data_7BMG # _entry.id 7BMG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7BMG pdb_00007bmg 10.2210/pdb7bmg/pdb WWPDB D_1292113598 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-04-07 2 'Structure model' 2 0 2021-04-21 3 'Structure model' 2 1 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Database references' 4 2 'Structure model' 'Derived calculations' 5 2 'Structure model' 'Experimental preparation' 6 2 'Structure model' 'Non-polymer description' 7 2 'Structure model' 'Polymer sequence' 8 2 'Structure model' 'Source and taxonomy' 9 2 'Structure model' 'Structure summary' 10 3 'Structure model' 'Data collection' 11 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' atom_site_anisotrop 3 2 'Structure model' chem_comp 4 2 'Structure model' citation 5 2 'Structure model' citation_author 6 2 'Structure model' entity 7 2 'Structure model' entity_poly 8 2 'Structure model' entity_poly_seq 9 2 'Structure model' entity_src_gen 10 2 'Structure model' exptl_crystal 11 2 'Structure model' pdbx_poly_seq_scheme 12 2 'Structure model' pdbx_struct_sheet_hbond 13 2 'Structure model' pdbx_unobs_or_zero_occ_residues 14 2 'Structure model' struct_conf 15 2 'Structure model' struct_ref 16 2 'Structure model' struct_ref_seq 17 2 'Structure model' struct_ref_seq_dif 18 2 'Structure model' struct_sheet_range 19 2 'Structure model' struct_site_gen 20 3 'Structure model' chem_comp_atom 21 3 'Structure model' chem_comp_bond 22 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.label_seq_id' 2 2 'Structure model' '_atom_site_anisotrop.pdbx_label_seq_id' 3 2 'Structure model' '_chem_comp.formula' 4 2 'Structure model' '_chem_comp.formula_weight' 5 2 'Structure model' '_chem_comp.id' 6 2 'Structure model' '_chem_comp.mon_nstd_flag' 7 2 'Structure model' '_chem_comp.name' 8 2 'Structure model' '_chem_comp.type' 9 2 'Structure model' '_citation.journal_volume' 10 2 'Structure model' '_citation.page_first' 11 2 'Structure model' '_citation.page_last' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 2 'Structure model' '_entity.formula_weight' 14 2 'Structure model' '_entity.pdbx_description' 15 2 'Structure model' '_entity.pdbx_ec' 16 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 17 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 18 2 'Structure model' '_exptl_crystal.density_Matthews' 19 2 'Structure model' '_exptl_crystal.density_percent_sol' 20 2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_seq_id' 21 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_seq_id' 22 2 'Structure model' '_struct_conf.beg_label_seq_id' 23 2 'Structure model' '_struct_conf.end_label_seq_id' 24 2 'Structure model' '_struct_sheet_range.beg_label_seq_id' 25 2 'Structure model' '_struct_sheet_range.end_label_seq_id' 26 2 'Structure model' '_struct_site_gen.label_seq_id' 27 3 'Structure model' '_database_2.pdbx_DOI' 28 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7BMG _pdbx_database_status.recvd_initial_deposition_date 2021-01-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Williams, P.A.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-1257-2351 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 64 _citation.language ? _citation.page_first 4071 _citation.page_last 4088 _citation.title 'Structure-Based Design of Potent and Orally Active Isoindolinone Inhibitors of MDM2-p53 Protein-Protein Interaction.