-RAY DIFFRACTION' 0.81 0.82 . . 333 6365 94.19 . . . 0.3704 . 0.3708 . . . . . . . . . . . 'X-RAY DIFFRACTION' 0.82 0.83 . . 337 6287 94.55 . . . 0.3485 . 0.3606 . . . . . . . . . . . 'X-RAY DIFFRACTION' 0.83 0.84 . . 338 6417 94.89 . . . 0.3255 . 0.3039 . . . . . . . . . . . 'X-RAY DIFFRACTION' 0.84 0.85 . . 330 6322 95.16 . . . 0.2637 . 0.2720 . . . . . . . . . . . 'X-RAY DIFFRACTION' 0.85 0.86 . . 339 6442 95.63 . . . 0.2881 . 0.2520 . . . . . . . . . . . 'X-RAY DIFFRACTION' 0.86 0.88 . . 335 6433 95.88 . . . 0.2206 . 0.2140 . . . . . . . . . . . 'X-RAY DIFFRACTION' 0.88 0.89 . . 346 6473 96.63 . . . 0.2191 . 0.1966 . . . . . . . . . . . 'X-RAY DIFFRACTION' 0.89 0.91 . . 342 6540 97.19 . . . 0.1960 . 0.1842 . . . . . . . . . . . 'X-RAY DIFFRACTION' 0.91 0.92 . . 345 6523 97.27 . . . 0.1815 . 0.1673 . . . . . . . . . . . 'X-RAY DIFFRACTION' 0.92 0.94 . . 342 6469 97.59 . . . 0.1616 . 0.1533 . . . . . . . . . . . 'X-RAY DIFFRACTION' 0.94 0.96 . . 346 6572 97.79 . . . 0.1720 . 0.1474 . . . . . . . . . . . 'X-RAY DIFFRACTION' 0.96 0.98 . . 343 6621 98.06 . . . 0.1549 . 0.1311 . . . . . . . . . . . 'X-RAY DIFFRACTION' 0.98 1.01 . . 348 6579 98.28 . . . 0.1268 . 0.1208 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.01 1.03 . . 350 6571 98.41 . . . 0.1213 . 0.1074 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.03 1.06 . . 343 6607 98.65 . . . 0.1290 . 0.0982 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.06 1.09 . . 348 6619 98.89 . . . 0.1038 . 0.0904 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.09 1.12 . . 344 6658 99.04 . . . 0.1220 . 0.0867 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.12 1.17 . . 348 6645 99.30 . . . 0.0861 . 0.0823 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.17 1.21 . . 354 6699 99.46 . . . 0.1044 . 0.0845 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.21 1.27 . . 350 6668 99.57 . . . 0.1019 . 0.0905 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.27 1.33 . . 347 6676 99.70 . . . 0.1276 . 0.0953 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.33 1.42 . . 352 6722 99.86 . . . 0.1049 . 0.0945 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.42 1.53 . . 351 6682 99.97 . . . 0.1148 . 0.0977 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.53 1.68 . . 355 6723 99.97 . . . 0.1219 . 0.0997 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.68 1.92 . . 355 6660 100.00 . . . 0.1145 . 0.1120 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.92 2.42 . . 346 6702 100.00 . . . 0.1444 . 0.1135 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.42 17.97 . . 355 6716 99.90 . . . 0.1535 . 0.1233 . . . . . . . . . . . # _struct.entry_id 7A5M _struct.title 'ENAH EVH1 in complex with Ac-[2-Cl-F]-[ProM-2]-[ProM-17]-OMe' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7A5M _struct_keywords.text 'proline-rich motif, Ena/VASP inhibitor, actin, protein-protein interaction, CELL INVASION' _struct_keywords.pdbx_keywords 'CELL INVASION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 4 ? G N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP ENAH_HUMAN Q8N8S7 ? 1 ;MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQW RDARQVYGLNFGSKEDANVFASAMMHALEVL ; 1 2 PDB 7A5M 7A5M ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7A5M A 3 ? 113 ? Q8N8S7 1 ? 111 ? 1 111 2 2 7A5M B 1 ? 4 ? 7A5M 1 ? 4 ? 1 4 3 2 7A5M C 1 ? 4 ? 7A5M 1 ? 4 ? 1 4 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7A5M GLY A 1 ? UNP Q8N8S7 ? ? 'expression tag' -1 1 1 7A5M SER A 2 ? UNP Q8N8S7 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1880 ? 1 MORE -0 ? 1 'SSA (A^2)' 6740 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Runs as monomer on a size exclusion column.' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 29 ? SER A 31 ? GLY A 27 SER A 29 5 ? 3 HELX_P HELX_P2 AA2 SER A 95 ? LEU A 113 ? SER A 93 LEU A 111 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ACE 1 C A ? ? 1_555 B 2L5 2 N A ? B ACE 1 B 2L5 2 1_555 ? ? ? ? ? ? ? 1.339 ? ? covale2 covale both ? B ACE 1 C B ? ? 1_555 B 2L5 2 N B ? B ACE 1 B 2L5 2 1_555 ? ? ? ? ? ? ? 1.304 ? ? covale3 covale both ? B 2L5 2 C A ? ? 1_555 B 2L6 3 N A ? B 2L5 2 B 2L6 3 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale4 covale both ? B 2L5 2 C B ? ? 1_555 B 2L6 3 N B ? B 2L5 2 B 2L6 3 1_555 ? ? ? ? ? ? ? 1.350 ? ? covale5 covale both ? B 2L6 3 C A ? ? 1_555 B JQ0 4 NBF A ? B 2L6 3 B JQ0 4 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale6 covale both ? B 2L6 3 C B ? ? 1_555 B JQ0 4 NBF B ? B 2L6 3 B JQ0 4 1_555 ? ? ? ? ? ? ? 1.342 ? ? covale7 covale both ? C ACE 1 C A ? ? 1_555 C 2L5 2 N A ? C ACE 1 C 2L5 2 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale8 covale both ? C ACE 1 C B ? ? 1_555 C 2L5 2 N B ? C ACE 1 C 2L5 2 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale9 covale both ? C 2L5 2 C A ? ? 1_555 C 2L6 3 N A ? C 2L5 2 C 2L6 3 1_555 ? ? ? ? ? ? ? 1.350 ? ? covale10 covale both ? C 2L5 2 C B ? ? 1_555 C 2L6 3 N B ? C 2L5 2 C 2L6 3 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale11 covale both ? C 2L5 2 C C ? ? 1_555 C 2L6 3 N C ? C 2L5 2 C 2L6 3 1_555 ? ? ? ? ? ? ? 1.342 ? ? covale12 covale both ? C 2L6 3 C A ? ? 1_555 C JQ0 4 NBF A ? C 2L6 3 C JQ0 4 1_555 ? ? ? ? ? ? ? 1.346 ? ? covale13 covale both ? C 2L6 3 C B ? ? 1_555 C JQ0 4 NBF B ? C 2L6 3 C JQ0 4 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale14 covale both ? C 2L6 3 C C ? ? 1_555 C JQ0 4 NBF C ? C 2L6 3 C JQ0 4 1_555 ? ? ? ? ? ? ? 1.369 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 24 ? PRO A 27 ? LYS A 22 PRO A 25 AA1 2 GLU A 5 ? ASP A 19 ? GLU A 3 ASP A 17 AA1 3 PHE A 34 ? HIS A 42 ? PHE A 32 HIS A 40 AA1 4 THR A 47 ? LYS A 54 ? THR A 45 LYS A 52 AA1 5 VAL A 60 ? ILE A 66 ? VAL A 58 ILE A 64 AA2 1 LYS A 24 ? PRO A 27 ? LYS A 22 PRO A 25 AA2 2 GLU A 5 ? ASP A 19 ? GLU A 3 ASP A 17 AA2 3 VAL A 88 ? PHE A 93 ? VAL A 86 PHE A 91 AA2 4 PHE A 79 ? ARG A 83 ? PHE A 77 ARG A 81 AA2 5 TYR A 72 ? GLN A 74 ? TYR A 70 GLN A 72 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 24 ? O LYS A 22 N ASP A 19 ? N ASP A 17 AA1 2 3 N ALA A 11 ? N ALA A 9 O VAL A 37 ? O VAL A 35 AA1 3 4 N HIS A 38 ? N HIS A 36 O VAL A 51 ? O VAL A 49 AA1 4 5 N VAL A 50 ? N VAL A 48 O CYS A 64 ? O CYS A 62 AA2 1 2 O LYS A 24 ? O LYS A 22 N ASP A 19 ? N ASP A 17 AA2 2 3 N ALA A 14 ? N ALA A 12 O ASN A 92 ? O ASN A 90 AA2 3 4 O LEU A 91 ? O LEU A 89 N HIS A 80 ? N HIS A 78 AA2 4 5 O GLN A 81 ? O GLN A 79 N ASN A 73 ? N ASN A 71 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASN 98 ? B O A HOH 301 ? ? 2.03 2 1 O A HOH 301 ? ? O A HOH 360 ? ? 2.07 3 1 O A HOH 353 ? ? O A HOH 438 ? ? 2.18 4 1 O A HOH 444 ? ? O A HOH 447 ? ? 2.18 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A CYS 7 ? A SG A CYS 7 ? A 1.660 1.812 -0.152 0.016 N 2 1 CB A VAL 24 ? ? CG2 A VAL 24 ? ? 1.287 1.524 -0.237 0.021 N 3 1 CB A VAL 99 ? B CG2 A VAL 99 ? B 1.717 1.524 0.193 0.021 N 4 1 CB A VAL 110 ? ? CG2 A VAL 110 ? ? 1.375 1.524 -0.149 0.021 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG1 A VAL 99 ? A CB A VAL 99 ? A CG2 A VAL 99 ? A 121.49 110.90 10.59 1.60 N 2 1 CG1 A VAL 99 ? B CB A VAL 99 ? B CG2 A VAL 99 ? B 127.15 110.90 16.25 1.