data_7DCM # _entry.id 7DCM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.368 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7DCM pdb_00007dcm 10.2210/pdb7dcm/pdb WWPDB D_1300019156 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7DCM _pdbx_database_status.recvd_initial_deposition_date 2020-10-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Xu, H.' 1 ? 'Wang, B.' 2 ? 'Su, X.D.' 3 0000-0001-6948-2317 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Chem.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1552-4469 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 19 _citation.language ? _citation.page_first 548 _citation.page_last 555 _citation.title 'Co-evolution-based prediction of metal-binding sites in proteomes by machine learning.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41589-022-01223-z _citation.pdbx_database_id_PubMed 36593274 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cheng, Y.' 1 ? primary 'Wang, H.' 2 ? primary 'Xu, H.' 3 0000-0001-9283-080X primary 'Liu, Y.' 4 0000-0002-1156-7673 primary 'Ma, B.' 5 ? primary 'Chen, X.' 6 ? primary 'Zeng, X.' 7 ? primary 'Wang, X.' 8 ? primary 'Wang, B.' 9 ? primary 'Shiau, C.' 10 ? primary 'Ovchinnikov, S.' 11 0000-0003-2774-2744 primary 'Su, X.D.' 12 0000-0001-6948-2317 primary 'Wang, C.' 13 0000-0002-6925-1268 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 92.130 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7DCM _cell.details ? _cell.formula_units_Z ? _cell.length_a 43.017 _cell.length_a_esd ? _cell.length_b 36.784 _cell.length_b_esd ? _cell.length_c 48.265 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7DCM _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Probable apo-citrate lyase phosphoribosyl-dephospho-CoA transferase' 20722.330 1 2.7.7.61 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 35 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase,Apo-ACP nucleodityltransferase,Holo-ACP synthase,Holo-citrate lyase synthase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GSH(MSE)HLLPELASHHAVSIPELLVSRDERQARQHVWLKRHPVPLVSFTVVAPGPIKDSEVTRRIFNHGVTALRALAA KQGWQIQEQAALVSASGPEG(MSE)LSIAAPARDLKLATIELEHSHPLGRLWDIDVLTPEGEILSRRDYSLPPRRCLLCE QSAAVCARGKTHQLTDLLNR(MSE)EALLNDVDACNVN ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMHLLPELASHHAVSIPELLVSRDERQARQHVWLKRHPVPLVSFTVVAPGPIKDSEVTRRIFNHGVTALRALAAKQGW QIQEQAALVSASGPEGMLSIAAPARDLKLATIELEHSHPLGRLWDIDVLTPEGEILSRRDYSLPPRRCLLCEQSAAVCAR GKTHQLTDLLNRMEALLNDVDACNVN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MSE n 1 5 HIS n 1 6 LEU n 1 7 LEU n 1 8 PRO n 1 9 GLU n 1 10 LEU n 1 11 ALA n 1 12 SER n 1 13 HIS n 1 14 HIS n 1 15 ALA n 1 16 VAL n 1 17 SER n 1 18 ILE n 1 19 PRO n 1 20 GLU n 1 21 LEU n 1 22 LEU n 1 23 VAL n 1 24 SER n 1 25 ARG n 1 26 ASP n 1 27 GLU n 1 28 ARG n 1 29 GLN n 1 30 ALA n 1 31 ARG n 1 32 GLN n 1 33 HIS n 1 34 VAL n 1 35 TRP n 1 36 LEU n 1 37 LYS n 1 38 ARG n 1 39 HIS n 1 40 