data_7K7A # _entry.id 7K7A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7K7A pdb_00007k7a 10.2210/pdb7k7a/pdb WWPDB D_1000251977 ? ? BMRB 30799 ? 10.13018/BMR30799 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-09-30 2 'Structure model' 1 1 2020-11-25 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.name' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' 15 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 16 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7K7A _pdbx_database_status.recvd_initial_deposition_date 2020-09-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Transmembrane structure of TNFR1' _pdbx_database_related.db_id 30799 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhao, L.' 1 0000-0003-1624-6649 'Chou, J.' 2 0000-0002-4442-0344 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Front Cell Dev Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2296-634X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first 569684 _citation.page_last 569684 _citation.title 'The Diversity and Similarity of Transmembrane Trimerization of TNF Receptors.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3389/fcell.2020.569684 _citation.pdbx_database_id_PubMed 33163490 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhao, L.' 1 ? primary 'Fu, Q.' 2 ? primary 'Pan, L.' 3 ? primary 'Piai, A.' 4 ? primary 'Chou, J.J.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Tumor necrosis factor receptor superfamily member 1A' _entity.formula_weight 3371.109 _entity.pdbx_number_of_molecules 3 _entity.pdbx_ec ? _entity.pdbx_mutation 'C223A, M233A' _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Tumor necrosis factor receptor 1,TNF-R1,Tumor necrosis factor receptor type I,TNFR-I,p55,p60' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GTTVLLPLVIFFGLALLSLLFIGLAYRYQR _entity_poly.pdbx_seq_one_letter_code_can GTTVLLPLVIFFGLALLSLLFIGLAYRYQR _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 THR n 1 3 THR n 1 4 VAL n 1 5 LEU n 1 6 LEU n 1 7 PRO n 1 8 LEU n 1 9 VAL n 1 10 ILE n 1 11 PHE n 1 12 PHE n 1 13 GLY n 1 14 LEU n 1 15 ALA n 1 16 LEU n 1 17 LEU n 1 18 SER n 1 19 LEU n 1 20 LEU n 1 21 PHE n 1 22 ILE n 1 23 GLY n 1 24 LEU n 1 25 ALA n 1 26 TYR n 1 27 ARG n 1 28 TYR n 1 29 GLN n 1 30 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 30 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TNFRSF1A, TNFAR, TNFR1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 209 209 GLY GLY A . n A 1 2 THR 2 210 210 THR THR A . n A 1 3 THR 3 211 211 THR THR A . n A 1 4 VAL 4 212 212 VAL VAL A . n A 1 5 LEU 5 213 213 LEU LEU A . n A 1 6 LEU 6 214 214 LEU LEU A . n A 1 7 PRO 7 215 215 PRO PRO A . n A 1 8 LEU 8 216 216 LEU LEU A . n A 1 9 VAL 9 217 217 VAL VAL A . n A 1 10 ILE 10 218 218 ILE ILE A . n A 1 11 PHE 11 219 219 PHE PHE A . n A 1 12 PHE 12 220 220 PHE PHE A . n A 1 13 GLY 13 221 221 GLY GLY A . n A 1 14 LEU 14 222 222 LEU LEU A . n A 1 15 ALA 15 223 223 ALA ALA A . n A 1 16 LEU 16 224 224 LEU LEU A . n A 1 17 LEU 17 225 225 LEU LEU A . n A 1 18 SER 18 226 226 SER SER A . n A 1 19 LEU 19 227 227 LEU LEU A . n A 1 20 LEU 20 228 228 LEU LEU A . n A 1 21 PHE 21 229 229 PHE PHE A . n A 1 22 ILE 22 230 230 ILE ILE A . n A 1 23 GLY 23 231 231 GLY GLY A . n A 1 24 LEU 24 232 232 LEU LEU A . n A 1 25 ALA 25 233 233 ALA ALA A . n A 1 26 TYR 26 234 234 TYR TYR A . n A 1 27 ARG 27 235 235 ARG ARG A . n A 1 28 TYR 28 236 236 TYR TYR A . n A 1 29 GLN 29 237 237 GLN GLN A . n A 1 30 ARG 30 238 238 ARG ARG A . n B 1 1 GLY 1 209 209 GLY GLY B . n B 1 2 THR 2 210 210 THR THR B . n B 1 3 THR 3 211 211 THR THR B . n B 1 4 VAL 4 212 212 VAL VAL B . n B 1 5 LEU 5 213 213 LEU LEU B . n B 1 6 LEU 6 214 214 LEU LEU B . n B 1 7 PRO 7 215 215 PRO PRO B . n B 1 8 LEU 8 216 216 LEU LEU B . n B 1 9 VAL 9 217 217 VAL VAL B . n B 1 10 ILE 10 218 218 ILE ILE B . n B 1 11 PHE 11 219 219 PHE PHE B . n B 1 12 PHE 12 220 220 PHE PHE B . n B 1 13 GLY 13 221 221 GLY GLY B . n B 1 14 LEU 14 222 222 LEU LEU B . n B 1 15 ALA 15 223 223 ALA ALA B . n B 1 16 LEU 16 224 224 LEU LEU B . n B 1 17 LEU 17 225 225 LEU LEU B . n B 1 18 SER 18 226 226 SER SER B . n B 1 19 LEU 19 227 227 LEU LEU B . n B 1 20 LEU 20 228 228 LEU LEU B . n B 1 21 PHE 21 229 229 PHE PHE B . n B 1 22 ILE 22 230 230 ILE ILE B . n B 1 23 GLY 23 231 231 GLY GLY B . n B 1 24 LEU 24 232 232 LEU LEU B . n B 1 25 ALA 25 233 233 ALA ALA B . n B 1 26 TYR 26 234 234 TYR TYR B . n B 1 27 ARG 27 235 235 ARG ARG B . n B 1 28 TYR 28 236 236 TYR TYR B . n B 1 29 GLN 29 237 237 GLN GLN B . n B 1 30 ARG 30 238 238 ARG ARG B . n C 1 1 GLY 1 209 209 GLY GLY C . n C 1 2 THR 2 210 210 THR THR C . n C 1 3 THR 3 211 211 THR THR C . n C 1 4 VAL 4 212 212 VAL VAL C . n C 1 5 LEU 5 213 213 LEU LEU C . n C 1 6 LEU 6 214 214 LEU LEU C . n C 1 7 PRO 7 215 215 PRO PRO C . n C 1 8 LEU 8 216 216 LEU LEU C . n C 1 9 VAL 9 217 217 VAL VAL C . n C 1 10 ILE 10 218 218 ILE ILE C . n C 1 11 PHE 11 219 219 PHE PHE C . n C 1 12 PHE 12 220 220 PHE PHE C . n C 1 13 GLY 13 221 221 GLY GLY C . n C 1 14 LEU 14 222 222 LEU LEU C . n C 1 15 ALA 15 223 223 ALA ALA C . n C 1 16 LEU 16 224 224 LEU LEU C . n C 1 17 LEU 17 225 225 LEU LEU C . n C 1 18 SER 18 226 226 SER SER C . n C 1 19 LEU 19 227 227 LEU LEU C . n C 1 20 LEU 20 228 228 LEU LEU C . n C 1 21 PHE 21 229 229 PHE PHE C . n C 1 22 ILE 22 230 230 ILE ILE C . n C 1 23 GLY 23 231 231 GLY GLY C . n C 1 24 LEU 24 232 232 LEU LEU C . n C 1 25 ALA 25 233 233 ALA ALA C . n C 1 26 TYR 26 234 234 TYR TYR C . n C 1 27 ARG 27 235 235 ARG ARG C . n C 1 28 TYR 28 236 236 TYR TYR C . n C 1 29 GLN 29 237 237 GLN GLN C . n C 1 30 ARG 30 238 238 ARG ARG C . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7K7A _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7K7A _struct.title 'Transmembrane structure of TNFR1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7K7A _struct_keywords.text 'TRANSMEMBRANE HELIX, APOPTOSIS' _struct_keywords.pdbx_keywords APOPTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TNR1A_HUMAN _struct_ref.pdbx_db_accession P19438 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GTTVLLPLVIFFGLCLLSLLFIGLMYRYQR _struct_ref.pdbx_align_begin 209 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7K7A A 1 ? 30 ? P19438 209 ? 238 ? 209 238 2 1 7K7A B 1 ? 30 ? P19438 209 ? 238 ? 209 238 3 1 7K7A C 1 ? 30 ? P19438 209 ? 238 ? 209 238 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7K7A ALA A 15 ? UNP P19438 CYS 223 'engineered mutation' 223 1 1 7K7A ALA A 25 ? UNP P19438 MET 233 'engineered mutation' 233 2 2 7K7A ALA B 15 ? UNP P19438 CYS 223 'engineered mutation' 223 3 2 7K7A ALA B 25 ? UNP P19438 MET 233 'engineered mutation' 233 4 3 7K7A ALA C 15 ? UNP P19438 CYS 223 'engineered mutation' 223 5 3 7K7A ALA C 25 ? UNP P19438 MET 233 'engineered mutation' 233 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1920 ? 1 MORE -26 ? 1 'SSA (A^2)' 8470 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 4 ? GLN A 29 ? VAL A 212 GLN A 237 1 ? 26 HELX_P HELX_P2 AA2 VAL B 4 ? ARG B 30 ? VAL B 212 ARG B 238 1 ? 27 HELX_P HELX_P3 AA3 VAL C 4 ? TYR C 28 ? VAL C 212 TYR C 236 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 211 ? ? -93.14 33.97 2 1 THR B 210 ? ? -152.17 -41.85 3 1 GLN C 237 ? ? -174.81 97.68 4 2 THR A 211 ? ? -115.03 50.68 5 2 THR B 211 ? ? -103.06 54.50 6 2 GLN B 237 ? ? -80.50 -91.42 7 2 THR C 211 ? ? -103.80 52.33 8 3 THR B 210 ? ? 53.47 99.49 9 3 THR C 211 ? ? -95.75 47.28 10 3 GLN C 237 ? ? 57.01 88.13 11 4 THR C 211 ? ? -152.88 33.93 12 4 GLN C 237 ? ? -172.91 93.07 13 5 GLN B 237 ? ? -163.94 87.21 14 6 THR A 211 ? ? -109.09 45.52 15 6 THR B 210 ? ? 54.57 98.63 16 6 GLN B 237 ? ? 56.55 86.55 17 6 THR C 210 ? ? -164.48 105.23 18 6 GLN C 237 ? ? -111.38 61.39 19 7 THR A 211 ? ? -114.38 57.74 20 7 GLN B 237 ? ? -107.55 58.76 21 7 GLN C 237 ? ? -165.91 88.14 22 8 GLN A 237 ? ? -151.14 81.76 23 8 GLN B 237 ? ? 55.33 87.35 24 8 GLN C 237 ? ? 58.86 88.61 25 9 THR A 210 ? ? 46.39 92.59 26 9 THR C 211 ? ? -143.96 52.13 27 9 GLN C 237 ? ? -175.68 92.20 28 10 GLN A 237 ? ? -152.19 79.28 29 10 THR B 211 ? ? -148.57 47.37 30 10 THR C 211 ? ? -150.54 48.73 31 11 THR A 211 ? ? -109.45 50.82 32 11 GLN A 237 ? ? -155.73 39.00 33 11 THR B 211 ? ? -98.88 49.26 34 11 GLN B 237 ? ? 47.80 22.09 35 12 GLN B 237 ? ? -141.55 40.41 36 12 THR C 210 ? ? 41.26 99.07 37 12 GLN C 237 ? ? -164.86 88.79 38 13 THR A 211 ? ? -97.96 59.51 39 13 GLN A 237 ? ? -156.67 82.81 40 13 GLN B 237 ? ? -102.50 55.89 41 14 GLN B 237 ? ? -90.14 44.66 42 15 THR C 210 ? ? -97.68 -67.23 # _pdbx_nmr_ensemble.entry_id 7K7A _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7K7A _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.7 mM [U-100% 13C; U-100% 15N; U-80% 2H] Protein, 20 mM sodium phosphate, 50 mM DMPC, 100 mM DHPC, 90% H2O/10% D2O' '90% H2O/10% D2O' 'triple res_sample' bicelle ? 3 ;0.4 mM [U-100% 13C] Protein A, 20 mM sodium phosphate, 50 mM DMPC, 100 mM DHPC, 0.4 mM [U-100% 2H; U-100% 15N] Protein B, 90% H2O/10% D2O ; '90% H2O/10% D2O' Inter_sample bicelle ? 2 '0.7 mM [U-100% 13C; U-100% 15N] Protein, 20 mM sodium phosphate, 50 mM DMPC, 100 mM DHPC, 90% H2O/10% D2O' '90% H2O/10% D2O' Intra_sample bicelle ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Protein 0.7 ? mM '[U-100% 13C; U-100% 15N; U-80% 2H]' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 DMPC 50 ? mM 'natural abundance' 1 DHPC 100 ? mM 'natural abundance' 3 'Protein A' 0.4 ? mM '[U-100% 13C]' 3 'sodium phosphate' 20 ? mM 'natural abundance' 3 DMPC 50 ? mM 'natural abundance' 3 DHPC 100 ? mM 'natural abundance' 3 'Protein B' 0.4 ? mM '[U-100% 2H; U-100% 15N]' 2 Protein 0.7 ? mM '[U-100% 13C; U-100% 15N]' 2 'sodium phosphate' 20 ? mM 'natural abundance' 2 DMPC 50 ? mM 'natural abundance' 2 DHPC 100 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'triple res' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCO' 1 isotropic 2 1 1 '3D HNCA' 1 isotropic 3 1 1 '3D HNCACO' 1 isotropic 4 1 2 '3D 1H-15N NOESY' 2 isotropic 5 1 3 '3D 1H-15N NOESY' 3 isotropic 6 1 3 '3D 1H-13C NOESY FOR METHYLS' 2 isotropic 7 1 2 '2D 1H-13C HSQC' 2 isotropic # _pdbx_nmr_refine.entry_id 7K7A _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' XEASY ? Bartels 5 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 3 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 CYS N N N N 41 CYS CA C N R 42 CYS C C N N 43 CYS O O N N 44 CYS CB C N N 45 CYS SG S N N 46 CYS OXT O N N 47 CYS H H N N 48 CYS H2 H N N 49 CYS HA H N N 50 CYS HB2 H N N 51 CYS HB3 H N N 52 CYS HG H N N 53 CYS HXT H N N 54 GLN N N N N 55 GLN CA C N S 56 GLN C C N N 57 GLN O O N N 58 GLN CB C N N 59 GLN CG C N N 60 GLN CD C N N 61 GLN OE1 O N N 62 GLN NE2 N N N 63 GLN OXT O N N 64 GLN H H N N 65 GLN H2 H N N 66 GLN HA H N N 67 GLN HB2 H N N 68 GLN HB3 H N N 69 GLN HG2 H N N 70 GLN HG3 H N N 71 GLN HE21 H N N 72 GLN HE22 H N N 73 GLN HXT H N N 74 GLY N N N N 75 GLY CA C N N 76 GLY C C N N 77 GLY O O N N 78 GLY OXT O N N 79 GLY H H N N 80 GLY H2 H N N 81 GLY HA2 H N N 82 GLY HA3 H N N 83 GLY HXT H N N 84 ILE N N N N 85 ILE CA C N S 86 ILE C C N N 87 ILE O O N N 88 ILE CB C N S 89 ILE CG1 C N N 90 ILE CG2 C N N 91 ILE CD1 C N N 92 ILE OXT O N N 93 ILE H H N N 94 ILE H2 H N N 95 ILE HA H N N 96 ILE HB H N N 97 ILE HG12 H N N 98 ILE HG13 H N N 99 ILE HG21 H N N 100 ILE HG22 H N N 101 ILE HG23 H N N 102 ILE HD11 H N N 103 ILE HD12 H N N 104 ILE HD13 H N N 105 ILE HXT H N N 106 LEU N N N N 107 LEU CA C N S 108 LEU C C N N 109 LEU O O N N 110 LEU CB C N N 111 LEU CG C N N 112 LEU CD1 C N N 113 LEU CD2 C N N 114 LEU OXT O N N 115 LEU H H N N 116 LEU H2 H N N 117 LEU HA H N N 118 LEU HB2 H N N 119 LEU HB3 H N N 120 LEU HG H N N 121 LEU HD11 H N N 122 LEU HD12 H N N 123 LEU HD13 H N N 124 LEU HD21 H N N 125 LEU HD22 H N N 126 LEU HD23 H N N 127 LEU HXT H N N 128 MET N N N N 129 MET CA C N S 130 MET C C N N 131 MET O O N N 132 MET CB C N N 133 MET CG C N N 134 MET SD S N N 135 MET CE C N N 136 MET OXT O N N 137 MET H H N N 138 MET H2 H N N 139 MET HA H N N 140 MET HB2 H N N 141 MET HB3 H N N 142 MET HG2 H N N 143 MET HG3 H N N 144 MET HE1 H N N 145 MET HE2 H N N 146 MET HE3 H N N 147 MET HXT H N N 148 PHE N N N N 149 PHE CA C N S 150 PHE C C N N 151 PHE O O N N 152 PHE CB C N N 153 PHE CG C Y N 154 PHE CD1 C Y N 155 PHE CD2 C Y N 156 PHE CE1 C Y N 157 PHE CE2 C Y N 158 PHE CZ C Y N 159 PHE OXT O N N 160 PHE H H N N 161 PHE H2 H N N 162 PHE HA H N N 163 PHE HB2 H N N 164 PHE HB3 H N N 165 PHE HD1 H N N 166 PHE HD2 H N N 167 PHE HE1 H N N 168 PHE HE2 H N N 169 PHE HZ H N N 170 PHE HXT H N N 171 PRO N N N N 172 PRO CA C N S 173 PRO C C N N 174 PRO O O N N 175 PRO CB C N N 176 PRO CG C N N 177 PRO CD C N N 178 PRO OXT O N N 179 PRO H H N N 180 PRO HA H N N 181 PRO HB2 H N N 182 PRO HB3 H N N 183 PRO HG2 H N N 184 PRO HG3 H N N 185 PRO HD2 H N N 186 PRO HD3 H N N 187 PRO HXT H N N 188 SER N N N N 189 SER CA C N S 190 SER C C N N 191 SER O O N N 192 SER CB C N N 193 SER OG O N N 194 SER OXT O N N 195 SER H H N N 196 SER H2 H N N 197 SER HA H N N 198 SER HB2 H N N 199 SER HB3 H N N 200 SER HG H N N 201 SER HXT H N N 202 THR N N N N 203 THR CA C N S 204 THR C C N N 205 THR O O N N 206 THR CB C N R 207 THR OG1 O N N 208 THR CG2 C N N 209 THR OXT O N N 210 THR H H N N 211 THR H2 H N N 212 THR HA H N N 213 THR HB H N N 214 THR HG1 H N N 215 THR HG21 H N N 216 THR HG22 H N N 217 THR HG23 H N N 218 THR HXT H N N 219 TYR N N N N 220 TYR CA C N S 221 TYR C C N N 222 TYR O O N N 223 TYR CB C N N 224 TYR CG C Y N 225 TYR CD1 C Y N 226 TYR CD2 C Y N 227 TYR CE1 C Y N 228 TYR CE2 C Y N 229 TYR CZ C Y N 230 TYR OH O N N 231 TYR OXT O N N 232 TYR H H N N 233 TYR H2 H N N 234 TYR HA H N N 235 TYR HB2 H N N 236 TYR HB3 H N N 237 TYR HD1 H N N 238 TYR HD2 H N N 239 TYR HE1 H N N 240 TYR HE2 H N N 241 TYR HH H N N 242 TYR HXT H N N 243 VAL N N N N 244 VAL CA C N S 245 VAL C C N N 246 VAL O O N N 247 VAL CB C N N 248 