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 7 ? B -173.58 139.41 2 1 ASN A 61 ? A -154.70 82.20 3 1 ASN A 61 ? B -154.33 87.43 4 1 ALA A 63 ? A -49.00 150.38 5 1 ASP A 82 ? A -119.85 -168.89 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ARG _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 81 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 A _pdbx_validate_peptide_omega.auth_comp_id_2 ASP _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 82 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 A _pdbx_validate_peptide_omega.omega 141.79 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 411 ? E HOH . 2 1 A HOH 431 ? E HOH . 3 1 A HOH 433 ? E HOH . 4 1 B HOH 101 ? F HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # _pdbx_entry_details.entry_id 7A5M _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 453 ? 6.15 . 2 1 O ? A HOH 454 ? 7.91 . 3 1 O ? A HOH 455 ? 8.11 . # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLY _pdbx_unobs_or_zero_occ_residues.auth_seq_id -1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id GLY _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 2L5 CL CL N N 1 2L5 C15 C Y N 2 2L5 C19 C Y N 3 2L5 C18 C Y N 4 2L5 C17 C Y N 5 2L5 C16 C Y N 6 2L5 C14 C Y N 7 2L5 C13 C N N 8 2L5 CA C N S 9 2L5 N N N N 10 2L5 C C N N 11 2L5 O O N N 12 2L5 H1 H N N 13 2L5 H20 H N N 14 2L5 H3 H N N 15 2L5 H4 H N N 16 2L5 H5 H N N 17 2L5 H6 H N N 18 2L5 HA H N N 19 2L5 H H N N 20 2L5 H2 H N N 21 2L5 OXT O N N 22 2L5 HXT H N N 23 2L6 N N N N 24 2L6 C30 C N N 25 2L6 C29 C N N 26 2L6 C34 C N N 27 2L6 CA C N R 28 2L6 C31 C N N 29 2L6 O3 O N N 30 2L6 N3 N N N 31 2L6 C26 C N N 32 2L6 C28 C N N 33 2L6 C27 C N S 34 2L6 C24 C N N 35 2L6 C9 C N N 36 2L6 C10 C N S 37 2L6 C C N N 38 2L6 O O N N 39 2L6 H12 H N N 40 2L6 H13 H N N 41 2L6 H14 H N N 42 2L6 H15 H N N 43 2L6 H16 H N N 44 2L6 H17 H N N 45 2L6 H18 H N N 46 2L6 H19 H N N 47 2L6 H20 H N N 48 2L6 H21 H N N 49 2L6 H22 H N N 50 2L6 H23 H N N 51 2L6 H24 H N N 52 2L6 H25 H N N 53 2L6 H H N N 54 2L6 OXT O N N 55 2L6 HXT H N N 56 ACE C C N N 57 ACE O O N N 58 ACE CH3 C N N 59 ACE H H N N 60 ACE H1 H N N 61 ACE H2 H N N 62 ACE H3 H N N 63 ALA N N N N 64 ALA CA C N S 65 ALA C C N N 66 ALA O O N N 67 ALA CB C N N 68 ALA OXT O N N 69 ALA H H N N 70 ALA H2 H N N 71 ALA HA H N N 72 ALA HB1 H N N 73 ALA HB2 H N N 74 ALA HB3 H N N 75 ALA HXT H N N 76 ARG N N N N 77 ARG CA C N S 78 ARG C C N N 79 ARG O O N N 80 ARG CB C N N 81 ARG CG C N N 82 ARG CD C N N 83 ARG NE N N N 84 ARG CZ C N N 85 ARG NH1 N N N 86 ARG NH2 N N N 87 ARG OXT O N N 88 ARG H H N N 89 ARG H2 H N N 90 ARG HA H N N 91 ARG HB2 H N N 92 ARG HB3 H N N 93 ARG HG2 H N N 94 ARG HG3 H N N 95 ARG HD2 H N N 96 ARG HD3 H N N 97 ARG HE H N N 98 ARG HH11 H N N 99 ARG HH12 H N N 100 ARG HH21 H N N 101 ARG HH22 H N N 102 ARG HXT H N N 103 ASN N N N N 104 ASN CA C N S 105 ASN C C N N 106 ASN O O N N 107 ASN CB C N N 108 ASN CG C N N 109 ASN OD1 O N N 110 ASN ND2 N N N 111 ASN OXT O N N 112 ASN H H N N 113 ASN H2 H N N 114 ASN HA H N N 115 ASN HB2 H N N 116 ASN HB3 H N N 117 ASN HD21 H N N 118 ASN HD22 H N N 119 ASN HXT H N N 120 ASP N N N N 121 ASP CA C N S 122 ASP C C N N 123 ASP O O N N 124 ASP CB C N N 125 ASP CG C N N 126 ASP OD1 O N N 127 ASP OD2 O N N 128 ASP OXT O N N 129 ASP H H N N 130 ASP H2 H N N 131 ASP HA H N N 132 ASP HB2 H N N 133 ASP HB3 H N N 134 ASP HD2 H N N 135 ASP HXT H N N 136 CYS N N N N 137 CYS CA C N R 138 CYS C C N N 139 CYS O O N N 140 CYS CB C N N 141 CYS SG S N N 142 CYS OXT O N N 143 CYS H H N N 144 CYS H2 H N N 145 CYS HA H N N 146 CYS HB2 H N N 147 CYS HB3 H N N 148 CYS HG H N N 149 CYS HXT H N N 150 GLN N N N N 151 GLN CA C N S 152 GLN C C N N 153 GLN O O N N 154 GLN CB C N N 155 GLN CG C N N 156 GLN CD C N N 157 GLN OE1 O N N 158 GLN NE2 N N N 159 GLN OXT O N N 160 GLN H H N N 161 GLN H2 H N N 162 GLN HA H N N 163 GLN HB2 H N N 164 GLN HB3 H N N 165 GLN HG2 H N N 166 GLN HG3 H N N 167 GLN HE21 H N N 168 GLN HE22 H N N 169 GLN HXT H