PRO n 1 41 VAL n 1 42 PRO n 1 43 LEU n 1 44 VAL n 1 45 SER n 1 46 PHE n 1 47 THR n 1 48 VAL n 1 49 VAL n 1 50 ALA n 1 51 PRO n 1 52 GLY n 1 53 PRO n 1 54 ILE n 1 55 LYS n 1 56 ASP n 1 57 SER n 1 58 GLU n 1 59 VAL n 1 60 THR n 1 61 ARG n 1 62 ARG n 1 63 ILE n 1 64 PHE n 1 65 ASN n 1 66 HIS n 1 67 GLY n 1 68 VAL n 1 69 THR n 1 70 ALA n 1 71 LEU n 1 72 ARG n 1 73 ALA n 1 74 LEU n 1 75 ALA n 1 76 ALA n 1 77 LYS n 1 78 GLN n 1 79 GLY n 1 80 TRP n 1 81 GLN n 1 82 ILE n 1 83 GLN n 1 84 GLU n 1 85 GLN n 1 86 ALA n 1 87 ALA n 1 88 LEU n 1 89 VAL n 1 90 SER n 1 91 ALA n 1 92 SER n 1 93 GLY n 1 94 PRO n 1 95 GLU n 1 96 GLY n 1 97 MSE n 1 98 LEU n 1 99 SER n 1 100 ILE n 1 101 ALA n 1 102 ALA n 1 103 PRO n 1 104 ALA n 1 105 ARG n 1 106 ASP n 1 107 LEU n 1 108 LYS n 1 109 LEU n 1 110 ALA n 1 111 THR n 1 112 ILE n 1 113 GLU n 1 114 LEU n 1 115 GLU n 1 116 HIS n 1 117 SER n 1 118 HIS n 1 119 PRO n 1 120 LEU n 1 121 GLY n 1 122 ARG n 1 123 LEU n 1 124 TRP n 1 125 ASP n 1 126 ILE n 1 127 ASP n 1 128 VAL n 1 129 LEU n 1 130 THR n 1 131 PRO n 1 132 GLU n 1 133 GLY n 1 134 GLU n 1 135 ILE n 1 136 LEU n 1 137 SER n 1 138 ARG n 1 139 ARG n 1 140 ASP n 1 141 TYR n 1 142 SER n 1 143 LEU n 1 144 PRO n 1 145 PRO n 1 146 ARG n 1 147 ARG n 1 148 CYS n 1 149 LEU n 1 150 LEU n 1 151 CYS n 1 152 GLU n 1 153 GLN n 1 154 SER n 1 155 ALA n 1 156 ALA n 1 157 VAL n 1 158 CYS n 1 159 ALA n 1 160 ARG n 1 161 GLY n 1 162 LYS n 1 163 THR n 1 164 HIS n 1 165 GLN n 1 166 LEU n 1 167 THR n 1 168 ASP n 1 169 LEU n 1 170 LEU n 1 171 ASN n 1 172 ARG n 1 173 MSE n 1 174 GLU n 1 175 ALA n 1 176 LEU n 1 177 LEU n 1 178 ASN n 1 179 ASP n 1 180 VAL n 1 181 ASP n 1 182 ALA n 1 183 CYS n 1 184 ASN n 1 185 VAL n 1 186 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 186 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 83333 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C3TJT2_ECOLX _struct_ref.pdbx_db_accession C3TJT2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MHLLPELASHHAVSIPELLVSRDERQARQHVWLKRHPVPLVSFTVVAPGPIKDSEVTRRIFNHGVTALRALAAKQGWQIQ EQAALVSASGPEGMLSIAAPARDLKLATIELEHSHPLGRLWDIDVLTPEGEILSRRDYSLPPRRCLLCEQSAAVCARGKT HQLTDLLNRMEALLNDVDACNVN ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7DCM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 186 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C3TJT2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7DCM GLY A 1 ? UNP C3TJT2 ? ? 'expression tag' -2 1 1 7DCM SER A 2 ? UNP C3TJT2 ? ? 'expression tag' -1 2 1 7DCM HIS A 3 ? UNP C3TJT2 ? ? 