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.0c02188 _citation.pdbx_database_id_PubMed 33761253 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chessari, G.' 1 ? primary 'Hardcastle, I.R.' 2 ? primary 'Ahn, J.S.' 3 ? primary 'Anil, B.' 4 ? primary 'Anscombe, E.' 5 ? primary 'Bawn, R.H.' 6 ? primary 'Bevan, L.D.' 7 ? primary 'Blackburn, T.J.' 8 ? primary 'Buck, I.' 9 ? primary 'Cano, C.' 10 ? primary 'Carbain, B.' 11 ? primary 'Castro, J.' 12 ? primary 'Cons, B.' 13 ? primary 'Cully, S.J.' 14 ? primary 'Endicott, J.A.' 15 ? primary 'Fazal, L.' 16 ? primary 'Golding, B.T.' 17 ? primary 'Griffin, R.J.' 18 ? primary 'Haggerty, K.' 19 ? primary 'Harnor, S.J.' 20 ? primary 'Hearn, K.' 21 ? primary 'Hobson, S.' 22 ? primary 'Holvey, R.S.' 23 ? primary 'Howard, S.' 24 ? primary 'Jennings, C.E.' 25 ? primary 'Johnson, C.N.' 26 ? primary 'Lunec, J.' 27 ? primary 'Miller, D.C.' 28 ? primary 'Newell, D.R.' 29 ? primary 'Noble, M.E.M.' 30 ? primary 'Reeks, J.' 31 ? primary 'Revill, C.H.' 32 ? primary 'Riedinger, C.' 33 ? primary 'St Denis, J.D.' 34 ? primary 'Tamanini, E.' 35 ? primary 'Thomas, H.' 36 ? primary 'Thompson, N.T.' 37 ? primary 'Vinkovic, M.' 38 ? primary 'Wedge, S.R.' 39 ? primary 'Williams, P.A.' 40 ? primary 'Wilsher, N.E.' 41 ? primary 'Zhang, B.' 42 ? primary 'Zhao, Y.' 43 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase Mdm2' 11181.083 1 2.3.2.27 E69A,K70A ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 3 ? ? ? ? 3 non-polymer syn ;(3~{R})-3-(4-chlorophenyl)-2-[(4-ethynylphenyl)methyl]-3-[[1-(hydroxymethyl)cyclopropyl]methoxy]-6-(2-oxidanylpropan-2-yl)isoindol-1-one ; 516.027 1 ? ? ? ? 4 water nat water 18.015 105 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Double minute 2 protein,Hdm2,Oncoprotein Mdm2,RING-type E3 ubiquitin transferase Mdm2,p53-binding protein Mdm2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDAAQQHIVYCSNDLLGDLFGVPSF SVKEHRKIYTMIYRNLVV ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDAAQQHIVYCSNDLLGDLFGVPSF SVKEHRKIYTMIYRNLVV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 ;(3~{R})-3-(4-chlorophenyl)-2-[(4-ethynylphenyl)methyl]-3-[[1-(hydroxymethyl)cyclopropyl]methoxy]-6-(2-oxidanylpropan-2-yl)isoindol-1-one ; U3Z 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLN n 1 8 ILE n 1 9 PRO n 1 10 ALA n 1 11 SER n 1 12 GLU n 1 13 GLN n 1 14 GLU n 1 15 THR n 1 16 LEU n 1 17 VAL n 1 18 ARG n 1 19 PRO n 1 20 LYS n 1 21 PRO n 1 22 LEU n 1 23 LEU n 1 24 LEU n 1 25 LYS n 1 26 LEU n 1 27 LEU n 1 28 LYS n 1 29 SER n 1 30 VAL n 1 31 GLY n 1 32 ALA n 1 33 GLN n 1 34 LYS n 1 35 ASP n 1 36 THR n 1 37 TYR n 1 38 THR n 1 39 MET n 1 40 LYS n 1 41 GLU n 1 42 VAL n 1 43 LEU n 1 44 PHE n 1 45 TYR n 1 46 LEU n 1 47 GLY n 1 48 GLN n 1 49 TYR n 1 50 ILE n 1 51 MET n 1 52 THR n 1 53 LYS n 1 54 ARG n 1 55 LEU n 1 56 TYR n 1 57 ASP n 1 58 ALA n 1 59 ALA n 1 60 GLN n 1 61 GLN n 1 62 HIS n 1 63 ILE n 1 64 VAL n 1 65 TYR n 1 66 CYS n 1 67 SER n 1 68 ASN n 1 69 ASP n 1 70 LEU n 1 71 LEU n 1 72 GLY n 1 73 ASP n 1 74 LEU n 1 75 PHE n 1 76 GLY n 1 77 VAL n 1 78 PRO n 1 79 SER n 1 80 PHE n 1 81 SER n 1 82 VAL n 1 83 LYS n 1 84 GLU n 1 85 HIS n 1 86 ARG n 1 87 LYS n 1 88 ILE n 1 89 TYR n 1 90 THR n 1 91 MET n 1 92 ILE n 1 93 TYR n 1 94 ARG n 1 95 ASN n 1 96 LEU n 1 97 VAL n 1 98 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 98 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MDM2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant pLysS _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U3Z non-polymer . ;(3~{R})-3-(4-chlorophenyl)-2-[(4-ethynylphenyl)methyl]-3-[[1-(hydroxymethyl)cyclopropyl]methoxy]-6-(2-oxidanylpropan-2-yl)isoindol-1-one ; ? 