N N 170 GLU N N N N 171 GLU CA C N S 172 GLU C C N N 173 GLU O O N N 174 GLU CB C N N 175 GLU CG C N N 176 GLU CD C N N 177 GLU OE1 O N N 178 GLU OE2 O N N 179 GLU OXT O N N 180 GLU H H N N 181 GLU H2 H N N 182 GLU HA H N N 183 GLU HB2 H N N 184 GLU HB3 H N N 185 GLU HG2 H N N 186 GLU HG3 H N N 187 GLU HE2 H N N 188 GLU HXT H N N 189 GLY N N N N 190 GLY CA C N N 191 GLY C C N N 192 GLY O O N N 193 GLY OXT O N N 194 GLY H H N N 195 GLY H2 H N N 196 GLY HA2 H N N 197 GLY HA3 H N N 198 GLY HXT H N N 199 HIS N N N N 200 HIS CA C N S 201 HIS C C N N 202 HIS O O N N 203 HIS CB C N N 204 HIS CG C Y N 205 HIS ND1 N Y N 206 HIS CD2 C Y N 207 HIS CE1 C Y N 208 HIS NE2 N Y N 209 HIS OXT O N N 210 HIS H H N N 211 HIS H2 H N N 212 HIS HA H N N 213 HIS HB2 H N N 214 HIS HB3 H N N 215 HIS HD1 H N N 216 HIS HD2 H N N 217 HIS HE1 H N N 218 HIS HE2 H N N 219 HIS HXT H N N 220 HOH O O N N 221 HOH H1 H N N 222 HOH H2 H N N 223 ILE N N N N 224 ILE CA C N S 225 ILE C C N N 226 ILE O O N N 227 ILE CB C N S 228 ILE CG1 C N N 229 ILE CG2 C N N 230 ILE CD1 C N N 231 ILE OXT O N N 232 ILE H H N N 233 ILE H2 H N N 234 ILE HA H N N 235 ILE HB H N N 236 ILE HG12 H N N 237 ILE HG13 H N N 238 ILE HG21 H N N 239 ILE HG22 H N N 240 ILE HG23 H N N 241 ILE HD11 H N N 242 ILE HD12 H N N 243 ILE HD13 H N N 244 ILE HXT H N N 245 JQ0 CBG C N S 246 JQ0 CBH C N N 247 JQ0 CBK C N N 248 JQ0 CBL C N N 249 JQ0 CBP C N N 250 JQ0 CBQ C N N 251 JQ0 CBR C N N 252 JQ0 CBS C N N 253 JQ0 CBT C N R 254 JQ0 CBU C N N 255 JQ0 CBV C N N 256 JQ0 CBW C N R 257 JQ0 CBX C N N 258 JQ0 CBY C N N 259 JQ0 NBF N N N 260 JQ0 NBJ N N N 261 JQ0 OBI O N N 262 JQ0 OBO O N N 263 JQ0 C C N N 264 JQ0 O O N N 265 JQ0 HBG H N N 266 JQ0 HZS H N N 267 JQ0 HBK H N N 268 JQ0 HBP H N N 269 JQ0 HZV H N N 270 JQ0 HZW H N N 271 JQ0 HBQ H N N 272 JQ0 HBR H N N 273 JQ0 HZX H N N 274 JQ0 HZY H N N 275 JQ0 HBS H N N 276 JQ0 HZZ H N N 277 JQ0 HBT H N N 278 JQ0 HBU H N N 279 JQ0 HBV H N N 280 JQ0 HBW H N N 281 JQ0 HBX H N N 282 JQ0 HZ0 H N N 283 JQ0 HZ1 H N N 284 JQ0 HBY H N N 285 JQ0 H4 H N N 286 JQ0 H2 H N N 287 JQ0 H1 H N N 288 JQ0 H3 H N N 289 LEU N N N N 290 LEU CA C N S 291 LEU C C N N 292 LEU O O N N 293 LEU CB C N N 294 LEU CG C N N 295 LEU CD1 C N N 296 LEU CD2 C N N 297 LEU OXT O N N 298 LEU H H N N 299 LEU H2 H N N 300 LEU HA H N N 301 LEU HB2 H N N 302 LEU HB3 H N N 303 LEU HG H N N 304 LEU HD11 H N N 305 LEU HD12 H N N 306 LEU HD13 H N N 307 LEU HD21 H N N 308 LEU HD22 H N N 309 LEU HD23 H N N 310 LEU HXT H N N 311 LYS N N N N 312 LYS CA C N S 313 LYS C C N N 314 LYS O O N N 315 LYS CB C N N 316 LYS CG C N N 317 LYS CD C N N 318 LYS CE C N N 319 LYS NZ N N N 320 LYS OXT O N N 321 LYS H H N N 322 LYS H2 H N N 323 LYS HA H N N 324 LYS HB2 H N N 325 LYS HB3 H N N 326 LYS HG2 H N N 327 LYS HG3 H N N 328 LYS HD2 H N N 329 LYS HD3 H N N 330 LYS HE2 H N N 331 LYS HE3 H N N 332 LYS HZ1 H N N 333 LYS HZ2 H N N 334 LYS HZ3 H N N 335 LYS HXT H N N 336 MET N N N N 337 MET CA C N S 338 MET C C N N 339 MET O O N N 340 MET CB C N N 341 MET CG C N N 342 MET SD S N N 343 MET CE C N N 344 MET OXT O N N 345 MET H H N N 346 MET H2 H N N 347 MET HA H N N 348 MET HB2 H N N 349 MET HB3 H N N 350 MET HG2 H N N 351 MET HG3 H N N 352 MET HE1 H N N 353 MET HE2 H N N 354 MET HE3 H N N 355 MET HXT H N N 356 NO3 N N N N 357 NO3 O1 O N N 358 NO3 O2 O N N 359 NO3 O3 O N N 360 PHE N N N N 361 PHE CA C N S 362 PHE C C N N 363 PHE O O N N 364 PHE CB C N N 365 PHE CG C Y N 366 PHE CD1 C Y N 367 PHE CD2 C Y N 368 PHE CE1 C Y N 369 PHE CE2 C Y N 370 PHE CZ C Y N 371 PHE OXT O N N 372 PHE H H N N 373 PHE H2 H N N 374 PHE HA H N N 375 PHE HB2 H N N 376 PHE HB3 H N N 377 PHE HD1 H N N 378 PHE HD2 H N N 379 PHE HE1 H N N 380 PHE HE2 H N N 381 PHE HZ H N N 382 PHE