'expression tag' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7DCM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.84 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-12-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 31.790 _reflns.entry_id 7DCM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.495 _reflns.d_resolution_low 24.439 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5375 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.35 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 40.60 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.496 _reflns_shell.d_res_low 2.585 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3570 _reflns_shell.percent_possible_all 98.13 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.996 _reflns_shell.pdbx_CC_star 0.999 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 85.080 _refine.B_iso_mean 31.6150 _refine.B_iso_min 13.970 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7DCM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4950 _refine.ls_d_res_low 24.4390 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5374 _refine.ls_number_reflns_R_free 540 _refine.ls_number_reflns_R_work 9205 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.1200 _refine.ls_percent_reflns_R_free 9.9400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1795 _refine.ls_R_factor_R_free 0.2569 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1707 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.500 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.4600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.4950 _refine_hist.d_res_low 24.4390 _refine_hist.number_atoms_solvent 35 _refine_hist.number_atoms_total 1450 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 182 _refine_hist.pdbx_B_iso_mean_ligand 48.68 _refine_hist.pdbx_B_iso_mean_solvent 31.83 _refine_hist.pdbx_number_atoms_protein 1414 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1444 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.074 ? 1964 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.055 ? 227 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 256 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 6.767 ? 888 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.496 2.6260 . . 146 1321 97.0000 . . . 0.3565 0.0000 0.1894 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6260 2.7903 . . 141 1297 100.0000 . . . 0.3969 0.0000 0.1955 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7903 3.0054 . . 134 1339 100.0000 . . . 0.2773 0.0000 0.1964 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0054 3.3072 . . 148 1321 100.0000 . . . 0.2715 0.0000 0.1850 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3072 3.7842 . . 149 1327 100.0000 . . . 0.2633 0.0000 0.1644 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7842 4.7619 . . 143 1314 100.0000 . . . 0.2026 0.0000 0.1429 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.7619 10 . . 155 1286 98.0000 . . . 0.2188 0.0000 0.1704 . . . . . . . . . . . # _struct.entry_id 7DCM _struct.title 'Crystal structure of CITX' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7DCM _struct_keywords.text 'zinc finger, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 7 ? ALA A 11 ? LEU A 4 ALA A 8 5 ? 5 HELX_P HELX_P2 AA2 SER A 17 ? HIS A 39 ? SER A 14 HIS A 36 1 ? 