'C31 H30 Cl N O4' 516.027 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 12 ? ? ? A . n A 1 2 PRO 2 13 ? ? ? A . n A 1 3 LEU 3 14 ? ? ? A . n A 1 4 GLY 4 15 ? ? ? A . n A 1 5 SER 5 16 ? ? ? A . n A 1 6 SER 6 17 17 SER SER A . n A 1 7 GLN 7 18 18 GLN GLN A . n A 1 8 ILE 8 19 19 ILE ILE A . n A 1 9 PRO 9 20 20 PRO PRO A . n A 1 10 ALA 10 21 21 ALA ALA A . n A 1 11 SER 11 22 22 SER SER A . n A 1 12 GLU 12 23 23 GLU GLU A . n A 1 13 GLN 13 24 24 GLN GLN A . n A 1 14 GLU 14 25 25 GLU GLU A . n A 1 15 THR 15 26 26 THR THR A . n A 1 16 LEU 16 27 27 LEU LEU A . n A 1 17 VAL 17 28 28 VAL VAL A . n A 1 18 ARG 18 29 29 ARG ARG A . n A 1 19 PRO 19 30 30 PRO PRO A . n A 1 20 LYS 20 31 31 LYS LYS A . n A 1 21 PRO 21 32 32 PRO PRO A . n A 1 22 LEU 22 33 33 LEU LEU A . n A 1 23 LEU 23 34 34 LEU LEU A . n A 1 24 LEU 24 35 35 LEU LEU A . n A 1 25 LYS 25 36 36 LYS LYS A . n A 1 26 LEU 26 37 37 LEU LEU A . n A 1 27 LEU 27 38 38 LEU LEU A . n A 1 28 LYS 28 39 39 LYS LYS A . n A 1 29 SER 29 40 40 SER SER A . n A 1 30 VAL 30 41 41 VAL VAL A . n A 1 31 GLY 31 42 42 GLY GLY A . n A 1 32 ALA 32 43 43 ALA ALA A . n A 1 33 GLN 33 44 44 GLN GLN A . n A 1 34 LYS 34 45 45 LYS LYS A . n A 1 35 ASP 35 46 46 ASP ASP A . n A 1 36 THR 36 47 47 THR THR A . n A 1 37 TYR 37 48 48 TYR TYR A . n A 1 38 THR 38 49 49 THR THR A . n A 1 39 MET 39 50 50 MET MET A . n A 1 40 LYS 40 51 51 LYS LYS A . n A 1 41 GLU 41 52 52 GLU GLU A . n A 1 42 VAL 42 53 53 VAL VAL A . n A 1 43 LEU 43 54 54 LEU LEU A . n A 1 44 PHE 44 55 55 PHE PHE A . n A 1 45 TYR 45 56 56 TYR TYR A . n A 1 46 LEU 46 57 57 LEU LEU A . n A 1 47 GLY 47 58 58 GLY GLY A . n A 1 48 GLN 48 59 59 GLN GLN A . n A 1 49 TYR 49 60 60 TYR TYR A . n A 1 50 ILE 50 61 61 ILE ILE A . n A 1 51 MET 51 62 62 MET MET A . n A 1 52 THR 52 63 63 THR THR A . n A 1 53 LYS 53 64 64 LYS LYS A . n A 1 54 ARG 54 65 65 ARG ARG A . n A 1 55 LEU 55 66 66 LEU LEU A . n A 1 56 TYR 56 67 67 TYR TYR A . n A 1 57 ASP 57 68 68 ASP ASP A . n A 1 58 ALA 58 69 69 ALA ALA A . n A 1 59 ALA 59 70 70 ALA ALA A . n A 1 60 GLN 60 71 71 GLN GLN A . n A 1 61 GLN 61 72 72 GLN GLN A . n A 1 62 HIS 62 73 73 HIS HIS A . n A 1 63 ILE 63 74 74 ILE ILE A . n A 1 64 VAL 64 75 75 VAL VAL A . n A 1 65 TYR 65 76 76 TYR TYR A . n A 1 66 CYS 66 77 77 CYS CYS A . n A 1 67 SER 67 78 78 SER SER A . n A 1 68 ASN 68 79 79 ASN ASN A . n A 1 69 ASP 69 80 80 ASP ASP A . n A 1 70 LEU 70 81 81 LEU LEU A . n A 1 71 LEU 71 82 82 LEU LEU A . n A 1 72 GLY 72 83 83 GLY GLY A . n A 1 73 ASP 73 84 84 ASP ASP A . n A 1 74 LEU 74 85 85 LEU LEU A . n A 1 75 PHE 75 86 86 PHE PHE A . n A 1 76 GLY 76 87 87 GLY GLY A . n A 1 77 VAL 77 88 88 VAL VAL A . n A 1 78 PRO 78 89 89 PRO PRO A . n A 1 79 SER 79 90 90 SER SER A . n A 1 80 PHE 80 91 91 PHE PHE A . n A 1 81 SER 81 92 92 SER SER A . n A 1 82 VAL 82 93 93 VAL VAL A . n A 1 83 LYS 83 94 94 LYS LYS A . n A 1 84 GLU 84 95 95 GLU GLU A . n A 1 85 HIS 85 96 96 HIS HIS A . n A 1 86 ARG 86 97 97 ARG ARG A . n A 1 87 LYS 87 98 98 LYS LYS A . n A 1 88 ILE 88 99 99 ILE ILE A . n A 1 89 TYR 89 100 100 TYR TYR A . n A 1 90 THR 90 101 101 THR THR A . n A 1 91 MET 91 102 102 MET MET A . n A 1 92 ILE 92 103 103 ILE ILE A . n A 1 93 TYR 93 104 104 TYR TYR A . n A 1 94 ARG 94 105 105 ARG ARG A . n A 1 95 ASN 95 106 106 ASN ASN A . n A 1 96 LEU 96 107 107 LEU LEU A . n A 1 97 VAL 97 108 108 VAL VAL A . n A 1 98 VAL 98 109 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 201 1 EDO EDO A . C 2 EDO 1 202 2 EDO EDO A . D 2 EDO 1 203 3 EDO EDO A . E 3 U3Z 1 204 1 U3Z L01 A . F 4 HOH 1 301 3 HOH HOH A . F 4 HOH 2 302 13 HOH HOH A . F 4 HOH 3 303 13 HOH HOH A . F 4 HOH 4 304 1 HOH HOH A . F 4 HOH 5 305 19 HOH HOH A . F 4 HOH 6 306 62 HOH HOH A . F 4 HOH 7 307 6 HOH HOH A . F 4 HOH 8 308 1 HOH HOH A . F 4 HOH 9 309 5 HOH HOH A . F 4 HOH 10 310 20 HOH HOH A . F 4 HOH 11 311 41 HOH