HXT H N N 383 PRO N N N N 384 PRO CA C N S 385 PRO C C N N 386 PRO O O N N 387 PRO CB C N N 388 PRO CG C N N 389 PRO CD C N N 390 PRO OXT O N N 391 PRO H H N N 392 PRO HA H N N 393 PRO HB2 H N N 394 PRO HB3 H N N 395 PRO HG2 H N N 396 PRO HG3 H N N 397 PRO HD2 H N N 398 PRO HD3 H N N 399 PRO HXT H N N 400 SER N N N N 401 SER CA C N S 402 SER C C N N 403 SER O O N N 404 SER CB C N N 405 SER OG O N N 406 SER OXT O N N 407 SER H H N N 408 SER H2 H N N 409 SER HA H N N 410 SER HB2 H N N 411 SER HB3 H N N 412 SER HG H N N 413 SER HXT H N N 414 THR N N N N 415 THR CA C N S 416 THR C C N N 417 THR O O N N 418 THR CB C N R 419 THR OG1 O N N 420 THR CG2 C N N 421 THR OXT O N N 422 THR H H N N 423 THR H2 H N N 424 THR HA H N N 425 THR HB H N N 426 THR HG1 H N N 427 THR HG21 H N N 428 THR HG22 H N N 429 THR HG23 H N N 430 THR HXT H N N 431 TRP N N N N 432 TRP CA C N S 433 TRP C C N N 434 TRP O O N N 435 TRP CB C N N 436 TRP CG C Y N 437 TRP CD1 C Y N 438 TRP CD2 C Y N 439 TRP NE1 N Y N 440 TRP CE2 C Y N 441 TRP CE3 C Y N 442 TRP CZ2 C Y N 443 TRP CZ3 C Y N 444 TRP CH2 C Y N 445 TRP OXT O N N 446 TRP H H N N 447 TRP H2 H N N 448 TRP HA H N N 449 TRP HB2 H N N 450 TRP HB3 H N N 451 TRP HD1 H N N 452 TRP HE1 H N N 453 TRP HE3 H N N 454 TRP HZ2 H N N 455 TRP HZ3 H N N 456 TRP HH2 H N N 457 TRP HXT H N N 458 TYR N N N N 459 TYR CA C N S 460 TYR C C N N 461 TYR O O N N 462 TYR CB C N N 463 TYR CG C Y N 464 TYR CD1 C Y N 465 TYR CD2 C Y N 466 TYR CE1 C Y N 467 TYR CE2 C Y N 468 TYR CZ C Y N 469 TYR OH O N N 470 TYR OXT O N N 471 TYR H H N N 472 TYR H2 H N N 473 TYR HA H N N 474 TYR HB2 H N N 475 TYR HB3 H N N 476 TYR HD1 H N N 477 TYR HD2 H N N 478 TYR HE1 H N N 479 TYR HE2 H N N 480 TYR HH H N N 481 TYR HXT H N N 482 VAL N N N N 483 VAL CA C N S 484 VAL C C N N 485 VAL O O N N 486 VAL CB C N N 487 VAL CG1 C N N 488 VAL CG2 C N N 489 VAL OXT O N N 490 VAL H H N N 491 VAL H2 H N N 492 VAL HA H N N 493 VAL HB H N N 494 VAL HG11 H N N 495 VAL HG12 H N N 496 VAL HG13 H N N 497 VAL HG21 H N N 498 VAL HG22 H N N 499 VAL HG23 H N N 500 VAL HXT H N N 501 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 2L5 C17 C18 doub Y N 1 2L5 C17 C16 sing Y N 2 2L5 C18 C19 sing Y N 3 2L5 C16 C14 doub Y N 4 2L5 N CA sing N N 5 2L5 C19 C15 doub Y N 6 2L5 C14 C15 sing Y N 7 2L5 C14 C13 sing N N 8 2L5 C15 CL sing N N 9 2L5 CA C13 sing N N 10 2L5 CA C sing N N 11 2L5 O C doub N N 12 2L5 C19 H1 sing N N 13 2L5 C18 H20 sing N N 14 2L5 C17 H3 sing N N 15 2L5 C16 H4 sing N N 16 2L5 C13 H5 sing N N 17 2L5 C13 H6 sing N N 18 2L5 CA HA sing N N 19 2L5 N H sing N N 20 2L5 N H2 sing N N 21 2L5 C OXT sing N N 22 2L5 OXT HXT sing N N 23 2L6 N C30 sing N N 24 2L6 N CA sing N N 25 2L6 C26 C28 doub N N 26 2L6 C26 CA sing N N 27 2L6 C28 C27 sing N N 28 2L6 C30 C29 sing N N 29 2L6 CA C31 sing N N 30 2L6 CA C34 sing N N 31 2L6 C24 C27 sing N N 32 2L6 C24 C9 sing N N 33 2L6 C31 O3 doub N N 34 2L6 C31 N3 sing N N 35 2L6 C27 N3 sing N N 36 2L6 N3 C10 sing N N 37 2L6 C9 C10 sing N N 38 2L6 C10 C sing N N 39 2L6 C34 C29 sing N N 40 2L6 C O doub N N 41 2L6 C30 H12 sing N N 42 2L6 C30 H13 sing N N 43 2L6 C29 H14 sing N N 44 2L6 C29 H15 sing N N 45 2L6 C34 H16 sing N N 46 2L6 C34 H17 sing N N 47 2L6 C26 H18 sing N N 48 2L6 C28 H19 sing N N 49 2L6 C27 H20 sing N N 50 2L6 C24 H21 sing N N 51 2L6 C24 H22 sing N N 52 2L6 C9 H23 sing N N 53 2L6 C9 H24 sing N N 54 2L6 C10 H25 sing N N 55 2L6 N H sing N N 56 2L6 C OXT sing N N 57 2L6 OXT HXT sing N N 58 ACE C O doub N N 59 ACE C CH3 sing N N 60 ACE C H sing N N 61 ACE CH3 H1 sing N N 62 ACE CH3 H2 sing N N 63 ACE CH3 H3 sing N N 64 ALA N CA sing N N 65 ALA N H sing N N 66 ALA N H2 sing N N 67 ALA CA C sing N N 68 ALA CA CB sing N N 69 ALA CA HA sing N N 70 ALA C O doub N N 71 ALA C OXT sing N N 72 ALA CB HB1 sing N N 73 ALA CB HB2 sing N N 74 ALA CB HB3 sing N N 75 ALA OXT HXT sing N N 76 ARG N CA sing N N 77 ARG N H sing N N 78 ARG N H2 sing N N 79 ARG CA C sing N N 80 ARG CA CB sing N N 81 ARG CA HA sing N N 82 ARG C O doub N N 83 ARG C OXT sing N N 84 ARG CB CG sing N N 85 ARG CB HB2 sing N N 86 ARG CB HB3 sing N N 87 ARG CG CD sing N N 88 ARG CG HG2 sing N N 89 ARG CG HG3 sing N N 90 ARG CD NE sing N N 91 ARG CD HD2 sing N N 92 ARG CD HD3 sing N N 93 ARG NE CZ sing N N 94 ARG NE HE sing N N 95 ARG CZ NH1 sing N N 96 ARG CZ NH2 doub N N 97 ARG NH1 HH11 sing N N 98 ARG NH1 HH12 sing N N 99 ARG NH2 HH21 sing N N 100 ARG NH2 HH22 sing N N 101 ARG OXT HXT sing N N 102 ASN N CA sing N N 103 ASN N H sing N N 104 ASN N H2 sing N N 105 ASN CA C sing N N 106 ASN CA CB sing N N 107 ASN CA HA sing N N 108 ASN C O doub N N 109 ASN C OXT sing N N 110 ASN CB CG sing N N 111 ASN CB HB2 sing N N 112 ASN CB HB3 sing N N 113 ASN CG OD1 doub N N 114 ASN CG ND2 sing N N 115 ASN ND2 HD21 sing N N 116 ASN ND2 HD22 sing N N 117 ASN OXT HXT sing N N 118 ASP N CA sing N N 119 ASP N H sing N N 120 ASP N H2 sing N N 121 ASP CA C sing N N 122 ASP CA CB sing N N 123 ASP CA HA sing N N 124 ASP C O doub N N 125 ASP C OXT sing N N 126 ASP CB CG sing N N 127 ASP CB HB2 sing N N 128 ASP CB HB3 sing N N 129 ASP CG OD1 doub N N 130 ASP CG OD2 sing N N 131 ASP OD2 HD2 sing N N 132 ASP OXT HXT sing N N 133 CYS N CA sing N N 134 CYS N H sing N N 135 CYS N H2 sing N N 136 CYS CA C sing N N 137 CYS CA CB sing N N 138 CYS CA HA sing N N 139 CYS C O doub N N 140 CYS C OXT sing N N 141 CYS CB SG sing N N 142 CYS CB HB2 sing N N 143 CYS CB HB3 sing N N 144 CYS SG HG sing N N 145 CYS OXT HXT sing N N 146 GLN N CA sing N N 147 GLN N H sing N N 148 GLN N H2 sing N N 149 GLN CA C sing N N 150 GLN CA CB sing N N 151 GLN CA HA sing N N 152 GLN C O doub N N 153 GLN C OXT sing N N 154 GLN CB CG sing N N 155 GLN CB HB2 sing N N 156 GLN CB HB3 sing N N 157 GLN CG CD sing N N 158 GLN CG HG2 sing N N 159 GLN CG HG3 sing N N 160 GLN CD OE1 doub N N 161 GLN CD NE2 sing N N 162 GLN NE2 HE21 sing N N 163 GLN NE2 HE22 sing N N 164 GLN OXT HXT sing N N 165 GLU N CA sing N N 166 GLU N H sing N N 167 GLU N H2 sing N N 168 GLU CA C sing N N 169 GLU CA CB sing N N 170 GLU CA HA sing N N 171 GLU C O doub N N 172 GLU C OXT sing N N 173 GLU CB CG sing N N 174 GLU CB HB2 sing N N 175 GLU CB HB3 sing N N 176 GLU CG CD sing N N 177 GLU CG HG2 sing N N 178 GLU CG HG3 sing N N 179 GLU CD OE1 doub N N 180 GLU CD OE2 sing N N 181 GLU OE2 HE2 sing N N 182 GLU OXT HXT sing N N 183 GLY N CA sing N N 184 GLY N H sing N N 185 GLY N H2 sing N N 186 GLY CA C sing N N 187 GLY CA HA2 sing N N 188 GLY CA HA3 sing N N 189 GLY C O doub N N 190 GLY C OXT sing N N 191 GLY OXT HXT sing N N 192 HIS N CA sing N N 193 HIS N H sing N N 194 HIS N H2 sing N N 195 HIS CA C sing N N 196 HIS CA CB sing N N 197 HIS CA HA sing N N 198 HIS C O doub N N 199 HIS C OXT sing N N 200 HIS CB CG sing N N 201 HIS CB HB2 sing N N 202 HIS CB HB3 sing N N 203 HIS CG ND1 sing Y N 204 HIS CG CD2 doub Y N 205 HIS ND1 CE1 doub Y N 206 HIS ND1 HD1 sing N N 207 HIS CD2 NE2 sing Y N 208 HIS CD2 HD2 sing N N 209 HIS CE1 NE2 sing Y N 210 HIS CE1 HE1 sing N N 211 HIS NE2 HE2 sing N N 212 HIS OXT HXT sing N N 213 HOH O H1 sing N N 214 HOH O H2 sing N N 215 ILE N CA sing N N 216 ILE N H sing N N 217 ILE N H2 sing N N 218 ILE CA C sing N N 219 ILE CA CB sing N N 220 ILE CA HA sing N N 221 ILE C O doub N N 222 ILE C OXT sing N N 223 ILE CB CG1 sing N N 224 ILE CB CG2 sing N N 225 ILE CB HB sing N N 226 ILE CG1 CD1 sing N N 227 ILE CG1 HG12 sing N N 228 ILE CG1 HG13 sing N N 229 ILE CG2 HG21 sing N N 230 ILE CG2 HG22 sing N N 231 