23 HELX_P HELX_P3 AA3 SER A 57 ? GLN A 78 ? SER A 54 GLN A 75 1 ? 22 HELX_P HELX_P4 AA4 PRO A 103 ? HIS A 118 ? PRO A 100 HIS A 115 1 ? 16 HELX_P HELX_P5 AA5 LEU A 120 ? ARG A 122 ? LEU A 117 ARG A 119 5 ? 3 HELX_P HELX_P6 AA6 SER A 137 ? SER A 142 ? SER A 134 SER A 139 5 ? 6 HELX_P HELX_P7 AA7 SER A 154 ? GLY A 161 ? SER A 151 GLY A 158 1 ? 8 HELX_P HELX_P8 AA8 GLN A 165 ? ASP A 181 ? GLN A 162 ASP A 178 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A HIS 3 C ? ? ? 1_555 A MSE 4 N ? ? A HIS 0 A MSE 1 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale2 covale both ? A MSE 4 C ? ? ? 1_555 A HIS 5 N ? ? A MSE 1 A HIS 2 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale3 covale both ? A GLY 96 C ? ? ? 1_555 A MSE 97 N ? ? A GLY 93 A MSE 94 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale4 covale both ? A MSE 97 C ? ? ? 1_555 A LEU 98 N ? ? A MSE 94 A LEU 95 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale5 covale both ? A ARG 172 C ? ? ? 1_555 A MSE 173 N ? ? A ARG 169 A MSE 170 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale6 covale both ? A MSE 173 C ? ? ? 1_555 A GLU 174 N ? ? A MSE 170 A GLU 171 1_555 ? ? ? ? ? ? ? 1.338 ? ? metalc1 metalc ? ? A CYS 148 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 145 A ZN 201 1_555 ? ? ? ? ? ? ? 2.408 ? ? metalc2 metalc ? ? A CYS 151 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 148 A ZN 201 1_555 ? ? ? ? ? ? ? 2.438 ? ? metalc3 metalc ? ? A CYS 158 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 155 A ZN 201 1_555 ? ? ? ? ? ? ? 2.279 ? ? metalc4 metalc ? ? A HIS 164 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 161 A ZN 201 1_555 ? ? ? ? ? ? ? 2.016 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 81 ? SER A 90 ? GLN A 78 SER A 87 AA1 2 GLY A 93 ? ALA A 101 ? GLY A 90 ALA A 98 AA1 3 LEU A 43 ? VAL A 48 ? LEU A 40 VAL A 45 AA1 4 TRP A 124 ? LEU A 129 ? TRP A 121 LEU A 126 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 84 ? N GLU A 81 O SER A 99 ? O SER A 96 AA1 2 3 O GLY A 96 ? O GLY A 93 N PHE A 46 ? N PHE A 43 AA1 3 4 N THR A 47 ? N THR A 44 O ASP A 125 ? O ASP A 122 # _atom_sites.entry_id 7DCM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.023247 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000863 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027186 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020733 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S SE ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 -2 GLY GLY A . n A 1 2 SER 2 -1 -1 SER SER A . n A 1 3 HIS 3 0 0 HIS HIS A . n A 1 4 MSE 4 1 1 MSE MSE A . n A 1 5 HIS 5 2 2 HIS HIS A . n A 1 6 LEU 6 3 3 LEU LEU A . n A 1 7 LEU 7 4 4 LEU LEU A . n A 1 8 PRO 8 5 5 PRO PRO A . n A 1 9 GLU 9 6 6 GLU GLU A . n A 1 10 LEU 10 7 7 LEU LEU A . n A 1 11 ALA 11 8 8 ALA ALA A . n A 1 12 SER 12 9 9 SER SER A . n A 1 13 HIS 13 10 10 HIS HIS A . n A 1 14 HIS 14 