HOH A . F 4 HOH 12 312 28 HOH HOH A . F 4 HOH 13 313 48 HOH HOH A . F 4 HOH 14 314 69 HOH HOH A . F 4 HOH 15 315 78 HOH HOH A . F 4 HOH 16 316 7 HOH HOH A . F 4 HOH 17 317 40 HOH HOH A . F 4 HOH 18 318 34 HOH HOH A . F 4 HOH 19 319 82 HOH HOH A . F 4 HOH 20 320 12 HOH HOH A . F 4 HOH 21 321 14 HOH HOH A . F 4 HOH 22 322 37 HOH HOH A . F 4 HOH 23 323 79 HOH HOH A . F 4 HOH 24 324 81 HOH HOH A . F 4 HOH 25 325 21 HOH HOH A . F 4 HOH 26 326 83 HOH HOH A . F 4 HOH 27 327 31 HOH HOH A . F 4 HOH 28 328 61 HOH HOH A . F 4 HOH 29 329 10 HOH HOH A . F 4 HOH 30 330 22 HOH HOH A . F 4 HOH 31 331 2 HOH HOH A . F 4 HOH 32 332 8 HOH HOH A . F 4 HOH 33 333 80 HOH HOH A . F 4 HOH 34 334 17 HOH HOH A . F 4 HOH 35 335 4 HOH HOH A . F 4 HOH 36 336 23 HOH HOH A . F 4 HOH 37 337 9 HOH HOH A . F 4 HOH 38 338 22 HOH HOH A . F 4 HOH 39 339 36 HOH HOH A . F 4 HOH 40 340 18 HOH HOH A . F 4 HOH 41 341 70 HOH HOH A . F 4 HOH 42 342 33 HOH HOH A . F 4 HOH 43 343 35 HOH HOH A . F 4 HOH 44 344 24 HOH HOH A . F 4 HOH 45 345 15 HOH HOH A . F 4 HOH 46 346 7 HOH HOH A . F 4 HOH 47 347 3 HOH HOH A . F 4 HOH 48 348 63 HOH HOH A . F 4 HOH 49 349 25 HOH HOH A . F 4 HOH 50 350 49 HOH HOH A . F 4 HOH 51 351 2 HOH HOH A . F 4 HOH 52 352 64 HOH HOH A . F 4 HOH 53 353 26 HOH HOH A . F 4 HOH 54 354 4 HOH HOH A . F 4 HOH 55 355 26 HOH HOH A . F 4 HOH 56 356 50 HOH HOH A . F 4 HOH 57 357 16 HOH HOH A . F 4 HOH 58 358 27 HOH HOH A . F 4 HOH 59 359 11 HOH HOH A . F 4 HOH 60 360 16 HOH HOH A . F 4 HOH 61 361 68 HOH HOH A . F 4 HOH 62 362 43 HOH HOH A . F 4 HOH 63 363 19 HOH HOH A . F 4 HOH 64 364 28 HOH HOH A . F 4 HOH 65 365 29 HOH HOH A . F 4 HOH 66 366 46 HOH HOH A . F 4 HOH 67 367 75 HOH HOH A . F 4 HOH 68 368 27 HOH HOH A . F 4 HOH 69 369 84 HOH HOH A . F 4 HOH 70 370 67 HOH HOH A . F 4 HOH 71 371 39 HOH HOH A . F 4 HOH 72 372 44 HOH HOH A . F 4 HOH 73 373 11 HOH HOH A . F 4 HOH 74 374 56 HOH HOH A . F 4 HOH 75 375 76 HOH HOH A . F 4 HOH 76 376 71 HOH HOH A . F 4 HOH 77 377 10 HOH HOH A . F 4 HOH 78 378 6 HOH HOH A . F 4 HOH 79 379 53 HOH HOH A . F 4 HOH 80 380 51 HOH HOH A . F 4 HOH 81 381 52 HOH HOH A . F 4 HOH 82 382 85 HOH HOH A . F 4 HOH 83 383 24 HOH HOH A . F 4 HOH 84 384 20 HOH HOH A . F 4 HOH 85 385 55 HOH HOH A . F 4 HOH 86 386 86 HOH HOH A . F 4 HOH 87 387 59 HOH HOH A . F 4 HOH 88 388 58 HOH HOH A . F 4 HOH 89 389 73 HOH HOH A . F 4 HOH 90 390 65 HOH HOH A . F 4 HOH 91 391 45 HOH HOH A . F 4 HOH 92 392 21 HOH HOH A . F 4 HOH 93 393 77 HOH HOH A . F 4 HOH 94 394 5 HOH HOH A . F 4 HOH 95 395 38 HOH HOH A . F 4 HOH 96 396 18 HOH HOH A . F 4 HOH 97 397 72 HOH HOH A . F 4 HOH 98 398 9 HOH HOH A . F 4 HOH 99 399 42 HOH HOH A . F 4 HOH 100 400 54 HOH HOH A . F 4 HOH 101 401 15 HOH HOH A . F 4 HOH 102 402 29 HOH HOH A . F 4 HOH 103 403 25 HOH HOH A . F 4 HOH 104 404 60 HOH HOH A . F 4 HOH 105 405 47 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.7 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7BMG _cell.details ? _cell.formula_units_Z ? _cell.length_a 71.530 _cell.length_a_esd ? _cell.length_b 71.530 _cell.length_b_esd ? _cell.length_c 100.430 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7BMG _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7BMG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 62.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.2M (NH4)2SO4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-12-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97957 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I02' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97957 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I02 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7BMG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.83 _reflns.d_resolution_low 61.95 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14020 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.1 _reflns.pdbx_Rmerge_I_obs 0.044 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 29.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.83 _reflns_shell.d_res_low 1.88 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1007 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.592 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 1.3104 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 1.3104 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -2.6209 _refine.B_iso_max 96.570 _refine.B_iso_mean 35.8550 _refine.B_iso_min 21.280 _refine.correlation_coeff_Fo_to_Fc 0.9110 _refine.correlation_coeff_Fo_to_Fc_free 0.9070 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7BMG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8300 _refine.ls_d_res_low 61.9500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13977 _refine.ls_number_reflns_R_free 696 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 100.0000 _refine.ls_percent_reflns_R_free 4.9800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2300 _refine.ls_R_factor_R_free 0.2510 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2290 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.1170 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.1250 _refine.pdbx_overall_SU_R_Blow_DPI 0.1370 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.1490 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 7BMG _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.300 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.8300 _refine_hist.d_res_low 61.9500 _refine_hist.number_atoms_solvent 105 _refine_hist.number_atoms_total 904 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 92 _refine_hist.pdbx_B_iso_mean_ligand 35.12 _refine_hist.pdbx_B_iso_mean_solvent 49.52 _refine_hist.pdbx_number_atoms_protein 750 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 49 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 373 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_trig_c_planes ? ? 'X-RAY DIFFRACTION' ? ? ? 242 ? t_gen_planes 16.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1618 ? t_it 20.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 102 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1756 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.013 ? 1618 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 1.040 ? 2921 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 5.890 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 15.760 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.8300 _refine_ls_shell.d_res_low 1.8500 _refine_ls_shell.number_reflns_all 412 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 17 _refine_ls_shell.number_reflns_R_work 395 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free 4.1300 _refine_ls_shell.R_factor_all 0.2046 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.1975 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2049 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 34 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7BMG _struct.title 'Inhibitor of MDM2-p53 Interaction' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7BMG _struct_keywords.text 'ligase, cell cycle, apoptosis, protein binding' _struct_keywords.pdbx_keywords APOPTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MDM2_HUMAN _struct_ref.pdbx_db_accession Q00987 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEH RKIYTMIYRNLVV ; _struct_ref.pdbx_align_begin 17 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7BMG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 98 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q00987 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 109 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 17 _struct_ref_seq.pdbx_auth_seq_align_end 109 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7BMG GLY A 1 ? UNP Q00987 ? ? 'expression tag' 12 1 1 7BMG PRO A 2 ? UNP Q00987 ? ? 'expression tag' 13 2 1 7BMG LEU A 3 ? UNP Q00987 ? ? 'expression tag' 14 3 1 7BMG GLY A 4 ? UNP Q00987 ? ? 'expression tag' 15 4 1 7BMG SER A 5 ? UNP Q00987 ? ? 'expression tag' 16 5 1 7BMG ALA A 58 ? UNP Q00987 GLU 69 'engineered mutation' 69 6 1 7BMG ALA A 59 ? UNP Q00987 LYS 70 'engineered mutation' 70 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 500 ? 1 MORE 5 ? 1 'SSA (A^2)' 5640 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 9 ? GLU A 14 ? PRO A 20 GLU A 25 1 ? 6 HELX_P HELX_P2 AA2 LYS A 20 ? VAL A 30 ? LYS A 31 VAL A 41 1 ? 11 HELX_P HELX_P3 AA3 MET A 39 ? LYS A 53 ? MET A 50 LYS A 64 1 ? 15 HELX_P HELX_P4 AA4 ASP A 69 ? GLY A 76 ? ASP A 80 GLY A 87 1 ? 8 HELX_P HELX_P5 AA5 GLU A 84 ? ARG A 94 ? GLU A 95 ARG A 105 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 16 ? VAL A 17 ? LEU A 27 VAL A 28 AA1 2 TYR A 37 ? THR A 38 ? TYR A 48 THR A 49 AA2 1 ILE A 63 ? TYR A 65 ? ILE A 74 TYR A 76 AA2 2 SER A 79 ? SER A 81 ? SER A 90 SER A 92 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 17 ? N VAL A 28 O TYR A 37 ? O TYR A 48 AA2 1 2 N VAL A 64 ? N VAL A 75 O PHE A 80 ? O PHE A 91 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EDO 201 ? 3 'binding site for residue EDO A 201' AC2 Software A EDO 202 ? 5 'binding site for residue EDO A 202' AC3 Software A EDO 203 ? 3 'binding site for residue EDO A 203' AC4 Software A U3Z 204 ? 15 'binding site for residue U3Z A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 LYS A 40 ? LYS A 51 . ? 1_555 ? 2 AC1 3 PHE A 44 ? PHE A 55 . ? 1_555 ? 3 AC1 3 HOH F . ? HOH A 318 . ? 1_555 ? 4 AC2 5 LYS A 20 ? LYS A 31 . ? 5_555 ? 5 AC2 5 ALA A 59 ? ALA A 70 . ? 1_555 ? 6 AC2 5 GLN A 60 ? GLN A 71 . ? 1_555 ? 7 AC2 5 GLN A 61 ? GLN A 72 . ? 1_555 ? 8 AC2 5 HIS A 62 ? HIS A 73 . ? 1_555 ? 9 AC3 3 LYS A 34 ? LYS A 45 . ? 1_555 ? 10 AC3 3 ASP A 35 ? ASP A 46 . ? 1_555 ? 11 AC3 3 THR A 36 ? THR A 47 . ? 1_555 ? 12 AC4 15 PRO A 21 ? PRO A 32 . ? 5_555 ? 13 AC4 15 LEU A 22 ? LEU A 33 . ? 5_555 ? 14 AC4 15 LEU A 43 ? LEU A 54 . ? 1_555 ? 15 AC4 15 PHE A 44 ? PHE A 55 . ? 1_555 ? 16 AC4 15 GLY A 47 ? GLY A 58 . ? 1_555 ? 17 AC4 15 GLN A 48 ? GLN A 59 . ? 1_555 ? 18 AC4 15 ILE A 50 ? ILE A 61 . ? 1_555 ? 19 AC4 15 MET A 51 ? MET A 62 . ? 1_555 ? 20 AC4 15 GLN A 61 ? GLN A 72 . ? 1_555 ? 21 AC4 15 ILE A 63 ? ILE A 74 . ? 1_555 ? 22 AC4 15 VAL A 82 ? VAL A 93 . ? 1_555 ? 23 AC4 15 HIS A 85 ? HIS A 96 . ? 1_555 ? 24 AC4 15 TYR A 89 ? TYR A 100 . ? 1_555 ? 25 AC4 15 HOH F . ? HOH A 315 . ? 1_555 ? 26 AC4 15 HOH F . ? HOH A 328 . ? 1_555 ? # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 309 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -19.6492 _pdbx_refine_tls.origin_y -14.1485 _pdbx_refine_tls.origin_z 7.4719 _pdbx_refine_tls.T[1][1] 0.0408 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0496 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0491 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] -0.0156 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0234 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] -0.0800 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.7155 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.1160 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.0735 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 2.7680 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.3038 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.7034 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0157 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.2187 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0088 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.1656 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.1242 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.1473 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.0830 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0574 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.1399 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 17 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 108 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|17 - A|108 }' # _pdbx_entry_details.entry_id 7BMG _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 405 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.27 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 12 ? A GLY 1 2 1 Y 1 A PRO 13 ? A PRO 2 3 1 Y 1 A LEU 14 ? A LEU 3 4 1 Y 1 A GLY 15 ? A GLY 4 5 1 Y 1 A SER 16 ? A SER 5 6 1 Y 1 A VAL 109 ? A VAL 98 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 SER N N N N 300 SER CA C N S 301 SER C C N N 302 SER O O N N 303 SER CB C N N 304 SER OG O N N 305 SER OXT O N N 306 SER H H N N 307 SER H2 H N N 308 SER HA H N N 309 SER HB2 H N N 310 SER HB3 H N N 311 SER HG H N N 312 SER HXT H N N 313 THR N N N N 314 THR CA C N S 315 THR C C N N 316 THR O O N N 317 THR CB C N R 318 THR OG1 O N N 319 THR CG2 C N N 320 THR OXT O N N 321 THR H H N N 322 THR H2 H N N 323 THR HA H N N 324 THR HB H N N 325 THR HG1 H N N 326 THR HG21 H N N 327 THR HG22 H N N 328 THR HG23 H N N 329 THR HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 U3Z C11 C N N 355 U3Z C13 C Y N 356 U3Z C14 C Y N 357 U3Z C15 C Y N 358 U3Z C16 C N N 359 U3Z C21 C Y N 360 U3Z C22 C Y N 361 U3Z C23 C N R 362 U3Z C25 C N N 363 U3Z C26 C N N 364 U3Z C27 C N N 365 U3Z C28 C N N 366 U3Z O30 O N N 367 U3Z C31 C Y N 368 U3Z C36 C Y N 369 U3Z C37 C Y N 370 U3Z C01 C Y N 371 U3Z C02 C Y N 372 U3Z C03 C Y N 373 U3Z C04 C N N 374 U3Z C05 C N N 375 U3Z C06 C Y N 376 U3Z C07 C Y N 377 U3Z C08 C Y N 378 U3Z C09 C N N 379 U3Z N10 N N N 380 U3Z O12 O N N 381 U3Z C17 C N N 382 U3Z C18 C N N 383 U3Z O19 O N N 384 U3Z C20 C Y N 385 U3Z O24 O N N 386 U3Z C29 C N N 387 U3Z C32 C Y N 388 U3Z C33 C Y N 389 U3Z C34 C Y N 390 U3Z CL1 CL N N 391 U3Z H1 H N N 392 U3Z H2 H N N 393 U3Z H3 H N N 394 U3Z H4 H N N 395 U3Z H5 H N N 396 U3Z H6 H N N 397 U3Z H7 H N N 398 U3Z H8 H N N 399 U3Z H9 H N N 400 U3Z H10 H N N 401 U3Z H11 H N N 402 U3Z H12 H N N 403 U3Z H13 H N N 404 U3Z H14 H N N 405 U3Z H15 H N N 406 U3Z H16 H N N 407 U3Z H17 H N N 408 U3Z H18 H N N 409 U3Z H19 H N N 410 U3Z H20 H N N 411 U3Z H21 H N N 412 U3Z H22 H N N 413 U3Z H23 H N N 414 U3Z H24 H N N 415 U3Z H25 H N N 416 U3Z H26 H N N 417 U3Z H27 H N N 418 U3Z H28 H N N 419 U3Z H29 H N N 420 U3Z H30 H N N 421 VAL N N N N 422 VAL CA C N S 423 VAL C C N N 424 VAL O O N N 425 VAL CB C N N 426 VAL CG1 C N N 427 VAL CG2 C N N 428 VAL OXT O N N 429 VAL H H N N 430 VAL H2 H N N 431 VAL HA H N N 432 VAL HB H N N 433 VAL HG11 H N N 434 VAL HG12 H N N 435 VAL HG13 H N N 436 VAL HG21 H N N 437 VAL HG22 H N N 438 VAL HG23 H N N 439 VAL HXT H N N 440 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 THR N CA sing N N 299 THR N H sing N N 300 THR N H2 sing N N 301 THR CA C sing N N 302 THR CA CB sing N N 303 THR CA HA sing N N 304 THR C O doub N N 305 THR C OXT sing N N 306 THR CB OG1 sing N N 307 THR CB CG2 sing N N 308 THR CB HB sing N N 309 THR OG1 HG1 sing N N 310 THR CG2 HG21 sing N N 311 THR CG2 HG22 sing N N 312 THR CG2 HG23 sing N N 313 THR OXT HXT sing N N 314 TYR N CA sing N N 315 TYR N H sing N N 316 TYR N H2 sing N N 317 TYR CA C sing N N 318 TYR CA CB sing N N 319 TYR CA HA sing N N 320 TYR C O doub N N 321 TYR C OXT sing N N 322 TYR CB CG sing N N 323 TYR CB HB2 sing N N 324 TYR CB HB3 sing N N 325 TYR CG CD1 doub Y N 326 TYR CG CD2 sing Y N 327 TYR CD1 CE1 sing Y N 328 TYR CD1 HD1 sing N N 329 TYR CD2 CE2 doub Y N 330 TYR CD2 HD2 sing N N 331 TYR CE1 CZ doub Y N 332 TYR CE1 HE1 sing N N 333 TYR CE2 CZ sing Y N 334 TYR CE2 HE2 sing N N 335 TYR CZ OH sing N N 336 TYR OH HH sing N N 337 TYR OXT HXT sing N N 338 U3Z CL1 C34 sing N N 339 U3Z C34 C36 doub Y N 340 U3Z C34 C33 sing Y N 341 U3Z C36 C37 sing Y N 342 U3Z C18 C16 sing N N 343 U3Z C33 C32 doub Y N 344 U3Z C37 C31 doub Y N 345 U3Z C05 C04 trip N N 346 U3Z C04 C03 sing N N 347 U3Z C20 C21 doub Y N 348 U3Z C20 C15 sing Y N 349 U3Z C32 C31 sing Y N 350 U3Z C16 C15 sing N N 351 U3Z C16 O19 sing N N 352 U3Z C16 C17 sing N N 353 U3Z C31 C23 sing N N 354 U3Z C21 C22 sing Y N 355 U3Z C06 C03 doub Y N 356 U3Z C06 C07 sing Y N 357 U3Z C15 C14 doub Y N 358 U3Z C03 C02 sing Y N 359 U3Z C22 C23 sing N N 360 U3Z C22 C13 doub Y N 361 U3Z C07 C08 doub Y N 362 U3Z C14 C13 sing Y N 363 U3Z C02 C01 doub Y N 364 U3Z C23 O24 sing N N 365 U3Z C23 N10 sing N N 366 U3Z C13 C11 sing N N 367 U3Z C08 C01 sing Y N 368 U3Z C08 C09 sing N N 369 U3Z O24 C25 sing N N 370 U3Z N10 C11 sing N N 371 U3Z N10 C09 sing N N 372 U3Z C11 O12 doub N N 373 U3Z C27 C26 sing N N 374 U3Z C27 C28 sing N N 375 U3Z C25 C26 sing N N 376 U3Z C26 C29 sing N N 377 U3Z C26 C28 sing N N 378 U3Z C29 O30 sing N N 379 U3Z C14 H1 sing N N 380 U3Z C21 H2 sing N N 381 U3Z C25 H3 sing N N 382 U3Z C25 H4 sing N N 383 U3Z C27 H5 sing N N 384 U3Z C27 H6 sing N N 385 U3Z C28 H7 sing N N 386 U3Z C28 H8 sing N N 387 U3Z O30 H9 sing N N 388 U3Z C36 H10 sing N N 389 U3Z C37 H11 sing N N 390 U3Z C01 H12 sing N N 391 U3Z C02 H13 sing N N 392 U3Z C05 H14 sing N N 393 U3Z C06 H15 sing N N 394 U3Z C07 H16 sing N N 395 U3Z C09 H17 sing N N 396 U3Z C09 H18 sing N N 397 U3Z C17 H19 sing N N 398 U3Z C17 H20 sing N N 399 U3Z C17 H21 sing N N 400 U3Z C18 H22 sing N N 401 U3Z C18 H23 sing N N 402 U3Z C18 H24 sing N N 403 U3Z O19 H25 sing N N 404 U3Z C20 H26 sing N N 405 U3Z C29 H27 sing N N 406 U3Z C29 H28 sing N N 407 U3Z C32 H29 sing N N 408 U3Z C33 H30 sing N N 409 VAL N CA sing N N 410 VAL N H sing N N 411 VAL N H2 sing N N 412 VAL CA C sing N N 413 VAL CA CB sing N N 414 VAL CA HA sing N N 415 VAL C O doub N N 416 VAL C OXT sing N N 417 VAL CB CG1 sing N N 418 VAL CB CG2 sing N N 419 VAL CB HB sing N N 420 VAL CG1 HG11 sing N N 421 VAL CG1 HG12 sing N N 422 VAL CG1 HG13 sing N N 423 VAL CG2 HG21 sing N N 424 VAL CG2 HG22 sing N N 425 VAL CG2 HG23 sing N N 426 VAL OXT HXT sing N N 427 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id U3Z _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id U3Z _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _atom_sites.entry_id 7BMG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013980 _atom_sites.fract_transf_matrix[1][2] 0.008071 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016143 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009957 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O S # loop_