VAL CG1 C N N 249 VAL CG2 C N N 250 VAL OXT O N N 251 VAL H H N N 252 VAL H2 H N N 253 VAL HA H N N 254 VAL HB H N N 255 VAL HG11 H N N 256 VAL HG12 H N N 257 VAL HG13 H N N 258 VAL HG21 H N N 259 VAL HG22 H N N 260 VAL HG23 H N N 261 VAL HXT H N N 262 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 CYS N CA sing N N 39 CYS N H sing N N 40 CYS N H2 sing N N 41 CYS CA C sing N N 42 CYS CA CB sing N N 43 CYS CA HA sing N N 44 CYS C O doub N N 45 CYS C OXT sing N N 46 CYS CB SG sing N N 47 CYS CB HB2 sing N N 48 CYS CB HB3 sing N N 49 CYS SG HG sing N N 50 CYS OXT HXT sing N N 51 GLN N CA sing N N 52 GLN N H sing N N 53 GLN N H2 sing N N 54 GLN CA C sing N N 55 GLN CA CB sing N N 56 GLN CA HA sing N N 57 GLN C O doub N N 58 GLN C OXT sing N N 59 GLN CB CG sing N N 60 GLN CB HB2 sing N N 61 GLN CB HB3 sing N N 62 GLN CG CD sing N N 63 GLN CG HG2 sing N N 64 GLN CG HG3 sing N N 65 GLN CD OE1 doub N N 66 GLN CD NE2 sing N N 67 GLN NE2 HE21 sing N N 68 GLN NE2 HE22 sing N N 69 GLN OXT HXT sing N N 70 GLY N CA sing N N 71 GLY N H sing N N 72 GLY N H2 sing N N 73 GLY CA C sing N N 74 GLY CA HA2 sing N N 75 GLY CA HA3 sing N N 76 GLY C O doub N N 77 GLY C OXT sing N N 78 GLY OXT HXT sing N N 79 ILE N CA sing N N 80 ILE N H sing N N 81 ILE N H2 sing N N 82 ILE CA C sing N N 83 ILE CA CB sing N N 84 ILE CA HA sing N N 85 ILE C O doub N N 86 ILE C OXT sing N N 87 ILE CB CG1 sing N N 88 ILE CB CG2 sing N N 89 ILE CB HB sing N N 90 ILE CG1 CD1 sing N N 91 ILE CG1 HG12 sing N N 92 ILE CG1 HG13 sing N N 93 ILE CG2 HG21 sing N N 94 ILE CG2 HG22 sing N N 95 ILE CG2 HG23 sing N N 96 ILE CD1 HD11 sing N N 97 ILE CD1 HD12 sing N N 98 ILE CD1 HD13 sing N N 99 ILE OXT HXT sing N N 100 LEU N CA sing N N 101 LEU N H sing N N 102 LEU N H2 sing N N 103 LEU CA C sing N N 104 LEU CA CB sing N N 105 LEU CA HA sing N N 106 LEU C O doub N N 107 LEU C OXT sing N N 108 LEU CB CG sing N N 109 LEU CB HB2 sing N N 110 LEU CB HB3 sing N N 111 LEU CG CD1 sing N N 112 LEU CG CD2 sing N N 113 LEU CG HG sing N N 114 LEU CD1 HD11 sing N N 115 LEU CD1 HD12 sing N N 116 LEU CD1 HD13 sing N N 117 LEU CD2 HD21 sing N N 118 LEU CD2 HD22 sing N N 119 LEU CD2 HD23 sing N N 120 LEU OXT HXT sing N N 121 MET N CA sing N N 122 MET N H sing N N 123 MET N H2 sing N N 124 MET CA C sing N N 125 MET CA CB sing N N 126 MET CA HA sing N N 127 MET C O doub N N 128 MET C OXT sing N N 129 MET CB CG sing N N 130 MET CB HB2 sing N N 131 MET CB HB3 sing N N 132 MET CG SD sing N N 133 MET CG HG2 sing N N 134 MET CG HG3 sing N N 135 MET SD CE sing N N 136 MET CE HE1 sing N N 137 MET CE HE2 sing N N 138 MET CE HE3 sing N N 139 MET OXT HXT sing N N 140 PHE N CA sing N N 141 PHE N H sing N N 142 PHE N H2 sing N N 143 PHE CA C sing N N 144 PHE CA CB sing N N 145 PHE CA HA sing N N 146 PHE C O doub N N 147 PHE C OXT sing N N 148 PHE CB CG sing N N 149 PHE CB HB2 sing N N 150 PHE CB HB3 sing N N 151 PHE CG CD1 doub Y N 152 PHE CG CD2 sing Y N 153 PHE CD1 CE1 sing Y N 154 PHE CD1 HD1 sing N N 155 PHE CD2 CE2 doub Y N 156 PHE CD2 HD2 sing N N 157 PHE CE1 CZ doub Y N 158 PHE CE1 HE1 sing N N 159 PHE CE2 CZ sing Y N 160 PHE CE2 HE2 sing N N 161 PHE CZ HZ sing N N 162 PHE OXT HXT sing N N 163 PRO N CA sing N N 164 PRO N CD sing N N 165 PRO N H sing N N 166 PRO CA C sing N N 167 PRO CA CB sing N N 168 PRO CA HA sing N N 169 PRO C O doub N N 170 PRO C OXT sing N N 171 PRO CB CG sing N N 172 PRO CB HB2 sing N N 173 PRO CB HB3 sing N N 174 PRO CG CD sing N N 175 PRO CG HG2 sing N N 176 PRO CG HG3 sing N N 177 PRO CD HD2 sing N N 178 PRO CD HD3 sing N N 179 PRO OXT HXT sing N N 180 SER N CA sing N N 181 SER N H sing N N 182 SER N H2 sing N N 183 SER CA C sing N N 184 SER CA CB sing N N 185 SER CA HA sing N N 186 SER C O doub N N 187 SER C OXT sing N N 188 SER CB OG sing N N 189 SER CB HB2 sing N N 190 SER CB HB3 sing N N 191 SER OG HG sing N N 192 SER OXT HXT sing N N 193 THR N CA sing N N 194 THR N H sing N N 195 THR N H2 sing N N 196 THR CA C sing N N 197 THR CA CB sing N N 198 THR CA HA sing N N 199 THR C O doub N N 200 THR C OXT sing N N 201 THR CB OG1 sing N N 202 THR CB CG2 sing N N 203 THR CB HB sing N N 204 THR OG1 HG1 sing N N 205 THR CG2 HG21 sing N N 206 THR CG2 HG22 sing N N 207 THR CG2 HG23 sing N N 208 THR OXT HXT sing N N 209 TYR N CA sing N N 210 TYR N H sing N N 211 TYR N H2 sing N N 212 TYR CA C sing N N 213 TYR CA CB sing N N 214 TYR CA HA sing N N 215 TYR C O doub N N 216 TYR C OXT sing N N 217 TYR CB CG sing N N 218 TYR CB HB2 sing N N 219 TYR CB HB3 sing N N 220 TYR CG CD1 doub Y N 221 TYR CG CD2 sing Y N 222 TYR CD1 CE1 sing Y N 223 TYR CD1 HD1 sing N N 224 TYR CD2 CE2 doub Y N 225 TYR CD2 HD2 sing N N 226 TYR CE1 CZ doub Y N 227 TYR CE1 HE1 sing N N 228 TYR CE2 CZ sing Y N 229 TYR CE2 HE2 sing N N 230 TYR CZ OH sing N N 231 TYR OH HH sing N N 232 TYR OXT HXT sing N N 233 VAL N CA sing N N 234 VAL N H sing N N 235 VAL N H2 sing N N 236 VAL CA C sing N N 237 VAL CA CB sing N N 238 VAL CA HA sing N N 239 VAL C O doub N N 240 VAL C OXT sing N N 241 VAL CB CG1 sing N N 242 VAL CB CG2 sing N N 243 VAL CB HB sing N N 244 VAL CG1 HG11 sing N N 245 VAL CG1 HG12 sing N N 246 VAL CG1 HG13 sing N N 247 VAL CG2 HG21 sing N N 248 VAL CG2 HG22 sing N N 249 VAL CG2 HG23 sing N N 250 VAL OXT HXT sing N N 251 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Center for Complementary and Integrative Health (NIH/NCCIH)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 600 ? 2 AVANCE ? Bruker 750 ? 3 AVANCE ? Bruker 800 ? # _atom_sites.entry_id 7K7A _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_