11 11 HIS HIS A . n A 1 15 ALA 15 12 12 ALA ALA A . n A 1 16 VAL 16 13 13 VAL VAL A . n A 1 17 SER 17 14 14 SER SER A . n A 1 18 ILE 18 15 15 ILE ILE A . n A 1 19 PRO 19 16 16 PRO PRO A . n A 1 20 GLU 20 17 17 GLU GLU A . n A 1 21 LEU 21 18 18 LEU LEU A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 VAL 23 20 20 VAL VAL A . n A 1 24 SER 24 21 21 SER SER A . n A 1 25 ARG 25 22 22 ARG ARG A . n A 1 26 ASP 26 23 23 ASP ASP A . n A 1 27 GLU 27 24 24 GLU GLU A . n A 1 28 ARG 28 25 25 ARG ARG A . n A 1 29 GLN 29 26 26 GLN GLN A . n A 1 30 ALA 30 27 27 ALA ALA A . n A 1 31 ARG 31 28 28 ARG ARG A . n A 1 32 GLN 32 29 29 GLN GLN A . n A 1 33 HIS 33 30 30 HIS HIS A . n A 1 34 VAL 34 31 31 VAL VAL A . n A 1 35 TRP 35 32 32 TRP TRP A . n A 1 36 LEU 36 33 33 LEU LEU A . n A 1 37 LYS 37 34 34 LYS LYS A . n A 1 38 ARG 38 35 35 ARG ARG A . n A 1 39 HIS 39 36 36 HIS HIS A . n A 1 40 PRO 40 37 37 PRO PRO A . n A 1 41 VAL 41 38 38 VAL VAL A . n A 1 42 PRO 42 39 39 PRO PRO A . n A 1 43 LEU 43 40 40 LEU LEU A . n A 1 44 VAL 44 41 41 VAL VAL A . n A 1 45 SER 45 42 42 SER SER A . n A 1 46 PHE 46 43 43 PHE PHE A . n A 1 47 THR 47 44 44 THR THR A . n A 1 48 VAL 48 45 45 VAL VAL A . n A 1 49 VAL 49 46 46 VAL VAL A . n A 1 50 ALA 50 47 47 ALA ALA A . n A 1 51 PRO 51 48 48 PRO PRO A . n A 1 52 GLY 52 49 49 GLY GLY A . n A 1 53 PRO 53 50 50 PRO PRO A . n A 1 54 ILE 54 51 51 ILE ILE A . n A 1 55 LYS 55 52 52 LYS LYS A . n A 1 56 ASP 56 53 53 ASP ASP A . n A 1 57 SER 57 54 54 SER SER A . n A 1 58 GLU 58 55 55 GLU GLU A . n A 1 59 VAL 59 56 56 VAL VAL A . n A 1 60 THR 60 57 57 THR THR A . n A 1 61 ARG 61 58 58 ARG ARG A . n A 1 62 ARG 62 59 59 ARG ARG A . n A 1 63 ILE 63 60 60 ILE ILE A . n A 1 64 PHE 64 61 61 PHE PHE A . n A 1 65 ASN 65 62 62 ASN ASN A . n A 1 66 HIS 66 63 63 HIS HIS A . n A 1 67 GLY 67 64 64 GLY GLY A . n A 1 68 VAL 68 65 65 VAL VAL A . n A 1 69 THR 69 66 66 THR THR A . n A 1 70 ALA 70 67 67 ALA ALA A . n A 1 71 LEU 71 68 68 LEU LEU A . n A 1 72 ARG 72 69 69 ARG ARG A . n A 1 73 ALA 73 70 70 ALA ALA A . n A 1 74 LEU 74 71 71 LEU LEU A . n A 1 75 ALA 75 72 72 ALA ALA A . n A 1 76 ALA 76 73 73 ALA ALA A . n A 1 77 LYS 77 74 74 LYS LYS A . n A 1 78 GLN 78 75 75 GLN GLN A . n A 1 79 GLY 79 76 76 GLY GLY A . n A 1 80 TRP 80 77 77 TRP TRP A . n A 1 81 GLN 81 78 78 GLN GLN A . n A 1 82 ILE 82 79 79 ILE ILE A . n A 1 83 GLN 83 80 80 GLN GLN A . n A 1 84 GLU 84 81 81 GLU GLU A . n A 1 85 GLN 85 82 82 GLN GLN A . n A 1 86 ALA 86 83 83 ALA ALA A . n A 1 87 ALA 87 84 84 ALA ALA A . n A 1 88 LEU 88 85 85 LEU LEU A . n A 1 89 VAL 89 86 86 VAL VAL A . n A 1 90 SER 90 87 87 SER SER A . n A 1 91 ALA 91 88 88 ALA ALA A . n A 1 92 SER 92 89 89 SER SER A . n A 1 93 GLY 93 90 90 GLY GLY A . n A 1 94 PRO 94 91 91 PRO PRO A . n A 1 95 GLU 95 92 92 GLU GLU A . n A 1 96 GLY 96 93 93 GLY GLY A . n A 1 97 MSE 97 94 94 MSE MSE A . n A 1 98 LEU 98 95 95 LEU LEU A . n A 1 99 SER 99 96 96 SER SER A . n A 1 100 