ILE CG2 HG23 sing N N 232 ILE CD1 HD11 sing N N 233 ILE CD1 HD12 sing N N 234 ILE CD1 HD13 sing N N 235 ILE OXT HXT sing N N 236 JQ0 CBV CBU doub N N 237 JQ0 CBV CBW sing N N 238 JQ0 CBU CBT sing N N 239 JQ0 CBQ CBP sing N N 240 JQ0 CBX CBW sing N N 241 JQ0 CBX CBY sing N N 242 JQ0 CBW CBG sing N N 243 JQ0 CBP CBS sing N N 244 JQ0 CBP CBR sing N N 245 JQ0 CBS CBT sing N N 246 JQ0 CBT NBJ sing N N 247 JQ0 CBY NBF sing N N 248 JQ0 NBJ CBK sing N N 249 JQ0 NBJ CBH sing N N 250 JQ0 CBK CBL sing N N 251 JQ0 CBG CBH sing N N 252 JQ0 CBG NBF sing N N 253 JQ0 CBH OBI doub N N 254 JQ0 O CBL sing N N 255 JQ0 O C sing N N 256 JQ0 CBL OBO doub N N 257 JQ0 CBG HBG sing N N 258 JQ0 CBK HZS sing N N 259 JQ0 CBK HBK sing N N 260 JQ0 CBP HBP sing N N 261 JQ0 CBQ HZV sing N N 262 JQ0 CBQ HZW sing N N 263 JQ0 CBQ HBQ sing N N 264 JQ0 CBR HBR sing N N 265 JQ0 CBR HZX sing N N 266 JQ0 CBR HZY sing N N 267 JQ0 CBS HBS sing N N 268 JQ0 CBS HZZ sing N N 269 JQ0 CBT HBT sing N N 270 JQ0 CBU HBU sing N N 271 JQ0 CBV HBV sing N N 272 JQ0 CBW HBW sing N N 273 JQ0 CBX HBX sing N N 274 JQ0 CBX HZ0 sing N N 275 JQ0 CBY HZ1 sing N N 276 JQ0 CBY HBY sing N N 277 JQ0 NBF H4 sing N N 278 JQ0 C H2 sing N N 279 JQ0 C H1 sing N N 280 JQ0 C H3 sing N N 281 LEU N CA sing N N 282 LEU N H sing N N 283 LEU N H2 sing N N 284 LEU CA C sing N N 285 LEU CA CB sing N N 286 LEU CA HA sing N N 287 LEU C O doub N N 288 LEU C OXT sing N N 289 LEU CB CG sing N N 290 LEU CB HB2 sing N N 291 LEU CB HB3 sing N N 292 LEU CG CD1 sing N N 293 LEU CG CD2 sing N N 294 LEU CG HG sing N N 295 LEU CD1 HD11 sing N N 296 LEU CD1 HD12 sing N N 297 LEU CD1 HD13 sing N N 298 LEU CD2 HD21 sing N N 299 LEU CD2 HD22 sing N N 300 LEU CD2 HD23 sing N N 301 LEU OXT HXT sing N N 302 LYS N CA sing N N 303 LYS N H sing N N 304 LYS N H2 sing N N 305 LYS CA C sing N N 306 LYS CA CB sing N N 307 LYS CA HA sing N N 308 LYS C O doub N N 309 LYS C OXT sing N N 310 LYS CB CG sing N N 311 LYS CB HB2 sing N N 312 LYS CB HB3 sing N N 313 LYS CG CD sing N N 314 LYS CG HG2 sing N N 315 LYS CG HG3 sing N N 316 LYS CD CE sing N N 317 LYS CD HD2 sing N N 318 LYS CD HD3 sing N N 319 LYS CE NZ sing N N 320 LYS CE HE2 sing N N 321 LYS CE HE3 sing N N 322 LYS NZ HZ1 sing N N 323 LYS NZ HZ2 sing N N 324 LYS NZ HZ3 sing N N 325 LYS OXT HXT sing N N 326 MET N CA sing N N 327 MET N H sing N N 328 MET N H2 sing N N 329 MET CA C sing N N 330 MET CA CB sing N N 331 MET CA HA sing N N 332 MET C O doub N N 333 MET C OXT sing N N 334 MET CB CG sing N N 335 MET CB HB2 sing N N 336 MET CB HB3 sing N N 337 MET CG SD sing N N 338 MET CG HG2 sing N N 339 MET CG HG3 sing N N 340 MET SD CE sing N N 341 MET CE HE1 sing N N 342 MET CE HE2 sing N N 343 MET CE HE3 sing N N 344 MET OXT HXT sing N N 345 NO3 N O1 doub N N 346 NO3 N O2 sing N N 347 NO3 N O3 sing N N 348 PHE N CA sing N N 349 PHE N H sing N N 350 PHE N H2 sing N N 351 PHE CA C sing N N 352 PHE CA CB sing N N 353 PHE CA HA sing N N 354 PHE C O doub N N 355 PHE C OXT sing N N 356 PHE CB CG sing N N 357 PHE CB HB2 sing N N 358 PHE CB HB3 sing N N 359 PHE CG CD1 doub Y N 360 PHE CG CD2 sing Y N 361 PHE CD1 CE1 sing Y N 362 PHE CD1 HD1 sing N N 363 PHE CD2 CE2 doub Y N 364 PHE CD2 HD2 sing N N 365 PHE CE1 CZ doub Y N 366 PHE CE1 HE1 sing N N 367 PHE CE2 CZ sing Y N 368 PHE CE2 HE2 sing N N 369 PHE CZ HZ sing N N 370 PHE OXT HXT sing N N 371 PRO N CA sing N N 372 PRO N CD sing N N 373 PRO N H sing N N 374 PRO CA C sing N N 375 PRO CA CB sing N N 376 PRO CA HA sing N N 377 PRO C O doub N N 378 PRO C OXT sing N N 379 PRO CB CG sing N N 380 PRO CB HB2 sing N N 381 PRO CB HB3 sing N N 382 PRO CG CD sing N N 383 PRO CG HG2 sing N N 384 PRO CG HG3 sing N N 385 PRO CD HD2 sing N N 386 PRO CD HD3 sing N N 387 PRO OXT HXT sing N N 388 SER N CA sing N N 389 SER N H sing N N 390 SER N H2 sing N N 391 SER CA C sing N N 392 SER CA CB sing N N 393 SER CA HA sing N N 394 SER C O doub N N 395 SER C OXT sing N N 396 SER CB OG sing N N 397 SER CB HB2 sing N N 398 SER CB HB3 sing N N 399 SER OG HG sing N N 400 SER OXT HXT sing N N 401 THR N CA sing N N 402 THR N H sing N N 403 THR N H2 sing N N 404 THR CA C sing N N 405 THR CA CB sing N N 406 THR CA HA sing N N 407 THR C O doub N N 408 THR C OXT sing N N 409 THR CB OG1 sing N N 410 THR CB CG2 sing N N 411 THR CB HB sing N N 412 THR OG1 HG1 sing N N 413 THR CG2 HG21 sing N N 414 THR CG2 HG22 sing N N 415 THR CG2 HG23 sing N N 416 THR OXT HXT sing N N 417 TRP N CA sing N N 418 TRP N H sing N N 419 TRP N H2 sing N N 420 TRP CA C sing N N 421 TRP CA CB sing N N 422 TRP CA HA sing N N 423 TRP C O doub N N 424 TRP C OXT sing N N 425 TRP CB CG sing N N 426 TRP CB HB2 sing N N 427 TRP CB HB3 sing N N 428 TRP CG CD1 doub Y N 429 TRP CG CD2 sing Y N 430 TRP CD1 NE1 sing Y N 431 TRP CD1 HD1 sing N N 432 TRP CD2 CE2 doub Y N 433 TRP CD2 CE3 sing Y N 434 TRP NE1 CE2 sing Y N 435 TRP NE1 HE1 sing N N 436 TRP CE2 CZ2 sing Y N 437 TRP CE3 CZ3 doub Y N 438 TRP CE3 HE3 sing N N 439 TRP CZ2 CH2 doub Y N 440 TRP CZ2 HZ2 sing N N 441 TRP CZ3 CH2 sing Y N 442 TRP CZ3 HZ3 sing N N 443 TRP CH2 HH2 sing N N 444 TRP OXT HXT sing N N 445 TYR N CA sing N N 446 TYR N H sing N N 447 TYR N H2 sing N N 448 TYR CA C sing N N 449 TYR CA CB sing N N 450 TYR CA HA sing N N 451 TYR C O doub N N 452 TYR C OXT sing N N 453 TYR CB CG sing N N 454 TYR CB HB2 sing N N 455 TYR CB HB3 sing N N 456 TYR CG CD1 doub Y N 457 TYR CG CD2 sing Y N 458 TYR CD1 CE1 sing Y N 459 TYR CD1 HD1 sing N N 460 TYR CD2 CE2 doub Y N 461 TYR CD2 HD2 sing N N 462 TYR CE1 CZ doub Y N 463 TYR CE1 HE1 sing N N 464 TYR CE2 CZ sing Y N 465 TYR CE2 HE2 sing N N 466 TYR CZ OH sing N N 467 TYR OH HH sing N N 468 TYR OXT HXT sing N N 469 VAL N CA sing N N 470 VAL N H sing N N 471 VAL N H2 sing N N 472 VAL CA C sing N N 473 VAL CA CB sing N N 474 VAL CA HA sing N N 475 VAL C O doub N N 476 VAL C OXT sing N N 477 VAL CB CG1 sing N N 478 VAL CB CG2 sing N N 479 VAL CB HB sing N N 480 VAL CG1 HG11 sing N N 481 VAL CG1 HG12 sing N N 482 VAL CG1 HG13 sing N N 483 VAL CG2 HG21 sing N N 484 VAL CG2 HG22 sing N N 485 VAL CG2 HG23 sing N N 486 VAL OXT HXT sing N N 487 # _pdbx_audit_support.funding_organization 'German Federal Ministry for Education and Research' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 16GW0186K _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 2L5 ? ? 2L5 ? ? 'SUBJECT OF INVESTIGATION' ? 2 ACE ? ? ACE ? ? 'SUBJECT OF INVESTIGATION' ? 3 2L6 ? ? 2L6 ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5NCG _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 7A5M _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.028450 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016297 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011244 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 2.51340 1.74867 1.72398 ? 31.80534 0.44561 10.58317 ? 0.0 ;3-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 8.12176 6.65345 2.19044 ? 0.69793 25.89440 6.00738 ? 0.0 ;3-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.53795 0.34799 0.11320 ? 10.08003 29.74760 2.57510 ? 0.0 ;3-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 2.99955 2.25584 1.72788 ? 23.27268 7.45433 0.31622 ? 0.0 ;3-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 3.21184 3.04156 1.73156 ? 18.83700 5.90590 0.24126 ? 0.0 ;3-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 6.83013 6.13863 2.99358 ? 0.66409 30.18870 3.52397 ? 0.0 ;3-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_