ILE 100 97 97 ILE ILE A . n A 1 101 ALA 101 98 98 ALA ALA A . n A 1 102 ALA 102 99 99 ALA ALA A . n A 1 103 PRO 103 100 100 PRO PRO A . n A 1 104 ALA 104 101 101 ALA ALA A . n A 1 105 ARG 105 102 102 ARG ARG A . n A 1 106 ASP 106 103 103 ASP ASP A . n A 1 107 LEU 107 104 104 LEU LEU A . n A 1 108 LYS 108 105 105 LYS LYS A . n A 1 109 LEU 109 106 106 LEU LEU A . n A 1 110 ALA 110 107 107 ALA ALA A . n A 1 111 THR 111 108 108 THR THR A . n A 1 112 ILE 112 109 109 ILE ILE A . n A 1 113 GLU 113 110 110 GLU GLU A . n A 1 114 LEU 114 111 111 LEU LEU A . n A 1 115 GLU 115 112 112 GLU GLU A . n A 1 116 HIS 116 113 113 HIS HIS A . n A 1 117 SER 117 114 114 SER SER A . n A 1 118 HIS 118 115 115 HIS HIS A . n A 1 119 PRO 119 116 116 PRO PRO A . n A 1 120 LEU 120 117 117 LEU LEU A . n A 1 121 GLY 121 118 118 GLY GLY A . n A 1 122 ARG 122 119 119 ARG ARG A . n A 1 123 LEU 123 120 120 LEU LEU A . n A 1 124 TRP 124 121 121 TRP TRP A . n A 1 125 ASP 125 122 122 ASP ASP A . n A 1 126 ILE 126 123 123 ILE ILE A . n A 1 127 ASP 127 124 124 ASP ASP A . n A 1 128 VAL 128 125 125 VAL VAL A . n A 1 129 LEU 129 126 126 LEU LEU A . n A 1 130 THR 130 127 127 THR THR A . n A 1 131 PRO 131 128 128 PRO PRO A . n A 1 132 GLU 132 129 129 GLU GLU A . n A 1 133 GLY 133 130 130 GLY GLY A . n A 1 134 GLU 134 131 131 GLU GLU A . n A 1 135 ILE 135 132 132 ILE ILE A . n A 1 136 LEU 136 133 133 LEU LEU A . n A 1 137 SER 137 134 134 SER SER A . n A 1 138 ARG 138 135 135 ARG ARG A . n A 1 139 ARG 139 136 136 ARG ARG A . n A 1 140 ASP 140 137 137 ASP ASP A . n A 1 141 TYR 141 138 138 TYR TYR A . n A 1 142 SER 142 139 139 SER SER A . n A 1 143 LEU 143 140 140 LEU LEU A . n A 1 144 PRO 144 141 141 PRO PRO A . n A 1 145 PRO 145 142 142 PRO PRO A . n A 1 146 ARG 146 143 143 ARG ARG A . n A 1 147 ARG 147 144 144 ARG ARG A . n A 1 148 CYS 148 145 145 CYS CYS A . n A 1 149 LEU 149 146 146 LEU LEU A . n A 1 150 LEU 150 147 147 LEU LEU A . n A 1 151 CYS 151 148 148 CYS CYS A . n A 1 152 GLU 152 149 149 GLU GLU A . n A 1 153 GLN 153 150 150 GLN GLN A . n A 1 154 SER 154 151 151 SER SER A . n A 1 155 ALA 155 152 152 ALA ALA A . n A 1 156 ALA 156 153 153 ALA ALA A . n A 1 157 VAL 157 154 154 VAL VAL A . n A 1 158 CYS 158 155 155 CYS CYS A . n A 1 159 ALA 159 156 156 ALA ALA A . n A 1 160 ARG 160 157 157 ARG ARG A . n A 1 161 GLY 161 158 158 GLY GLY A . n A 1 162 LYS 162 159 159 LYS LYS A . n A 1 163 THR 163 160 160 THR THR A . n A 1 164 HIS 164 161 161 HIS HIS A . n A 1 165 GLN 165 162 162 GLN GLN A . n A 1 166 LEU 166 163 163 LEU LEU A . n A 1 167 THR 167 164 164 THR THR A . n A 1 168 ASP 168 165 165 ASP ASP A . n A 1 169 LEU 169 166 166 LEU LEU A . n A 1 170 LEU 170 167 167 LEU LEU A . n A 1 171 ASN 171 168 168 ASN ASN A . n A 1 172 ARG 172 169 169 ARG ARG A . n A 1 173 MSE 173 170 170 MSE MSE A . n A 1 174 GLU 174 171 171 GLU GLU A . n A 1 175 ALA 175 172 172 ALA ALA A . n A 1 176 LEU 176 173 173 LEU LEU A . n A 1 177 LEU 177 174 174 LEU LEU A . n A 1 178 ASN 178 175 175 ASN ASN A . n A 1 179 ASP 179 176 176 ASP ASP A . n A 1 180 VAL 180 177 177 VAL VAL A . n A 1 181 ASP 181 178 178 ASP ASP A . n A 1 182 ALA 182 179 179 ALA ALA A . n A 1 183 CYS 183 180 ? ? ? A . n A 1 184 ASN 184 181 ? ? ? A . n A 1 185 VAL 185 182 ? ? ? A . n A 1 186 ASN 186 183 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 3 HOH 1 301 34 HOH HOH A . C 3 HOH 2 302 39 HOH HOH A . C 3 HOH 3 303 24 HOH HOH A . C 3 HOH 4 304 27 HOH HOH A . C 3 HOH 5 305 36 HOH HOH A . C 3 HOH 6 306 15 HOH HOH A . C 3 HOH 7 307 7 HOH HOH A . C 3 HOH 8 308 2 HOH HOH A . C 3 HOH 9 309 8 HOH HOH A . C 3 HOH 10 310 4 HOH HOH A . C 3 HOH 11 311 11 HOH HOH A . C 3 HOH 12 312 30 HOH HOH A . C 3 HOH 13 313 32 HOH HOH A . C 3 HOH 14 314 18 HOH HOH A . C 3 HOH 15 315 38 HOH HOH A . C 3 HOH 16 316 3 HOH HOH A . C 3 HOH 17 317 1 HOH HOH A . C 3 HOH 18 318 25 HOH HOH A . C 3 HOH 19 319 26 HOH HOH A . C 3 HOH 20 320 12 HOH HOH A . C 3 HOH 21 321 29 HOH HOH A . C 3 HOH 22 322 23 HOH HOH A . C 3 HOH 23 323 13 HOH HOH A . C 3 HOH 24 324 14 HOH HOH A . C 3 HOH 25 325 5 HOH HOH A . C 3 HOH 26 326 6 HOH HOH A . C 3 HOH 27 327 33 HOH HOH A . C 3 HOH 28 328 28 HOH HOH A . C 3 HOH 29 329 9 HOH HOH A . C 3 HOH 30 330 21 HOH HOH A . C 3 HOH 31 331 19 HOH HOH A . C 3 HOH 32 332 22 HOH HOH A . C 3 HOH 33 333 20 HOH HOH A . C 3 HOH 34 334 37 HOH HOH A . C 3 HOH 35 335 17 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 4 A MSE 1 ? MET 'modified residue' 2 A MSE 97 A MSE 94 ? MET 'modified residue' 3 A MSE 173 A MSE 170 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 148 ? A CYS 145 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 151 ? A CYS 148 ? 1_555 132.4 ? 2 SG ? A CYS 148 ? A CYS 145 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 158 ? A CYS 155 ? 1_555 98.6 ? 3 SG ? A CYS 151 ? A CYS 148 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 158 ? A CYS 155 ? 1_555 108.0 ? 4 SG ? A CYS 148 ? A CYS 145 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 164 ? A HIS 161 ? 1_555 96.1 ? 5 SG ? A CYS 151 ? A CYS 148 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 164 ? A HIS 161 ? 1_555 111.7 ? 6 SG ? A CYS 158 ? A CYS 155 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 164 ? A HIS 161 ? 1_555 107.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-11-03 2 'Structure model' 1 1 2023-05-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . 5 # _pdbx_entry_details.entry_id 7DCM _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 53 ? ? -112.91 76.01 2 1 ARG A 157 ? ? -51.19 -78.09 3 1 LYS A 159 ? ? -62.17 74.83 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A CYS 180 ? A CYS 183 2 1 Y 1 A ASN 181 ? A ASN 184 3 1 Y 1 A VAL 182 ? A VAL 185 4 1 Y 1 A ASN 183 ? A ASN 186 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 MSE ? ? MSE ? ? 'SUBJECT OF INVESTIGATION' ? 2 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #