data_7O6S # _entry.id 7O6S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7O6S pdb_00007o6s 10.2210/pdb7o6s/pdb WWPDB D_1292115153 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-04-20 2 'Structure model' 1 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 2 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 2 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 3 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 4 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 5 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 6 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 7 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 8 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7O6S _pdbx_database_status.recvd_initial_deposition_date 2021-04-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gardonyi, M.' 1 0000-0001-6689-0112 'Heine, A.' 2 0000-0002-5285-4089 'Klebe, G.' 3 0000-0002-4913-390X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of a shortened IpgC variant in complex with N-(2H-1,3-benzodioxol-5-ylmethyl)cyclopentanamine' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gardonyi, M.' 1 0000-0001-6689-0112 primary 'Heine, A.' 2 0000-0002-5285-4089 primary 'Klebe, G.' 3 0000-0002-4913-390X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Chaperone protein IpgC' 16310.492 2 ? 'M1_E9del, D152_E155del' ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 3 ? ? ? ? 3 non-polymer syn 'DIMETHYL SULFOXIDE' 78.133 2 ? ? ? ? 4 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 2 ? ? ? ? 5 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 6 non-polymer syn 'N-(1,3-benzodioxol-5-ylmethyl)cyclopentanamine' 219.280 1 ? ? ? ? 7 water nat water 18.015 187 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQ AADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GSISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQ AADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQ ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 'DIMETHYL SULFOXIDE' DMS 4 'DI(HYDROXYETHYL)ETHER' PEG 5 'MAGNESIUM ION' MG 6 'N-(1,3-benzodioxol-5-ylmethyl)cyclopentanamine' 45N 7 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ILE n 1 4 SER n 1 5 THR n 1 6 ALA n 1 7 VAL n 1 8 ILE n 1 9 ASP n 1 10 ALA n 1 11 ILE n 1 12 ASN n 1 13 SER n 1 14 GLY n 1 15 ALA n 1 16 THR n 1 17 LEU n 1 18 LYS n 1 19 ASP n 1 20 ILE n 1 21 ASN n 1 22 ALA n 1 23 ILE n 1 24 PRO n 1 25 ASP n 1 26 ASP n 1 27 MET n 1 28 MET n 1 29 ASP n 1 30 ASP n 1 31 ILE n 1 32 TYR n 1 33 SER n 1 34 TYR n 1 35 ALA n 1 36 TYR n 1 37 ASP n 1 38 PHE n 1 39 TYR n 1 40 ASN n 1 41 LYS n 1 42 GLY n 1 43 ARG n 1 44 ILE n 1 45 GLU n 1 46 GLU n 1 47 ALA n 1 48 GLU n 1 49 VAL n 1 50 PHE n 1 51 PHE n 1 52 ARG n 1 53 PHE n 1 54 LEU n 1 55 CYS n 1 56 ILE n 1 57 TYR n 1 58 ASP n 1 59 PHE n 1 60 TYR n 1 61 ASN n 1 62 VAL n 1 63 ASP n 1 64 TYR n 1 65 ILE n 1 66 MET n 1 67 GLY n 1 68 LEU n 1 69 ALA n 1 70 ALA n 1 71 ILE n 1 72 TYR n 1 73 GLN n 1 74 ILE n 1 75 LYS n 1 76 GLU n 1 77 GLN n 1 78 PHE n 1 79 GLN n 1 80 GLN n 1 81 ALA n 1 82 ALA n 1 83 ASP n 1 84 LEU n 1 85 TYR n 1 86 ALA n 1 87 VAL n 1 88 ALA n 1 89 PHE n 1 90 ALA n 1 91 LEU n 1 92 GLY n 1 93 LYS n 1 94 ASN n 1 95 ASP n 1 96 TYR n 1 97 THR n 1 98 PRO n 1 99 VAL n 1 100 PHE n 1 101 HIS n 1 102 THR n 1 103 GLY n 1 104 GLN n 1 105 CYS n 1 106 GLN n 1 107 LEU n 1 108 ARG n 1 109 LEU n 1 110 LYS n 1 111 ALA n 1 112 PRO n 1 113 LEU n 1 114 LYS n 1 115 ALA n 1 116 LYS n 1 117 GLU n 1 118 CYS n 1 119 PHE n 1 120 GLU n 1 121 LEU n 1 122 VAL n 1 123 ILE n 1 124 GLN n 1 125 HIS n 1 126 SER n 1 127 ASN n 1 128 ASP n 1 129 GLU n 1 130 LYS n 1 131 LEU n 1 132 LYS n 1 133 ILE n 1 134 LYS n 1 135 ALA n 1 136 GLN n 1 137 SER n 1 138 TYR n 1 139 LEU n 1 140 ASP n 1 141 ALA n 1 142 ILE n 1 143 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 143 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ipgC, ippI, CP0129' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Shigella flexneri' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 623 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 45N non-polymer . 'N-(1,3-benzodioxol-5-ylmethyl)cyclopentanamine' ? 'C13 H17 N O2' 219.280 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DMS non-polymer . 'DIMETHYL SULFOXIDE' ? 'C2 H6 O S' 78.133 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 9 ? ? ? A . n A 1 2 SER 2 10 ? ? ? A . n A 1 3 ILE 3 11 ? ? ? A . n A 1 4 SER 4 12 ? ? ? A . n A 1 5 THR 5 13 ? ? ? A . n A 1 6 ALA 6 14 ? ? ? A . n A 1 7 VAL 7 15 15 VAL VAL A . n A 1 8 ILE 8 16 16 ILE ILE A . n A 1 9 ASP 9 17 17 ASP ASP A . n A 1 10 ALA 10 18 18 ALA ALA A . n A 1 11 ILE 11 19 19 ILE ILE A . n A 1 12 ASN 12 20 20 ASN ASN A . n A 1 13 SER 13 21 21 SER SER A . n A 1 14 GLY 14 22 22 GLY GLY A . n A 1 15 ALA 15 23 23 ALA ALA A . n A 1 16 THR 16 24 24 THR THR A . n A 1 17 LEU 17 25 25 LEU LEU A . n A 1 18 LYS 18 26 26 LYS LYS A . n A 1 19 ASP 19 27 27 ASP ASP A . n A 1 20 ILE 20 28 28 ILE ILE A . n A 1 21 ASN 21 29 29 ASN ASN A . n A 1 22 ALA 22 30 30 ALA ALA A . n A 1 23 ILE 23 31 31 ILE ILE A . n A 1 24 PRO 24 32 32 PRO PRO A . n A 1 25 ASP 25 33 33 ASP ASP A . n A 1 26 ASP 26 34 34 ASP ASP A . n A 1 27 MET 27 35 35 MET MET A . n A 1 28 MET 28 36 36 MET MET A . n A 1 29 ASP 29 37 37 ASP ASP A . n A 1 30 ASP 30 38 38 ASP ASP A . n A 1 31 ILE 31 39 39 ILE ILE A . n A 1 32 TYR 32 40 40 TYR TYR A . n A 1 33 SER 33 41 41 SER SER A . n A 1 34 TYR 34 42 42 TYR TYR A . n A 1 35 ALA 35 43 43 ALA ALA A . n A 1 36 TYR 36 44 44 TYR TYR A . n A 1 37 ASP 37 45 45 ASP ASP A . n A 1 38 PHE 38 46 46 PHE PHE A . n A 1 39 TYR 39 47 47 TYR TYR A . n A 1 40 ASN 40 48 48 ASN ASN A . n A 1 41 LYS 41 49 49 LYS LYS A . n A 1 42 GLY 42 50 50 GLY GLY A . n A 1 43 ARG 43 51 51 ARG ARG A . n A 1 44 ILE 44 52 52 ILE ILE A . n A 1 45 GLU 45 53 53 GLU GLU A . n A 1 46 GLU 46 54 54 GLU GLU A . n A 1 47 ALA 47 55 55 ALA ALA A . n A 1 48 GLU 48 56 56 GLU GLU A . n A 1 49 VAL 49 57 57 VAL VAL A . n A 1 50 PHE 50 58 58 PHE PHE A . n A 1 51 PHE 51 59 59 PHE PHE A . n A 1 52 ARG 52 60 60 ARG ARG A . n A 1 53 PHE 53 61 61 PHE PHE A . n A 1 54 LEU 54 62 62 LEU LEU A . n A 1 55 CYS 55 63 63 CYS CYS A . n A 1 56 ILE 56 64 64 ILE ILE A . n A 1 57 TYR 57 65 65 TYR TYR A . n A 1 58 ASP 58 66 66 ASP ASP A . n A 1 59 PHE 59 67 67 PHE PHE A . n A 1 60 TYR 60 68 68 TYR TYR A . n A 1 61 ASN 61 69 69 ASN ASN A . n A 1 62 VAL 62 70 70 VAL VAL A . n A 1 63 ASP 63 71 71 ASP ASP A . n A 1 64 TYR 64 72 72 TYR TYR A . n A 1 65 ILE 65 73 73 ILE ILE A . n A 1 66 MET 66 74 74 MET MET A . n A 1 67 GLY 67 75 75 GLY GLY A . n A 1 68 LEU 68 76 76 LEU LEU A . n A 1 69 ALA 69 77 77 ALA ALA A . n A 1 70 ALA 70 78 78 ALA ALA A . n A 1 71 ILE 71 79 79 ILE ILE A . n A 1 72 TYR 72 80 80 TYR TYR A . n A 1 73 GLN 73 81 81 GLN GLN A . n A 1 74 ILE 74 82 82 ILE ILE A . n A 1 75 LYS 75 83 83 LYS LYS A . n A 1 76 GLU 76 84 84 GLU GLU A . n A 1 77 GLN 77 85 85 GLN GLN A . n A 1 78 PHE 78 86 86 PHE PHE A . n A 1 79 GLN 79 87 87 GLN GLN A . n A 1 80 GLN 80 88 88 GLN GLN A . n A 1 81 ALA 81 89 89 ALA ALA A . n A 1 82 ALA 82 90 90 ALA ALA A . n A 1 83 ASP 83 91 91 ASP ASP A . n A 1 84 LEU 84 92 92 LEU LEU A . n A 1 85 TYR 85 93 93 TYR TYR A . n A 1 86 ALA 86 94 94 ALA ALA A . n A 1 87 VAL 87 95 95 VAL VAL A . n A 1 88 ALA 88 96 96 ALA ALA A . n A 1 89 PHE 89 97 97 PHE PHE A . n A 1 90 ALA 90 98 98 ALA ALA A . n A 1 91 LEU 91 99 99 LEU LEU A . n A 1 92 GLY 92 100 100 GLY GLY A . n A 1 93 LYS 93 101 101 LYS LYS A . n A 1 94 ASN 94 102 102 ASN ASN A . n A 1 95 ASP 95 103 103 ASP ASP A . n A 1 96 TYR 96 104 104 TYR TYR A . n A 1 97 THR 97 105 105 THR THR A . n A 1 98 PRO 98 106 106 PRO PRO A . n A 1 99 VAL 99 107 107 VAL VAL A . n A 1 100 PHE 100 108 108 PHE PHE A . n A 1 101 HIS 101 109 109 HIS HIS A . n A 1 102 THR 102 110 110 THR THR A . n A 1 103 GLY 103 111 111 GLY GLY A . n A 1 104 GLN 104 112 112 GLN GLN A . n A 1 105 CYS 105 113 113 CYS CYS A . n A 1 106 GLN 106 114 114 GLN GLN A . n A 1 107 LEU 107 115 115 LEU LEU A . n A 1 108 ARG 108 116 116 ARG ARG A . n A 1 109 LEU 109 117 117 LEU LEU A . n A 1 110 LYS 110 118 118 LYS LYS A . n A 1 111 ALA 111 119 119 ALA ALA A . n A 1 112 PRO 112 120 120 PRO PRO A . n A 1 113 LEU 113 121 121 LEU LEU A . n A 1 114 LYS 114 122 122 LYS LYS A . n A 1 115 ALA 115 123 123 ALA ALA A . n A 1 116 LYS 116 124 124 LYS LYS A . n A 1 117 GLU 117 125 125 GLU GLU A . n A 1 118 CYS 118 126 126 CYS CYS A . n A 1 119 PHE 119 127 127 PHE PHE A . n A 1 120 GLU 120 128 128 GLU GLU A . n A 1 121 LEU 121 129 129 LEU LEU A . n A 1 122 VAL 122 130 130 VAL VAL A . n A 1 123 ILE 123 131 131 ILE ILE A . n A 1 124 GLN 124 132 132 GLN GLN A . n A 1 125 HIS 125 133 133 HIS HIS A . n A 1 126 SER 126 134 134 SER SER A . n A 1 127 ASN 127 135 135 ASN ASN A . n A 1 128 ASP 128 136 136 ASP ASP A . n A 1 129 GLU 129 137 137 GLU GLU A . n A 1 130 LYS 130 138 138 LYS LYS A . n A 1 131 LEU 131 139 139 LEU LEU A . n A 1 132 LYS 132 140 140 LYS LYS A . n A 1 133 ILE 133 141 141 ILE ILE A . n A 1 134 LYS 134 142 142 LYS LYS A . n A 1 135 ALA 135 143 143 ALA ALA A . n A 1 136 GLN 136 144 144 GLN GLN A . n A 1 137 SER 137 145 145 SER SER A . n A 1 138 TYR 138 146 146 TYR TYR A . n A 1 139 LEU 139 147 147 LEU LEU A . n A 1 140 ASP 140 148 148 ASP ASP A . n A 1 141 ALA 141 149 149 ALA ALA A . n A 1 142 ILE 142 150 150 ILE ILE A . n A 1 143 GLN 143 151 151 GLN GLN A . n B 1 1 GLY 1 9 9 GLY GLY B . n B 1 2 SER 2 10 10 SER SER B . n B 1 3 ILE 3 11 11 ILE ILE B . n B 1 4 SER 4 12 12 SER SER B . n B 1 5 THR 5 13 13 THR THR B . n B 1 6 ALA 6 14 14 ALA ALA B . n B 1 7 VAL 7 15 15 VAL VAL B . n B 1 8 ILE 8 16 16 ILE ILE B . n B 1 9 ASP 9 17 17 ASP ASP B . n B 1 10 ALA 10 18 18 ALA ALA B . n B 1 11 ILE 11 19 19 ILE ILE B . n B 1 12 ASN 12 20 20 ASN ASN B . n B 1 13 SER 13 21 21 SER SER B . n B 1 14 GLY 14 22 22 GLY GLY B . n B 1 15 ALA 15 23 23 ALA ALA B . n B 1 16 THR 16 24 24 THR THR B . n B 1 17 LEU 17 25 25 LEU LEU B . n B 1 18 LYS 18 26 26 LYS LYS B . n B 1 19 ASP 19 27 27 ASP ASP B . n B 1 20 ILE 20 28 28 ILE ILE B . n B 1 21 ASN 21 29 29 ASN ASN B . n B 1 22 ALA 22 30 30 ALA ALA B . n B 1 23 ILE 23 31 31 ILE ILE B . n B 1 24 PRO 24 32 32 PRO PRO B . n B 1 25 ASP 25 33 33 ASP ASP B . n B 1 26 ASP 26 34 34 ASP ASP B . n B 1 27 MET 27 35 35 MET MET B . n B 1 28 MET 28 36 36 MET MET B . n B 1 29 ASP 29 37 37 ASP ASP B . n B 1 30 ASP 30 38 38 ASP ASP B . n B 1 31 ILE 31 39 39 ILE ILE B . n B 1 32 TYR 32 40 40 TYR TYR B . n B 1 33 SER 33 41 41 SER SER B . n B 1 34 TYR 34 42 42 TYR TYR B . n B 1 35 ALA 35 43 43 ALA ALA B . n B 1 36 TYR 36 44 44 TYR TYR B . n B 1 37 ASP 37 45 45 ASP ASP B . n B 1 38 PHE 38 46 46 PHE PHE B . n B 1 39 TYR 39 47 47 TYR TYR B . n B 1 40 ASN 40 48 48 ASN ASN B . n B 1 41 LYS 41 49 49 LYS LYS B . n B 1 42 GLY 42 50 50 GLY GLY B . n B 1 43 ARG 43 51 51 ARG ARG B . n B 1 44 ILE 44 52 52 ILE ILE B . n B 1 45 GLU 45 53 53 GLU GLU B . n B 1 46 GLU 46 54 54 GLU GLU B . n B 1 47 ALA 47 55 55 ALA ALA B . n B 1 48 GLU 48 56 56 GLU GLU B . n B 1 49 VAL 49 57 57 VAL VAL B . n B 1 50 PHE 50 58 58 PHE PHE B . n B 1 51 PHE 51 59 59 PHE PHE B . n B 1 52 ARG 52 60 60 ARG ARG B . n B 1 53 PHE 53 61 61 PHE PHE B . n B 1 54 LEU 54 62 62 LEU LEU B . n B 1 55 CYS 55 63 63 CYS CYS B . n B 1 56 ILE 56 64 64 ILE ILE B . n B 1 57 TYR 57 65 65 TYR TYR B . n B 1 58 ASP 58 66 66 ASP ASP B . n B 1 59 PHE 59 67 67 PHE PHE B . n B 1 60 TYR 60 68 68 TYR TYR B . n B 1 61 ASN 61 69 69 ASN ASN B . n B 1 62 VAL 62 70 70 VAL VAL B . n B 1 63 ASP 63 71 71 ASP ASP B . n B 1 64 TYR 64 72 72 TYR TYR B . n B 1 65 ILE 65 73 73 ILE ILE B . n B 1 66 MET 66 74 74 MET MET B . n B 1 67 GLY 67 75 75 GLY GLY B . n B 1 68 LEU 68 76 76 LEU LEU B . n B 1 69 ALA 69 77 77 ALA ALA B . n B 1 70 ALA 70 78 78 ALA ALA B . n B 1 71 ILE 71 79 79 ILE ILE B . n B 1 72 TYR 72 80 80 TYR TYR B . n B 1 73 GLN 73 81 81 GLN GLN B . n B 1 74 ILE 74 82 82 ILE ILE B . n B 1 75 LYS 75 83 83 LYS LYS B . n B 1 76 GLU 76 84 84 GLU GLU B . n B 1 77 GLN 77 85 85 GLN GLN B . n B 1 78 PHE 78 86 86 PHE PHE B . n B 1 79 GLN 79 87 87 GLN GLN B . n B 1 80 GLN 80 88 88 GLN GLN B . n B 1 81 ALA 81 89 89 ALA ALA B . n B 1 82 ALA 82 90 90 ALA ALA B . n B 1 83 ASP 83 91 91 ASP ASP B . n B 1 84 LEU 84 92 92 LEU LEU B . n B 1 85 TYR 85 93 93 TYR TYR B . n B 1 86 ALA 86 94 94 ALA ALA B . n B 1 87 VAL 87 95 95 VAL VAL B . n B 1 88 ALA 88 96 96 ALA ALA B . n B 1 89 PHE 89 97 97 PHE PHE B . n B 1 90 ALA 90 98 98 ALA ALA B . n B 1 91 LEU 91 99 99 LEU LEU B . n B 1 92 GLY 92 100 100 GLY GLY B . n B 1 93 LYS 93 101 101 LYS LYS B . n B 1 94 ASN 94 102 102 ASN ASN B . n B 1 95 ASP 95 103 103 ASP ASP B . n B 1 96 TYR 96 104 104 TYR TYR B . n B 1 97 THR 97 105 105 THR THR B . n B 1 98 PRO 98 106 106 PRO PRO B . n B 1 99 VAL 99 107 107 VAL VAL B . n B 1 100 PHE 100 108 108 PHE PHE B . n B 1 101 HIS 101 109 109 HIS HIS B . n B 1 102 THR 102 110 110 THR THR B . n B 1 103 GLY 103 111 111 GLY GLY B . n B 1 104 GLN 104 112 112 GLN GLN B . n B 1 105 CYS 105 113 113 CYS CYS B . n B 1 106 GLN 106 114 114 GLN GLN B . n B 1 107 LEU 107 115 115 LEU LEU B . n B 1 108 ARG 108 116 116 ARG ARG B . n B 1 109 LEU 109 117 117 LEU LEU B . n B 1 110 LYS 110 118 118 LYS LYS B . n B 1 111 ALA 111 119 119 ALA ALA B . n B 1 112 PRO 112 120 120 PRO PRO B . n B 1 113 LEU 113 121 121 LEU LEU B . n B 1 114 LYS 114 122 122 LYS LYS B . n B 1 115 ALA 115 123 123 ALA ALA B . n B 1 116 LYS 116 124 124 LYS LYS B . n B 1 117 GLU 117 125 125 GLU GLU B . n B 1 118 CYS 118 126 126 CYS CYS B . n B 1 119 PHE 119 127 127 PHE PHE B . n B 1 120 GLU 120 128 128 GLU GLU B . n B 1 121 LEU 121 129 129 LEU LEU B . n B 1 122 VAL 122 130 130 VAL VAL B . n B 1 123 ILE 123 131 131 ILE ILE B . n B 1 124 GLN 124 132 132 GLN GLN B . n B 1 125 HIS 125 133 133 HIS HIS B . n B 1 126 SER 126 134 134 SER SER B . n B 1 127 ASN 127 135 135 ASN ASN B . n B 1 128 ASP 128 136 136 ASP ASP B . n B 1 129 GLU 129 137 137 GLU GLU B . n B 1 130 LYS 130 138 138 LYS LYS B . n B 1 131 LEU 131 139 139 LEU LEU B . n B 1 132 LYS 132 140 140 LYS LYS B . n B 1 133 ILE 133 141 141 ILE ILE B . n B 1 134 LYS 134 142 142 LYS LYS B . n B 1 135 ALA 135 143 143 ALA ALA B . n B 1 136 GLN 136 144 144 GLN GLN B . n B 1 137 SER 137 145 145 SER SER B . n B 1 138 TYR 138 146 146 TYR TYR B . n B 1 139 LEU 139 147 147 LEU LEU B . n B 1 140 ASP 140 148 148 ASP ASP B . n B 1 141 ALA 141 149 149 ALA ALA B . n B 1 142 ILE 142 150 150 ILE ILE B . n B 1 143 GLN 143 151 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 CL 1 201 1 CL CL A . D 2 CL 1 202 3 CL CL A . E 3 DMS 1 203 1 DMS DMS A . F 3 DMS 1 204 2 DMS DMS A . G 4 PEG 1 205 1 PEG PEG A . H 2 CL 1 201 4 CL CL B . I 5 MG 1 202 2 MG MG B . J 6 45N 1 203 1 45N J06 B . K 4 PEG 1 204 2 PEG PEG B . L 7 HOH 1 301 64 HOH HOH A . L 7 HOH 2 302 218 HOH HOH A . L 7 HOH 3 303 169 HOH HOH A . L 7 HOH 4 304 180 HOH HOH A . L 7 HOH 5 305 143 HOH HOH A . L 7 HOH 6 306 128 HOH HOH A . L 7 HOH 7 307 51 HOH HOH A . L 7 HOH 8 308 166 HOH HOH A . L 7 HOH 9 309 192 HOH HOH A . L 7 HOH 10 310 208 HOH HOH A . L 7 HOH 11 311 62 HOH HOH A . L 7 HOH 12 312 187 HOH HOH A . L 7 HOH 13 313 43 HOH HOH A . L 7 HOH 14 314 11 HOH HOH A . L 7 HOH 15 315 130 HOH HOH A . L 7 HOH 16 316 76 HOH HOH A . L 7 HOH 17 317 100 HOH HOH A . L 7 HOH 18 318 110 HOH HOH A . L 7 HOH 19 319 14 HOH HOH A . L 7 HOH 20 320 21 HOH HOH A . L 7 HOH 21 321 98 HOH HOH A . L 7 HOH 22 322 193 HOH HOH A . L 7 HOH 23 323 158 HOH HOH A . L 7 HOH 24 324 132 HOH HOH A . L 7 HOH 25 325 212 HOH HOH A . L 7 HOH 26 326 122 HOH HOH A . L 7 HOH 27 327 69 HOH HOH A . L 7 HOH 28 328 139 HOH HOH A . L 7 HOH 29 329 63 HOH HOH A . L 7 HOH 30 330 81 HOH HOH A . L 7 HOH 31 331 163 HOH HOH A . L 7 HOH 32 332 40 HOH HOH A . L 7 HOH 33 333 28 HOH HOH A . L 7 HOH 34 334 224 HOH HOH A . L 7 HOH 35 335 67 HOH HOH A . L 7 HOH 36 336 83 HOH HOH A . L 7 HOH 37 337 30 HOH HOH A . L 7 HOH 38 338 42 HOH HOH A . L 7 HOH 39 339 146 HOH HOH A . L 7 HOH 40 340 172 HOH HOH A . L 7 HOH 41 341 55 HOH HOH A . L 7 HOH 42 342 4 HOH HOH A . L 7 HOH 43 343 148 HOH HOH A . L 7 HOH 44 344 145 HOH HOH A . L 7 HOH 45 345 75 HOH HOH A . L 7 HOH 46 346 223 HOH HOH A . L 7 HOH 47 347 34 HOH HOH A . L 7 HOH 48 348 45 HOH HOH A . L 7 HOH 49 349 117 HOH HOH A . L 7 HOH 50 350 79 HOH HOH A . L 7 HOH 51 351 240 HOH HOH A . L 7 HOH 52 352 61 HOH HOH A . L 7 HOH 53 353 29 HOH HOH A . L 7 HOH 54 354 264 HOH HOH A . L 7 HOH 55 355 138 HOH HOH A . L 7 HOH 56 356 211 HOH HOH A . L 7 HOH 57 357 50 HOH HOH A . L 7 HOH 58 358 44 HOH HOH A . L 7 HOH 59 359 249 HOH HOH A . L 7 HOH 60 360 99 HOH HOH A . L 7 HOH 61 361 121 HOH HOH A . L 7 HOH 62 362 25 HOH HOH A . L 7 HOH 63 363 74 HOH HOH A . L 7 HOH 64 364 261 HOH HOH A . L 7 HOH 65 365 71 HOH HOH A . L 7 HOH 66 366 217 HOH HOH A . L 7 HOH 67 367 167 HOH HOH A . L 7 HOH 68 368 82 HOH HOH A . L 7 HOH 69 369 48 HOH HOH A . L 7 HOH 70 370 222 HOH HOH A . L 7 HOH 71 371 177 HOH HOH A . L 7 HOH 72 372 131 HOH HOH A . L 7 HOH 73 373 16 HOH HOH A . L 7 HOH 74 374 65 HOH HOH A . L 7 HOH 75 375 160 HOH HOH A . L 7 HOH 76 376 27 HOH HOH A . L 7 HOH 77 377 265 HOH HOH A . L 7 HOH 78 378 144 HOH HOH A . L 7 HOH 79 379 195 HOH HOH A . L 7 HOH 80 380 151 HOH HOH A . L 7 HOH 81 381 58 HOH HOH A . L 7 HOH 82 382 32 HOH HOH A . L 7 HOH 83 383 236 HOH HOH A . L 7 HOH 84 384 105 HOH HOH A . L 7 HOH 85 385 179 HOH HOH A . L 7 HOH 86 386 251 HOH HOH A . L 7 HOH 87 387 101 HOH HOH A . L 7 HOH 88 388 97 HOH HOH A . L 7 HOH 89 389 201 HOH HOH A . L 7 HOH 90 390 140 HOH HOH A . L 7 HOH 91 391 190 HOH HOH A . L 7 HOH 92 392 267 HOH HOH A . L 7 HOH 93 393 113 HOH HOH A . L 7 HOH 94 394 168 HOH HOH A . L 7 HOH 95 395 247 HOH HOH A . L 7 HOH 96 396 239 HOH HOH A . L 7 HOH 97 397 241 HOH HOH A . L 7 HOH 98 398 164 HOH HOH A . L 7 HOH 99 399 214 HOH HOH A . L 7 HOH 100 400 186 HOH HOH A . L 7 HOH 101 401 227 HOH HOH A . L 7 HOH 102 402 225 HOH HOH A . L 7 HOH 103 403 103 HOH HOH A . L 7 HOH 104 404 254 HOH HOH A . L 7 HOH 105 405 242 HOH HOH A . L 7 HOH 106 406 127 HOH HOH A . M 7 HOH 1 301 207 HOH HOH B . M 7 HOH 2 302 37 HOH HOH B . M 7 HOH 3 303 36 HOH HOH B . M 7 HOH 4 304 156 HOH HOH B . M 7 HOH 5 305 228 HOH HOH B . M 7 HOH 6 306 89 HOH HOH B . M 7 HOH 7 307 141 HOH HOH B . M 7 HOH 8 308 26 HOH HOH B . M 7 HOH 9 309 53 HOH HOH B . M 7 HOH 10 310 112 HOH HOH B . M 7 HOH 11 311 84 HOH HOH B . M 7 HOH 12 312 8 HOH HOH B . M 7 HOH 13 313 17 HOH HOH B . M 7 HOH 14 314 196 HOH HOH B . M 7 HOH 15 315 66 HOH HOH B . M 7 HOH 16 316 221 HOH HOH B . M 7 HOH 17 317 111 HOH HOH B . M 7 HOH 18 318 20 HOH HOH B . M 7 HOH 19 319 137 HOH HOH B . M 7 HOH 20 320 39 HOH HOH B . M 7 HOH 21 321 80 HOH HOH B . M 7 HOH 22 322 134 HOH HOH B . M 7 HOH 23 323 31 HOH HOH B . M 7 HOH 24 324 52 HOH HOH B . M 7 HOH 25 325 12 HOH HOH B . M 7 HOH 26 326 88 HOH HOH B . M 7 HOH 27 327 215 HOH HOH B . M 7 HOH 28 328 174 HOH HOH B . M 7 HOH 29 329 22 HOH HOH B . M 7 HOH 30 330 59 HOH HOH B . M 7 HOH 31 331 205 HOH HOH B . M 7 HOH 32 332 104 HOH HOH B . M 7 HOH 33 333 165 HOH HOH B . M 7 HOH 34 334 125 HOH HOH B . M 7 HOH 35 335 109 HOH HOH B . M 7 HOH 36 336 115 HOH HOH B . M 7 HOH 37 337 24 HOH HOH B . M 7 HOH 38 338 135 HOH HOH B . M 7 HOH 39 339 35 HOH HOH B . M 7 HOH 40 340 133 HOH HOH B . M 7 HOH 41 341 124 HOH HOH B . M 7 HOH 42 342 23 HOH HOH B . M 7 HOH 43 343 41 HOH HOH B . M 7 HOH 44 344 198 HOH HOH B . M 7 HOH 45 345 90 HOH HOH B . M 7 HOH 46 346 47 HOH HOH B . M 7 HOH 47 347 68 HOH HOH B . M 7 HOH 48 348 189 HOH HOH B . M 7 HOH 49 349 250 HOH HOH B . M 7 HOH 50 350 233 HOH HOH B . M 7 HOH 51 351 49 HOH HOH B . M 7 HOH 52 352 56 HOH HOH B . M 7 HOH 53 353 209 HOH HOH B . M 7 HOH 54 354 85 HOH HOH B . M 7 HOH 55 355 102 HOH HOH B . M 7 HOH 56 356 120 HOH HOH B . M 7 HOH 57 357 38 HOH HOH B . M 7 HOH 58 358 194 HOH HOH B . M 7 HOH 59 359 96 HOH HOH B . M 7 HOH 60 360 123 HOH HOH B . M 7 HOH 61 361 258 HOH HOH B . M 7 HOH 62 362 73 HOH HOH B . M 7 HOH 63 363 95 HOH HOH B . M 7 HOH 64 364 18 HOH HOH B . M 7 HOH 65 365 270 HOH HOH B . M 7 HOH 66 366 13 HOH HOH B . M 7 HOH 67 367 1 HOH HOH B . M 7 HOH 68 368 253 HOH HOH B . M 7 HOH 69 369 268 HOH HOH B . M 7 HOH 70 370 269 HOH HOH B . M 7 HOH 71 371 54 HOH HOH B . M 7 HOH 72 372 94 HOH HOH B . M 7 HOH 73 373 266 HOH HOH B . M 7 HOH 74 374 157 HOH HOH B . M 7 HOH 75 375 226 HOH HOH B . M 7 HOH 76 376 108 HOH HOH B . M 7 HOH 77 377 182 HOH HOH B . M 7 HOH 78 378 154 HOH HOH B . M 7 HOH 79 379 248 HOH HOH B . M 7 HOH 80 380 106 HOH HOH B . M 7 HOH 81 381 263 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A VAL 15 ? CG1 ? A VAL 7 CG1 2 1 Y 1 A VAL 15 ? CG2 ? A VAL 7 CG2 3 1 Y 1 A ILE 16 ? CG1 ? A ILE 8 CG1 4 1 Y 1 A ILE 16 ? CG2 ? A ILE 8 CG2 5 1 Y 1 A ILE 16 ? CD1 ? A ILE 8 CD1 6 1 Y 1 A ASP 17 ? CG ? A ASP 9 CG 7 1 Y 1 A ASP 17 ? OD1 ? A ASP 9 OD1 8 1 Y 1 A ASP 17 ? OD2 ? A ASP 9 OD2 9 1 Y 1 A ILE 19 ? CG1 ? A ILE 11 CG1 10 1 Y 1 A ILE 19 ? CG2 ? A ILE 11 CG2 11 1 Y 1 A ILE 19 ? CD1 ? A ILE 11 CD1 12 1 Y 1 A ASN 20 ? CG ? A ASN 12 CG 13 1 Y 1 A ASN 20 ? OD1 ? A ASN 12 OD1 14 1 Y 1 A ASN 20 ? ND2 ? A ASN 12 ND2 15 1 Y 1 A ASN 29 ? CG ? A ASN 21 CG 16 1 Y 1 A ASN 29 ? OD1 ? A ASN 21 OD1 17 1 Y 1 A ASN 29 ? ND2 ? A ASN 21 ND2 18 1 Y 1 A LYS 49 ? CE ? A LYS 41 CE 19 1 Y 1 A LYS 49 ? NZ ? A LYS 41 NZ 20 1 Y 1 A GLN 88 ? CD ? A GLN 80 CD 21 1 Y 1 A GLN 88 ? OE1 ? A GLN 80 OE1 22 1 Y 1 A GLN 88 ? NE2 ? A GLN 80 NE2 23 1 Y 1 A LYS 101 ? CG ? A LYS 93 CG 24 1 Y 1 A LYS 101 ? CD ? A LYS 93 CD 25 1 Y 1 A LYS 101 ? CE ? A LYS 93 CE 26 1 Y 1 A LYS 101 ? NZ ? A LYS 93 NZ 27 1 Y 1 A LYS 124 ? NZ ? A LYS 116 NZ 28 1 Y 1 A GLU 125 ? CD ? A GLU 117 CD 29 1 Y 1 A GLU 125 ? OE1 ? A GLU 117 OE1 30 1 Y 1 A GLU 125 ? OE2 ? A GLU 117 OE2 31 1 Y 1 A GLN 132 ? CG ? A GLN 124 CG 32 1 Y 1 A GLN 132 ? CD ? A GLN 124 CD 33 1 Y 1 A GLN 132 ? OE1 ? A GLN 124 OE1 34 1 Y 1 A GLN 132 ? NE2 ? A GLN 124 NE2 35 1 Y 1 A LYS 138 ? CE ? A LYS 130 CE 36 1 Y 1 A LYS 138 ? NZ ? A LYS 130 NZ 37 1 Y 1 B SER 21 ? OG ? B SER 13 OG 38 1 Y 1 B ILE 28 ? CG1 ? B ILE 20 CG1 39 1 Y 1 B ILE 28 ? CG2 ? B ILE 20 CG2 40 1 Y 1 B ILE 28 ? CD1 ? B ILE 20 CD1 41 1 Y 1 B ASN 29 ? CG ? B ASN 21 CG 42 1 Y 1 B ASN 29 ? OD1 ? B ASN 21 OD1 43 1 Y 1 B ASN 29 ? ND2 ? B ASN 21 ND2 44 1 Y 1 B MET 35 ? CG ? B MET 27 CG 45 1 Y 1 B MET 35 ? SD ? B MET 27 SD 46 1 Y 1 B MET 35 ? CE ? B MET 27 CE 47 1 Y 1 B ILE 52 ? CG1 ? B ILE 44 CG1 48 1 Y 1 B ILE 52 ? CG2 ? B ILE 44 CG2 49 1 Y 1 B ILE 52 ? CD1 ? B ILE 44 CD1 50 1 Y 1 B LYS 101 ? CG ? B LYS 93 CG 51 1 Y 1 B LYS 101 ? CD ? B LYS 93 CD 52 1 Y 1 B LYS 101 ? CE ? B LYS 93 CE 53 1 Y 1 B LYS 101 ? NZ ? B LYS 93 NZ 54 1 Y 1 B ASN 102 ? CG ? B ASN 94 CG 55 1 Y 1 B ASN 102 ? OD1 ? B ASN 94 OD1 56 1 Y 1 B ASN 102 ? ND2 ? B ASN 94 ND2 57 1 Y 1 B LYS 118 ? CE ? B LYS 110 CE 58 1 Y 1 B LYS 118 ? NZ ? B LYS 110 NZ 59 1 Y 1 B LEU 121 ? CG ? B LEU 113 CG 60 1 Y 1 B LEU 121 ? CD1 ? B LEU 113 CD1 61 1 Y 1 B LEU 121 ? CD2 ? B LEU 113 CD2 62 1 Y 1 B LYS 122 ? CE ? B LYS 114 CE 63 1 Y 1 B LYS 122 ? NZ ? B LYS 114 NZ 64 1 Y 1 B LYS 124 ? CG ? B LYS 116 CG 65 1 Y 1 B LYS 124 ? CD ? B LYS 116 CD 66 1 Y 1 B LYS 124 ? CE ? B LYS 116 CE 67 1 Y 1 B LYS 124 ? NZ ? B LYS 116 NZ 68 1 Y 1 B GLU 125 ? CG ? B GLU 117 CG 69 1 Y 1 B GLU 125 ? CD ? B GLU 117 CD 70 1 Y 1 B GLU 125 ? OE1 ? B GLU 117 OE1 71 1 Y 1 B GLU 125 ? OE2 ? B GLU 117 OE2 72 1 Y 1 B GLN 132 ? CD ? B GLN 124 CD 73 1 Y 1 B GLN 132 ? OE1 ? B GLN 124 OE1 74 1 Y 1 B GLN 132 ? NE2 ? B GLN 124 NE2 75 1 Y 1 B LYS 138 ? CE ? B LYS 130 CE 76 1 Y 1 B LYS 138 ? NZ ? B LYS 130 NZ 77 1 Y 1 B ILE 150 ? CG1 ? B ILE 142 CG1 78 1 Y 1 B ILE 150 ? CG2 ? B ILE 142 CG2 79 1 Y 1 B ILE 150 ? CD1 ? B ILE 142 CD1 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 1.02 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 1.02 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 7.0.047 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.8.9 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7O6S _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.630 _cell.length_a_esd ? _cell.length_b 57.630 _cell.length_b_esd ? _cell.length_c 159.184 _cell.length_c_esd ? _cell.volume 457854.286 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7O6S _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ;P 32 2" ; _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7O6S _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;25% PEG 4000, 0.05 M TRIS (pH 7.0), 0.3 M magnesium chloride ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-02-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.91841 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.91841 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 21.01 _reflns.entry_id 7O6S _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.58 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 43093 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.059 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.58 _reflns_shell.d_res_low 1.66 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 6793 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value 0.69 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.915 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 28.24 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7O6S _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.58 _refine.ls_d_res_low 47.62 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 43077 _refine.ls_number_reflns_R_free 2155 _refine.ls_number_reflns_R_work 40922 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.54 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1917 _refine.ls_R_factor_R_free 0.2252 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1900 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6SCB _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details 'random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.0696 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1633 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.58 _refine_hist.d_res_low 47.62 _refine_hist.number_atoms_solvent 187 _refine_hist.number_atoms_total 2402 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2173 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 42 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0094 ? 2413 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9862 ? 3292 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0548 ? 358 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0073 ? 440 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.0584 ? 1438 ? f_dihedral_angle_d ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.58 _refine_ls_shell.d_res_low 1.61 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 139 _refine_ls_shell.number_reflns_R_work 2634 _refine_ls_shell.percent_reflns_obs 98.12 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3058 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2683 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # loop_ _struct_ncs_dom.id _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.details 1 1 ? 2 1 ? # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A VAL 7 . A TYR 32 . A VAL 15 A TYR 40 ? ;(chain 'A' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 48 or resid 50 through 51 or (resid 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 97 or resid 103 through 104 or resid 106 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or (resid 123 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 128 or resid 130 or resid 132 or resid 134 through 149 or (resid 150 and (name N or name CA or name C or name O or name CB )))) ; 1 1 2 A TYR 34 . A ASN 40 . A TYR 42 A ASN 48 ? ;(chain 'A' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 48 or resid 50 through 51 or (resid 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 97 or resid 103 through 104 or resid 106 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or (resid 123 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 128 or resid 130 or resid 132 or resid 134 through 149 or (resid 150 and (name N or name CA or name C or name O or name CB )))) ; 1 1 3 A GLY 42 . A ASN 61 . A GLY 50 A ASN 69 ? ;(chain 'A' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 48 or resid 50 through 51 or (resid 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 97 or resid 103 through 104 or resid 106 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or (resid 123 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 128 or resid 130 or resid 132 or resid 134 through 149 or (resid 150 and (name N or name CA or name C or name O or name CB )))) ; 1 1 4 A ASP 63 . A TYR 64 . A ASP 71 A TYR 72 ? ;(chain 'A' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 48 or resid 50 through 51 or (resid 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 97 or resid 103 through 104 or resid 106 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or (resid 123 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 128 or resid 130 or resid 132 or resid 134 through 149 or (resid 150 and (name N or name CA or name C or name O or name CB )))) ; 1 1 5 A MET 66 . A ALA 69 . A MET 74 A ALA 77 ? ;(chain 'A' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 48 or resid 50 through 51 or (resid 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 97 or resid 103 through 104 or resid 106 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or (resid 123 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 128 or resid 130 or resid 132 or resid 134 through 149 or (resid 150 and (name N or name CA or name C or name O or name CB )))) ; 1 1 6 A TYR 72 . A GLN 73 . A TYR 80 A GLN 81 ? ;(chain 'A' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 48 or resid 50 through 51 or (resid 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 97 or resid 103 through 104 or resid 106 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or (resid 123 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 128 or resid 130 or resid 132 or resid 134 through 149 or (resid 150 and (name N or name CA or name C or name O or name CB )))) ; 1 1 7 A LYS 75 . A PHE 89 . A LYS 83 A PHE 97 ? ;(chain 'A' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 48 or resid 50 through 51 or (resid 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 97 or resid 103 through 104 or resid 106 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or (resid 123 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 128 or resid 130 or resid 132 or resid 134 through 149 or (resid 150 and (name N or name CA or name C or name O or name CB )))) ; 1 1 8 A ASP 95 . A TYR 96 . A ASP 103 A TYR 104 ? ;(chain 'A' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 48 or resid 50 through 51 or (resid 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 97 or resid 103 through 104 or resid 106 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or (resid 123 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 128 or resid 130 or resid 132 or resid 134 through 149 or (resid 150 and (name N or name CA or name C or name O or name CB )))) ; 1 1 9 A PRO 98 . A PRO 112 . A PRO 106 A PRO 120 ? ;(chain 'A' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 48 or resid 50 through 51 or (resid 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 97 or resid 103 through 104 or resid 106 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or (resid 123 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 128 or resid 130 or resid 132 or resid 134 through 149 or (resid 150 and (name N or name CA or name C or name O or name CB )))) ; 1 1 10 A ALA 115 . A GLU 120 . A ALA 123 A GLU 128 ? ;(chain 'A' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 48 or resid 50 through 51 or (resid 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 97 or resid 103 through 104 or resid 106 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or (resid 123 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 128 or resid 130 or resid 132 or resid 134 through 149 or (resid 150 and (name N or name CA or name C or name O or name CB )))) ; 1 1 11 A VAL 122 . A VAL 122 . A VAL 130 A VAL 130 ? ;(chain 'A' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 48 or resid 50 through 51 or (resid 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 97 or resid 103 through 104 or resid 106 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or (resid 123 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 128 or resid 130 or resid 132 or resid 134 through 149 or (resid 150 and (name N or name CA or name C or name O or name CB )))) ; 1 1 12 A SER 126 . A ALA 141 . A SER 134 A ALA 149 ? ;(chain 'A' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 34 or (resid 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 48 or resid 50 through 51 or (resid 52 and (name N or name CA or name C or name O or name CB )) or resid 53 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 97 or resid 103 through 104 or resid 106 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or (resid 123 through 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 128 or resid 130 or resid 132 or resid 134 through 149 or (resid 150 and (name N or name CA or name C or name O or name CB )))) ; 1 2 1 B VAL 7 . B TYR 32 . B VAL 15 B TYR 40 ? ;(chain 'B' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 40 or resid 42 through 48 or resid 50 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 97 or resid 103 through 104 or resid 106 through 121 or resid 123 through 128 or resid 130 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 134 through 150)) ; 1 2 2 B TYR 34 . B ASN 40 . B TYR 42 B ASN 48 ? ;(chain 'B' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 40 or resid 42 through 48 or resid 50 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 97 or resid 103 through 104 or resid 106 through 121 or resid 123 through 128 or resid 130 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 134 through 150)) ; 1 2 3 B GLY 42 . B ASN 61 . B GLY 50 B ASN 69 ? ;(chain 'B' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 40 or resid 42 through 48 or resid 50 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 97 or resid 103 through 104 or resid 106 through 121 or resid 123 through 128 or resid 130 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 134 through 150)) ; 1 2 4 B ASP 63 . B TYR 64 . B ASP 71 B TYR 72 ? ;(chain 'B' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 40 or resid 42 through 48 or resid 50 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 97 or resid 103 through 104 or resid 106 through 121 or resid 123 through 128 or resid 130 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 134 through 150)) ; 1 2 5 B MET 66 . B ALA 69 . B MET 74 B ALA 77 ? ;(chain 'B' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 40 or resid 42 through 48 or resid 50 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 97 or resid 103 through 104 or resid 106 through 121 or resid 123 through 128 or resid 130 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 134 through 150)) ; 1 2 6 B TYR 72 . B GLN 73 . B TYR 80 B GLN 81 ? ;(chain 'B' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 40 or resid 42 through 48 or resid 50 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 97 or resid 103 through 104 or resid 106 through 121 or resid 123 through 128 or resid 130 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 134 through 150)) ; 1 2 7 B LYS 75 . B PHE 89 . B LYS 83 B PHE 97 ? ;(chain 'B' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 40 or resid 42 through 48 or resid 50 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 97 or resid 103 through 104 or resid 106 through 121 or resid 123 through 128 or resid 130 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 134 through 150)) ; 1 2 8 B ASP 95 . B TYR 96 . B ASP 103 B TYR 104 ? ;(chain 'B' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 40 or resid 42 through 48 or resid 50 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 97 or resid 103 through 104 or resid 106 through 121 or resid 123 through 128 or resid 130 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 134 through 150)) ; 1 2 9 B PRO 98 . B PRO 112 . B PRO 106 B PRO 120 ? ;(chain 'B' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 40 or resid 42 through 48 or resid 50 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 97 or resid 103 through 104 or resid 106 through 121 or resid 123 through 128 or resid 130 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 134 through 150)) ; 1 2 10 B ALA 115 . B GLU 120 . B ALA 123 B GLU 128 ? ;(chain 'B' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 40 or resid 42 through 48 or resid 50 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 97 or resid 103 through 104 or resid 106 through 121 or resid 123 through 128 or resid 130 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 134 through 150)) ; 1 2 11 B VAL 122 . B VAL 122 . B VAL 130 B VAL 130 ? ;(chain 'B' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 40 or resid 42 through 48 or resid 50 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 97 or resid 103 through 104 or resid 106 through 121 or resid 123 through 128 or resid 130 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 134 through 150)) ; 1 2 12 B SER 126 . B ALA 141 . B SER 134 B ALA 149 ? ;(chain 'B' and ((resid 15 through 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 40 or resid 42 through 48 or resid 50 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 81 or resid 83 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 97 or resid 103 through 104 or resid 106 through 121 or resid 123 through 128 or resid 130 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 134 through 150)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7O6S _struct.title 'Crystal structure of a shortened IpgC variant in complex with N-(2H-1,3-benzodioxol-5-ylmethyl)cyclopentanamine' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7O6S _struct_keywords.text 'IpgC, Dimer, Chaperone, Shigella, Mutant, Magnesium, Chlorine, N-(2H-1, 3-benzodioxol-5-ylmethyl)cyclopentanamine' _struct_keywords.pdbx_keywords CHAPERONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 4 ? H N N 2 ? I N N 5 ? J N N 6 ? K N N 4 ? L N N 7 ? M N N 7 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IPGC_SHIFL _struct_ref.pdbx_db_accession P0A2U4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQA ADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQ ; _struct_ref.pdbx_align_begin 10 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7O6S A 2 ? 143 ? P0A2U4 10 ? 151 ? 10 151 2 1 7O6S B 2 ? 143 ? P0A2U4 10 ? 151 ? 10 151 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7O6S GLY A 1 ? UNP P0A2U4 ? ? 'expression tag' 9 1 2 7O6S GLY B 1 ? UNP P0A2U4 ? ? 'expression tag' 9 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3400 ? 1 MORE -38 ? 1 'SSA (A^2)' 14150 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 7 ? GLY A 14 ? VAL A 15 GLY A 22 1 ? 8 HELX_P HELX_P2 AA2 LEU A 17 ? ASN A 21 ? LEU A 25 ASN A 29 5 ? 5 HELX_P HELX_P3 AA3 PRO A 24 ? LYS A 41 ? PRO A 32 LYS A 49 1 ? 18 HELX_P HELX_P4 AA4 ARG A 43 ? ASP A 58 ? ARG A 51 ASP A 66 1 ? 16 HELX_P HELX_P5 AA5 ASN A 61 ? LYS A 75 ? ASN A 69 LYS A 83 1 ? 15 HELX_P HELX_P6 AA6 GLN A 77 ? GLY A 92 ? GLN A 85 GLY A 100 1 ? 16 HELX_P HELX_P7 AA7 TYR A 96 ? LEU A 109 ? TYR A 104 LEU A 117 1 ? 14 HELX_P HELX_P8 AA8 ALA A 111 ? SER A 126 ? ALA A 119 SER A 134 1 ? 16 HELX_P HELX_P9 AA9 ASP A 128 ? ILE A 142 ? ASP A 136 ILE A 150 1 ? 15 HELX_P HELX_P10 AB1 SER B 2 ? SER B 13 ? SER B 10 SER B 21 1 ? 12 HELX_P HELX_P11 AB2 LEU B 17 ? ASN B 21 ? LEU B 25 ASN B 29 5 ? 5 HELX_P HELX_P12 AB3 PRO B 24 ? LYS B 41 ? PRO B 32 LYS B 49 1 ? 18 HELX_P HELX_P13 AB4 ARG B 43 ? ASP B 58 ? ARG B 51 ASP B 66 1 ? 16 HELX_P HELX_P14 AB5 ASN B 61 ? LYS B 75 ? ASN B 69 LYS B 83 1 ? 15 HELX_P HELX_P15 AB6 GLN B 77 ? LYS B 93 ? GLN B 85 LYS B 101 1 ? 17 HELX_P HELX_P16 AB7 TYR B 96 ? LEU B 109 ? TYR B 104 LEU B 117 1 ? 14 HELX_P HELX_P17 AB8 ALA B 111 ? SER B 126 ? ALA B 119 SER B 134 1 ? 16 HELX_P HELX_P18 AB9 ASP B 128 ? ILE B 142 ? ASP B 136 ILE B 150 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? L HOH . O ? ? ? 6_444 I MG . MG ? ? A HOH 388 B MG 202 1_555 ? ? ? ? ? ? ? 2.275 ? ? metalc2 metalc ? ? I MG . MG ? ? ? 1_555 M HOH . O ? ? B MG 202 B HOH 309 1_555 ? ? ? ? ? ? ? 2.129 ? ? metalc3 metalc ? ? I MG . MG ? ? ? 1_555 M HOH . O ? ? B MG 202 B HOH 343 1_555 ? ? ? ? ? ? ? 2.048 ? ? metalc4 metalc ? ? I MG . MG ? ? ? 1_555 M HOH . O ? ? B MG 202 B HOH 359 1_555 ? ? ? ? ? ? ? 2.053 ? ? metalc5 metalc ? ? I MG . MG ? ? ? 1_555 M HOH . O ? ? B MG 202 B HOH 362 1_555 ? ? ? ? ? ? ? 1.896 ? ? metalc6 metalc ? ? I MG . MG ? ? ? 1_555 M HOH . O ? ? B MG 202 B HOH 363 1_555 ? ? ? ? ? ? ? 2.028 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? L HOH . ? A HOH 388 ? 6_444 MG ? I MG . ? B MG 202 ? 1_555 O ? M HOH . ? B HOH 309 ? 1_555 170.6 ? 2 O ? L HOH . ? A HOH 388 ? 6_444 MG ? I MG . ? B MG 202 ? 1_555 O ? M HOH . ? B HOH 343 ? 1_555 97.3 ? 3 O ? M HOH . ? B HOH 309 ? 1_555 MG ? I MG . ? B MG 202 ? 1_555 O ? M HOH . ? B HOH 343 ? 1_555 91.9 ? 4 O ? L HOH . ? A HOH 388 ? 6_444 MG ? I MG . ? B MG 202 ? 1_555 O ? M HOH . ? B HOH 359 ? 1_555 100.0 ? 5 O ? M HOH . ? B HOH 309 ? 1_555 MG ? I MG . ? B MG 202 ? 1_555 O ? M HOH . ? B HOH 359 ? 1_555 82.9 ? 6 O ? M HOH . ? B HOH 343 ? 1_555 MG ? I MG . ? B MG 202 ? 1_555 O ? M HOH . ? B HOH 359 ? 1_555 84.1 ? 7 O ? L HOH . ? A HOH 388 ? 6_444 MG ? I MG . ? B MG 202 ? 1_555 O ? M HOH . ? B HOH 362 ? 1_555 89.7 ? 8 O ? M HOH . ? B HOH 309 ? 1_555 MG ? I MG . ? B MG 202 ? 1_555 O ? M HOH . ? B HOH 362 ? 1_555 81.0 ? 9 O ? M HOH . ? B HOH 343 ? 1_555 MG ? I MG . ? B MG 202 ? 1_555 O ? M HOH . ? B HOH 362 ? 1_555 172.4 ? 10 O ? M HOH . ? B HOH 359 ? 1_555 MG ? I MG . ? B MG 202 ? 1_555 O ? M HOH . ? B HOH 362 ? 1_555 97.5 ? 11 O ? L HOH . ? A HOH 388 ? 6_444 MG ? I MG . ? B MG 202 ? 1_555 O ? M HOH . ? B HOH 363 ? 1_555 81.3 ? 12 O ? M HOH . ? B HOH 309 ? 1_555 MG ? I MG . ? B MG 202 ? 1_555 O ? M HOH . ? B HOH 363 ? 1_555 95.5 ? 13 O ? M HOH . ? B HOH 343 ? 1_555 MG ? I MG . ? B MG 202 ? 1_555 O ? M HOH . ? B HOH 363 ? 1_555 98.3 ? 14 O ? M HOH . ? B HOH 359 ? 1_555 MG ? I MG . ? B MG 202 ? 1_555 O ? M HOH . ? B HOH 363 ? 1_555 177.2 ? 15 O ? M HOH . ? B HOH 362 ? 1_555 MG ? I MG . ? B MG 202 ? 1_555 O ? M HOH . ? B HOH 363 ? 1_555 79.9 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 101 ? A -103.36 78.85 2 1 LYS A 101 ? B 64.66 -38.48 3 1 SER B 21 ? ? 53.41 17.66 4 1 LYS B 101 ? ? 83.54 -42.14 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+2/3 3 -x+y,-x,z+1/3 4 x-y,-y,-z+1/3 5 -x,-x+y,-z+2/3 6 y,x,-z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -38.9936731062 13.7359283285 -1.79210019601 0.214491314104 ? -0.0678046241949 ? 0.0538743671742 ? 0.47063470932 ? -0.0731735953888 ? 0.423638284603 ? 9.00517021459 ? -0.437618739647 ? 4.08737965887 ? 5.66501566349 ? -1.22693187771 ? 5.82000843414 ? -0.0400568902175 ? 0.123287276001 ? -0.91661285631 ? 0.12337350787 ? -0.152454082144 ? 0.337395205878 ? 0.439325705451 ? -1.0780013725 ? 0.127044175891 ? 2 'X-RAY DIFFRACTION' ? refined -34.6735771442 23.2635302614 -5.52469889131 0.44682472594 ? 0.0581366625376 ? -0.025653852971 ? 0.417921626454 ? -0.000464074654005 ? 0.412044091419 ? 9.85604122013 ? 5.50825903139 ? 4.86839072115 ? 3.29541355101 ? 2.86436391907 ? 2.53955792581 ? -0.168848358696 ? -0.192891936882 ? 0.936196826013 ? -0.221166922807 ? -0.0494631994051 ? 0.98438849228 ? -0.686600704552 ? -1.12124810608 ? 0.300750923474 ? 3 'X-RAY DIFFRACTION' ? refined -20.5604859404 24.1331459695 -7.78274403928 0.329900328519 ? -0.0612768472476 ? 0.031247975414 ? 0.231956324731 ? -0.00938228604872 ? 0.180805332523 ? 6.37840408257 ? 0.296398299555 ? 4.96660801866 ? 2.18147228578 ? -0.278177625415 ? 4.77822072475 ? -0.321232537224 ? 0.338374513972 ? -0.0332063592986 ? -0.223709053104 ? 0.142738176954 ? 0.0751462447392 ? -0.311608922075 ? 0.263150440101 ? 0.181688893943 ? 4 'X-RAY DIFFRACTION' ? refined -26.4104040222 13.6997972556 -7.13729551113 0.157269601721 ? -0.042152852311 ? 0.00986295542114 ? 0.124678294281 ? -0.00711766826249 ? 0.121401119386 ? 1.01725078513 ? -1.29346497889 ? -0.430217534216 ? 2.47776154514 ? 1.51631462925 ? 4.61025519434 ? 0.0447289391034 ? 0.0670554507048 ? -0.0571838200134 ? -0.0160423568361 ? -0.0790379927631 ? 0.0973520083272 ? -0.0304762583467 ? -0.203532881662 ? 0.0391247764587 ? 5 'X-RAY DIFFRACTION' ? refined -13.4326417161 12.4963035396 -9.19967533786 0.196648677204 ? -0.0822566055456 ? -0.00365105765372 ? 0.273258518184 ? -0.0229522370076 ? 0.168160494996 ? 7.39316734888 ? 1.75250317454 ? -2.93258928858 ? 3.88854200676 ? -0.5637817181 ? 1.30273897218 ? 0.310520126119 ? -0.952746580953 ? 0.152887513237 ? 0.638404095017 ? -0.258064941267 ? -0.260035657099 ? -0.59790007993 ? 0.429735465139 ? -0.09493116051 ? 6 'X-RAY DIFFRACTION' ? refined -13.8330393888 5.38660670955 -11.5910282453 0.260617455463 ? -0.0632155323682 ? -0.012394333506 ? 0.257216489972 ? 0.035780194168 ? 0.292947903422 ? 6.18807679686 ? -1.42527699565 ? -4.15342650474 ? 3.47956051581 ? 0.797518652502 ? 7.11602775564 ? 0.0069120668569 ? -0.451205363458 ? -0.765406874069 ? 0.139894712476 ? -0.16577685387 ? -0.477918964319 ? -0.0521103609267 ? 0.554396328839 ? 0.170863246709 ? 7 'X-RAY DIFFRACTION' ? refined -19.8228923379 6.19907155892 -19.4355569971 0.196659360437 ? -0.0334586675325 ? 0.00958554450516 ? 0.119247412435 ? -0.0167629510631 ? 0.148586662072 ? 5.69190888375 ? -0.190008725462 ? -0.393443351078 ? 1.68015100137 ? -0.659606533829 ? 1.72950742652 ? 0.098116935008 ? -0.00327278735906 ? 0.0106222926812 ? -0.117617613673 ? -0.0778738871186 ? -0.0769234413921 ? -0.00908427785226 ? 0.0261009106943 ? -0.0190206917042 ? 8 'X-RAY DIFFRACTION' ? refined -18.4799288466 3.50345482206 -28.4260290133 0.265531516607 ? -0.0850319082344 ? 0.0442910071406 ? 0.190557962132 ? -0.0295733863579 ? 0.198873998733 ? 8.21617838748 ? -4.18098817768 ? 5.62907574141 ? 4.9018706113 ? -3.35019899744 ? 7.57336945285 ? -0.0345307243313 ? 0.569253383379 ? -0.514308274443 ? -0.292787133977 ? 0.111875601097 ? -0.072018694173 ? 0.451390903321 ? -0.0376845893581 ? -0.12568216809 ? 9 'X-RAY DIFFRACTION' ? refined -14.9756004813 11.1436798014 -30.9331115922 0.262085151782 ? -0.0818572283917 ? 0.0245559576047 ? 0.283592081014 ? 0.0305491807429 ? 0.249019920481 ? 8.52585752573 ? -5.31599405889 ? 1.69127101311 ? 5.72197314795 ? -1.29517691456 ? 2.76042418147 ? 0.0582166964502 ? 0.687675548633 ? 0.0238415617509 ? -0.274835594541 ? -0.161599716815 ? -0.246435498484 ? -0.102340795899 ? 0.0055935263875 ? 0.117386493177 ? 10 'X-RAY DIFFRACTION' ? refined -25.7490746956 2.33475605986 -4.12416956204 0.341955201691 ? -0.0472591524643 ? 0.0160477228849 ? 0.214881149619 ? 0.0354250397888 ? 0.241695260995 ? 4.36445837706 ? -1.1371629426 ? 0.0433881759204 ? 0.447333284944 ? -0.247368783447 ? 3.04085840784 ? 0.553365689176 ? -0.0834903675098 ? 0.157114564442 ? 0.467561920733 ? -0.400696375638 ? -0.163197164487 ? 0.0517385760745 ? -0.024603688309 ? -0.0836438743038 ? 11 'X-RAY DIFFRACTION' ? refined -15.735947211 -8.99214901794 -2.59444042889 0.239261664793 ? -0.0789505429713 ? -0.017958656114 ? 0.552163234547 ? 0.0408606068472 ? 0.498971404028 ? 2.93261075237 ? 2.05791241575 ? -1.86276407338 ? 2.53905598285 ? -0.0924320779874 ? 3.90064335639 ? -0.0866194424145 ? 0.389372636062 ? -0.09724495935 ? 0.0483531459099 ? -0.23806887642 ? -0.956231285744 ? 0.0549491778261 ? 0.30341844099 ? -0.219594351315 ? 12 'X-RAY DIFFRACTION' ? refined -28.9825966016 -20.7270259041 -9.68659197091 0.307678741771 ? 0.00744131503951 ? 0.0397530938422 ? 0.185297854697 ? -0.0416560773224 ? 0.197659138477 ? 2.795293519 ? 2.79000858919 ? 2.16769626086 ? 4.20183367114 ? 1.19654553187 ? 5.09571320448 ? -0.00845673820753 ? 0.309504882422 ? -0.462744674068 ? -0.182454303793 ? 0.0557762156328 ? -0.285465859185 ? 0.514542710737 ? 0.0721525281236 ? -0.0705053149929 ? 13 'X-RAY DIFFRACTION' ? refined -29.1026594349 -10.7858828524 -6.76622154722 0.17088393785 ? 0.00657158030326 ? 0.0320799762914 ? 0.118231522072 ? -0.0128262370178 ? 0.108979398281 ? 7.95837127214 ? 5.01965547323 ? -0.362907672861 ? 7.85359449137 ? -1.0536869339 ? 7.29900435381 ? -0.0458490334767 ? 0.167418280655 ? 0.0796070816299 ? -0.00445367280398 ? 0.043448508411 ? 0.0889223382985 ? 0.151323294385 ? -0.0512284758795 ? 0.000515688886383 ? 14 'X-RAY DIFFRACTION' ? refined -33.6928211315 -6.68678943401 -16.0782011197 0.164705033635 ? -0.012468149977 ? 0.0214627750833 ? 0.17322450281 ? -0.0216683128151 ? 0.130829486671 ? 3.12662332636 ? -1.11058005281 ? 3.67626356035 ? 5.11926563794 ? -1.80412869799 ? 5.10000917037 ? 0.0768171930376 ? -0.0364628654652 ? 0.00839637185499 ? -0.00553850691034 ? -0.0292528134917 ? 0.225336712827 ? 0.181644753316 ? -0.0531879499653 ? -0.0350037257178 ? 15 'X-RAY DIFFRACTION' ? refined -22.850700148 -5.47334996469 -24.5578508596 0.343871103965 ? 0.0286203847587 ? 0.0188230260291 ? 0.566074990159 ? -0.0158593363095 ? 0.4495176962 ? 6.73326099124 ? 4.65683006679 ? 5.60800312917 ? 3.85098958295 ? 4.23615476632 ? 4.87437685479 ? -0.217558071654 ? 0.0377113367862 ? -1.1821708347 ? -0.2231025733 ? 1.25990512884 ? -1.2385511538 ? 0.322910418843 ? 2.01213517337 ? -0.994187772737 ? 16 'X-RAY DIFFRACTION' ? refined -38.2983291098 -2.67443987919 -25.8714040374 0.270475307308 ? -0.0236308576747 ? -0.0190608088672 ? 0.174674954211 ? 0.0081961925149 ? 0.213664438864 ? 6.7798956789 ? -3.04486692678 ? -5.39258691055 ? 3.35214983915 ? 2.19359337257 ? 8.09497795775 ? 0.22435019636 ? 0.0211793611528 ? 0.277048496028 ? -0.276056353597 ? 0.0785205598089 ? 0.157885596227 ? -0.382162105165 ? -0.336539371294 ? -0.268360559859 ? 17 'X-RAY DIFFRACTION' ? refined -31.9978584494 -1.79694962941 -33.8862539213 0.327850212405 ? 0.0208202321254 ? 0.0519964518207 ? 0.263026386833 ? 0.0677402883024 ? 0.247716663812 ? 6.91802686359 ? 4.80155469632 ? 0.0278754651059 ? 3.65819178407 ? -1.18473367282 ? 4.4892803007 ? 0.356589019439 ? 0.810408084189 ? 0.918319086915 ? -0.0419165609473 ? 0.143791733751 ? 0.247737066164 ? -0.797389622833 ? -0.230810012577 ? -0.392509072496 ? 18 'X-RAY DIFFRACTION' ? refined -36.7085194084 -8.5825655902 -35.7974331096 0.268348303084 ? -0.0149325840482 ? -0.0179619549459 ? 0.36651450713 ? -0.0381860311113 ? 0.200207188751 ? 7.84993258063 ? -5.1388254811 ? -3.47104285558 ? 8.65195888287 ? 2.51378202703 ? 8.72446955567 ? 0.415516018467 ? 0.445532200222 ? -0.571172741231 ? -0.176883875462 ? -0.513352645296 ? 0.364576927828 ? 0.253688958976 ? -0.898307641717 ? 0.145845493033 ? 19 'X-RAY DIFFRACTION' ? refined -37.9409008313 4.17849359625 3.63526750949 0.827981319344 ? -0.0744357233503 ? -0.173829488995 ? 0.336216390432 ? 0.139244744397 ? 1.03116793739 ? 2.21449357886 ? 1.20533611839 ? -0.712933210742 ? 8.04416032931 ? 3.45345592163 ? 3.8755179079 ? 0.0866131355611 ? 0.337025791866 ? -0.821462463307 ? -0.888745210593 ? 0.857651655225 ? 2.24188159225 ? 0.814563334448 ? -0.754697171357 ? -0.594911805069 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 24 through 32 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 33 through 39 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 40 through 53 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 54 through 78 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 79 through 85 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 86 through 89 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 90 through 121 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 122 through 134 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 135 through 151 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 9 through 22 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 23 through 33 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 34 through 51 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 52 through 68 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 69 through 98 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 99 through 103 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 104 through 124 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 125 through 134 ) ; 18 'X-RAY DIFFRACTION' 18 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 135 through 150 ) ; 19 'X-RAY DIFFRACTION' 19 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 15 through 23 ) ; # _pdbx_entry_details.entry_id 7O6S _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 9 ? A GLY 1 2 1 Y 1 A SER 10 ? A SER 2 3 1 Y 1 A ILE 11 ? A ILE 3 4 1 Y 1 A SER 12 ? A SER 4 5 1 Y 1 A THR 13 ? A THR 5 6 1 Y 1 A ALA 14 ? A ALA 6 7 1 Y 1 B GLN 151 ? B GLN 143 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 45N C4 C Y N 1 45N C5 C Y N 2 45N C6 C N N 3 45N C7 C N N 4 45N C8 C N N 5 45N C9 C N N 6 45N C10 C N N 7 45N C11 C N N 8 45N C12 C N N 9 45N O1 O N N 10 45N C2 C Y N 11 45N C1 C Y N 12 45N O O N N 13 45N C3 C Y N 14 45N C C Y N 15 45N N N N N 16 45N H1 H N N 17 45N H2 H N N 18 45N H3 H N N 19 45N H4 H N N 20 45N H5 H N N 21 45N H6 H N N 22 45N H7 H N N 23 45N H8 H N N 24 45N H9 H N N 25 45N H10 H N N 26 45N H11 H N N 27 45N H12 H N N 28 45N H13 H N N 29 45N H14 H N N 30 45N H15 H N N 31 45N H16 H N N 32 45N H17 H N N 33 ALA N N N N 34 ALA CA C N S 35 ALA C C N N 36 ALA O O N N 37 ALA CB C N N 38 ALA OXT O N N 39 ALA H H N N 40 ALA H2 H N N 41 ALA HA H N N 42 ALA HB1 H N N 43 ALA HB2 H N N 44 ALA HB3 H N N 45 ALA HXT H N N 46 ARG N N N N 47 ARG CA C N S 48 ARG C C N N 49 ARG O O N N 50 ARG CB C N N 51 ARG CG C N N 52 ARG CD C N N 53 ARG NE N N N 54 ARG CZ C N N 55 ARG NH1 N N N 56 ARG NH2 N N N 57 ARG OXT O N N 58 ARG H H N N 59 ARG H2 H N N 60 ARG HA H N N 61 ARG HB2 H N N 62 ARG HB3 H N N 63 ARG HG2 H N N 64 ARG HG3 H N N 65 ARG HD2 H N N 66 ARG HD3 H N N 67 ARG HE H N N 68 ARG HH11 H N N 69 ARG HH12 H N N 70 ARG HH21 H N N 71 ARG HH22 H N N 72 ARG HXT H N N 73 ASN N N N N 74 ASN CA C N S 75 ASN C C N N 76 ASN O O N N 77 ASN CB C N N 78 ASN CG C N N 79 ASN OD1 O N N 80 ASN ND2 N N N 81 ASN OXT O N N 82 ASN H H N N 83 ASN H2 H N N 84 ASN HA H N N 85 ASN HB2 H N N 86 ASN HB3 H N N 87 ASN HD21 H N N 88 ASN HD22 H N N 89 ASN HXT H N N 90 ASP N N N N 91 ASP CA C N S 92 ASP C C N N 93 ASP O O N N 94 ASP CB C N N 95 ASP CG C N N 96 ASP OD1 O N N 97 ASP OD2 O N N 98 ASP OXT O N N 99 ASP H H N N 100 ASP H2 H N N 101 ASP HA H N N 102 ASP HB2 H N N 103 ASP HB3 H N N 104 ASP HD2 H N N 105 ASP HXT H N N 106 CL CL CL N N 107 CYS N N N N 108 CYS CA C N R 109 CYS C C N N 110 CYS O O N N 111 CYS CB C N N 112 CYS SG S N N 113 CYS OXT O N N 114 CYS H H N N 115 CYS H2 H N N 116 CYS HA H N N 117 CYS HB2 H N N 118 CYS HB3 H N N 119 CYS HG H N N 120 CYS HXT H N N 121 DMS S S N N 122 DMS O O N N 123 DMS C1 C N N 124 DMS C2 C N N 125 DMS H11 H N N 126 DMS H12 H N N 127 DMS H13 H N N 128 DMS H21 H N N 129 DMS H22 H N N 130 DMS H23 H N N 131 GLN N N N N 132 GLN CA C N S 133 GLN C C N N 134 GLN O O N N 135 GLN CB C N N 136 GLN CG C N N 137 GLN CD C N N 138 GLN OE1 O N N 139 GLN NE2 N N N 140 GLN OXT O N N 141 GLN H H N N 142 GLN H2 H N N 143 GLN HA H N N 144 GLN HB2 H N N 145 GLN HB3 H N N 146 GLN HG2 H N N 147 GLN HG3 H N N 148 GLN HE21 H N N 149 GLN HE22 H N N 150 GLN HXT H N N 151 GLU N N N N 152 GLU CA C N S 153 GLU C C N N 154 GLU O O N N 155 GLU CB C N N 156 GLU CG C N N 157 GLU CD C N N 158 GLU OE1 O N N 159 GLU OE2 O N N 160 GLU OXT O N N 161 GLU H H N N 162 GLU H2 H N N 163 GLU HA H N N 164 GLU HB2 H N N 165 GLU HB3 H N N 166 GLU HG2 H N N 167 GLU HG3 H N N 168 GLU HE2 H N N 169 GLU HXT H N N 170 GLY N N N N 171 GLY CA C N N 172 GLY C C N N 173 GLY O O N N 174 GLY OXT O N N 175 GLY H H N N 176 GLY H2 H N N 177 GLY HA2 H N N 178 GLY HA3 H N N 179 GLY HXT H N N 180 HIS N N N N 181 HIS CA C N S 182 HIS C C N N 183 HIS O O N N 184 HIS CB C N N 185 HIS CG C Y N 186 HIS ND1 N Y N 187 HIS CD2 C Y N 188 HIS CE1 C Y N 189 HIS NE2 N Y N 190 HIS OXT O N N 191 HIS H H N N 192 HIS H2 H N N 193 HIS HA H N N 194 HIS HB2 H N N 195 HIS HB3 H N N 196 HIS HD1 H N N 197 HIS HD2 H N N 198 HIS HE1 H N N 199 HIS HE2 H N N 200 HIS HXT H N N 201 HOH O O N N 202 HOH H1 H N N 203 HOH H2 H N N 204 ILE N N N N 205 ILE CA C N S 206 ILE C C N N 207 ILE O O N N 208 ILE CB C N S 209 ILE CG1 C N N 210 ILE CG2 C N N 211 ILE CD1 C N N 212 ILE OXT O N N 213 ILE H H N N 214 ILE H2 H N N 215 ILE HA H N N 216 ILE HB H N N 217 ILE HG12 H N N 218 ILE HG13 H N N 219 ILE HG21 H N N 220 ILE HG22 H N N 221 ILE HG23 H N N 222 ILE HD11 H N N 223 ILE HD12 H N N 224 ILE HD13 H N N 225 ILE HXT H N N 226 LEU N N N N 227 LEU CA C N S 228 LEU C C N N 229 LEU O O N N 230 LEU CB C N N 231 LEU CG C N N 232 LEU CD1 C N N 233 LEU CD2 C N N 234 LEU OXT O N N 235 LEU H H N N 236 LEU H2 H N N 237 LEU HA H N N 238 LEU HB2 H N N 239 LEU HB3 H N N 240 LEU HG H N N 241 LEU HD11 H N N 242 LEU HD12 H N N 243 LEU HD13 H N N 244 LEU HD21 H N N 245 LEU HD22 H N N 246 LEU HD23 H N N 247 LEU HXT H N N 248 LYS N N N N 249 LYS CA C N S 250 LYS C C N N 251 LYS O O N N 252 LYS CB C N N 253 LYS CG C N N 254 LYS CD C N N 255 LYS CE C N N 256 LYS NZ N N N 257 LYS OXT O N N 258 LYS H H N N 259 LYS H2 H N N 260 LYS HA H N N 261 LYS HB2 H N N 262 LYS HB3 H N N 263 LYS HG2 H N N 264 LYS HG3 H N N 265 LYS HD2 H N N 266 LYS HD3 H N N 267 LYS HE2 H N N 268 LYS HE3 H N N 269 LYS HZ1 H N N 270 LYS HZ2 H N N 271 LYS HZ3 H N N 272 LYS HXT H N N 273 MET N N N N 274 MET CA C N S 275 MET C C N N 276 MET O O N N 277 MET CB C N N 278 MET CG C N N 279 MET SD S N N 280 MET CE C N N 281 MET OXT O N N 282 MET H H N N 283 MET H2 H N N 284 MET HA H N N 285 MET HB2 H N N 286 MET HB3 H N N 287 MET HG2 H N N 288 MET HG3 H N N 289 MET HE1 H N N 290 MET HE2 H N N 291 MET HE3 H N N 292 MET HXT H N N 293 MG MG MG N N 294 PEG C1 C N N 295 PEG O1 O N N 296 PEG C2 C N N 297 PEG O2 O N N 298 PEG C3 C N N 299 PEG C4 C N N 300 PEG O4 O N N 301 PEG H11 H N N 302 PEG H12 H N N 303 PEG HO1 H N N 304 PEG H21 H N N 305 PEG H22 H N N 306 PEG H31 H N N 307 PEG H32 H N N 308 PEG H41 H N N 309 PEG H42 H N N 310 PEG HO4 H N N 311 PHE N N N N 312 PHE CA C N S 313 PHE C C N N 314 PHE O O N N 315 PHE CB C N N 316 PHE CG C Y N 317 PHE CD1 C Y N 318 PHE CD2 C Y N 319 PHE CE1 C Y N 320 PHE CE2 C Y N 321 PHE CZ C Y N 322 PHE OXT O N N 323 PHE H H N N 324 PHE H2 H N N 325 PHE HA H N N 326 PHE HB2 H N N 327 PHE HB3 H N N 328 PHE HD1 H N N 329 PHE HD2 H N N 330 PHE HE1 H N N 331 PHE HE2 H N N 332 PHE HZ H N N 333 PHE HXT H N N 334 PRO N N N N 335 PRO CA C N S 336 PRO C C N N 337 PRO O O N N 338 PRO CB C N N 339 PRO CG C N N 340 PRO CD C N N 341 PRO OXT O N N 342 PRO H H N N 343 PRO HA H N N 344 PRO HB2 H N N 345 PRO HB3 H N N 346 PRO HG2 H N N 347 PRO HG3 H N N 348 PRO HD2 H N N 349 PRO HD3 H N N 350 PRO HXT H N N 351 SER N N N N 352 SER CA C N S 353 SER C C N N 354 SER O O N N 355 SER CB C N N 356 SER OG O N N 357 SER OXT O N N 358 SER H H N N 359 SER H2 H N N 360 SER HA H N N 361 SER HB2 H N N 362 SER HB3 H N N 363 SER HG H N N 364 SER HXT H N N 365 THR N N N N 366 THR CA C N S 367 THR C C N N 368 THR O O N N 369 THR CB C N R 370 THR OG1 O N N 371 THR CG2 C N N 372 THR OXT O N N 373 THR H H N N 374 THR H2 H N N 375 THR HA H N N 376 THR HB H N N 377 THR HG1 H N N 378 THR HG21 H N N 379 THR HG22 H N N 380 THR HG23 H N N 381 THR HXT H N N 382 TYR N N N N 383 TYR CA C N S 384 TYR C C N N 385 TYR O O N N 386 TYR CB C N N 387 TYR CG C Y N 388 TYR CD1 C Y N 389 TYR CD2 C Y N 390 TYR CE1 C Y N 391 TYR CE2 C Y N 392 TYR CZ C Y N 393 TYR OH O N N 394 TYR OXT O N N 395 TYR H H N N 396 TYR H2 H N N 397 TYR HA H N N 398 TYR HB2 H N N 399 TYR HB3 H N N 400 TYR HD1 H N N 401 TYR HD2 H N N 402 TYR HE1 H N N 403 TYR HE2 H N N 404 TYR HH H N N 405 TYR HXT H N N 406 VAL N N N N 407 VAL CA C N S 408 VAL C C N N 409 VAL O O N N 410 VAL CB C N N 411 VAL CG1 C N N 412 VAL CG2 C N N 413 VAL OXT O N N 414 VAL H H N N 415 VAL H2 H N N 416 VAL HA H N N 417 VAL HB H N N 418 VAL HG11 H N N 419 VAL HG12 H N N 420 VAL HG13 H N N 421 VAL HG21 H N N 422 VAL HG22 H N N 423 VAL HG23 H N N 424 VAL HXT H N N 425 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 45N C9 C10 sing N N 1 45N C9 C8 sing N N 2 45N C10 C11 sing N N 3 45N C8 C7 sing N N 4 45N C11 C7 sing N N 5 45N C7 N sing N N 6 45N N C6 sing N N 7 45N O C12 sing N N 8 45N O C3 sing N N 9 45N C12 O1 sing N N 10 45N C3 C4 sing Y N 11 45N C3 C2 doub Y N 12 45N C4 C5 doub Y N 13 45N O1 C2 sing N N 14 45N C2 C1 sing Y N 15 45N C6 C5 sing N N 16 45N C5 C sing Y N 17 45N C1 C doub Y N 18 45N C4 H1 sing N N 19 45N C6 H2 sing N N 20 45N C6 H3 sing N N 21 45N C7 H4 sing N N 22 45N C8 H5 sing N N 23 45N C8 H6 sing N N 24 45N C9 H7 sing N N 25 45N C9 H8 sing N N 26 45N C10 H9 sing N N 27 45N C10 H10 sing N N 28 45N C11 H11 sing N N 29 45N C11 H12 sing N N 30 45N C12 H13 sing N N 31 45N C12 H14 sing N N 32 45N C1 H15 sing N N 33 45N C H16 sing N N 34 45N N H17 sing N N 35 ALA N CA sing N N 36 ALA N H sing N N 37 ALA N H2 sing N N 38 ALA CA C sing N N 39 ALA CA CB sing N N 40 ALA CA HA sing N N 41 ALA C O doub N N 42 ALA C OXT sing N N 43 ALA CB HB1 sing N N 44 ALA CB HB2 sing N N 45 ALA CB HB3 sing N N 46 ALA OXT HXT sing N N 47 ARG N CA sing N N 48 ARG N H sing N N 49 ARG N H2 sing N N 50 ARG CA C sing N N 51 ARG CA CB sing N N 52 ARG CA HA sing N N 53 ARG C O doub N N 54 ARG C OXT sing N N 55 ARG CB CG sing N N 56 ARG CB HB2 sing N N 57 ARG CB HB3 sing N N 58 ARG CG CD sing N N 59 ARG CG HG2 sing N N 60 ARG CG HG3 sing N N 61 ARG CD NE sing N N 62 ARG CD HD2 sing N N 63 ARG CD HD3 sing N N 64 ARG NE CZ sing N N 65 ARG NE HE sing N N 66 ARG CZ NH1 sing N N 67 ARG CZ NH2 doub N N 68 ARG NH1 HH11 sing N N 69 ARG NH1 HH12 sing N N 70 ARG NH2 HH21 sing N N 71 ARG NH2 HH22 sing N N 72 ARG OXT HXT sing N N 73 ASN N CA sing N N 74 ASN N H sing N N 75 ASN N H2 sing N N 76 ASN CA C sing N N 77 ASN CA CB sing N N 78 ASN CA HA sing N N 79 ASN C O doub N N 80 ASN C OXT sing N N 81 ASN CB CG sing N N 82 ASN CB HB2 sing N N 83 ASN CB HB3 sing N N 84 ASN CG OD1 doub N N 85 ASN CG ND2 sing N N 86 ASN ND2 HD21 sing N N 87 ASN ND2 HD22 sing N N 88 ASN OXT HXT sing N N 89 ASP N CA sing N N 90 ASP N H sing N N 91 ASP N H2 sing N N 92 ASP CA C sing N N 93 ASP CA CB sing N N 94 ASP CA HA sing N N 95 ASP C O doub N N 96 ASP C OXT sing N N 97 ASP CB CG sing N N 98 ASP CB HB2 sing N N 99 ASP CB HB3 sing N N 100 ASP CG OD1 doub N N 101 ASP CG OD2 sing N N 102 ASP OD2 HD2 sing N N 103 ASP OXT HXT sing N N 104 CYS N CA sing N N 105 CYS N H sing N N 106 CYS N H2 sing N N 107 CYS CA C sing N N 108 CYS CA CB sing N N 109 CYS CA HA sing N N 110 CYS C O doub N N 111 CYS C OXT sing N N 112 CYS CB SG sing N N 113 CYS CB HB2 sing N N 114 CYS CB HB3 sing N N 115 CYS SG HG sing N N 116 CYS OXT HXT sing N N 117 DMS S O doub N N 118 DMS S C1 sing N N 119 DMS S C2 sing N N 120 DMS C1 H11 sing N N 121 DMS C1 H12 sing N N 122 DMS C1 H13 sing N N 123 DMS C2 H21 sing N N 124 DMS C2 H22 sing N N 125 DMS C2 H23 sing N N 126 GLN N CA sing N N 127 GLN N H sing N N 128 GLN N H2 sing N N 129 GLN CA C sing N N 130 GLN CA CB sing N N 131 GLN CA HA sing N N 132 GLN C O doub N N 133 GLN C OXT sing N N 134 GLN CB CG sing N N 135 GLN CB HB2 sing N N 136 GLN CB HB3 sing N N 137 GLN CG CD sing N N 138 GLN CG HG2 sing N N 139 GLN CG HG3 sing N N 140 GLN CD OE1 doub N N 141 GLN CD NE2 sing N N 142 GLN NE2 HE21 sing N N 143 GLN NE2 HE22 sing N N 144 GLN OXT HXT sing N N 145 GLU N CA sing N N 146 GLU N H sing N N 147 GLU N H2 sing N N 148 GLU CA C sing N N 149 GLU CA CB sing N N 150 GLU CA HA sing N N 151 GLU C O doub N N 152 GLU C OXT sing N N 153 GLU CB CG sing N N 154 GLU CB HB2 sing N N 155 GLU CB HB3 sing N N 156 GLU CG CD sing N N 157 GLU CG HG2 sing N N 158 GLU CG HG3 sing N N 159 GLU CD OE1 doub N N 160 GLU CD OE2 sing N N 161 GLU OE2 HE2 sing N N 162 GLU OXT HXT sing N N 163 GLY N CA sing N N 164 GLY N H sing N N 165 GLY N H2 sing N N 166 GLY CA C sing N N 167 GLY CA HA2 sing N N 168 GLY CA HA3 sing N N 169 GLY C O doub N N 170 GLY C OXT sing N N 171 GLY OXT HXT sing N N 172 HIS N CA sing N N 173 HIS N H sing N N 174 HIS N H2 sing N N 175 HIS CA C sing N N 176 HIS CA CB sing N N 177 HIS CA HA sing N N 178 HIS C O doub N N 179 HIS C OXT sing N N 180 HIS CB CG sing N N 181 HIS CB HB2 sing N N 182 HIS CB HB3 sing N N 183 HIS CG ND1 sing Y N 184 HIS CG CD2 doub Y N 185 HIS ND1 CE1 doub Y N 186 HIS ND1 HD1 sing N N 187 HIS CD2 NE2 sing Y N 188 HIS CD2 HD2 sing N N 189 HIS CE1 NE2 sing Y N 190 HIS CE1 HE1 sing N N 191 HIS NE2 HE2 sing N N 192 HIS OXT HXT sing N N 193 HOH O H1 sing N N 194 HOH O H2 sing N N 195 ILE N CA sing N N 196 ILE N H sing N N 197 ILE N H2 sing N N 198 ILE CA C sing N N 199 ILE CA CB sing N N 200 ILE CA HA sing N N 201 ILE C O doub N N 202 ILE C OXT sing N N 203 ILE CB CG1 sing N N 204 ILE CB CG2 sing N N 205 ILE CB HB sing N N 206 ILE CG1 CD1 sing N N 207 ILE CG1 HG12 sing N N 208 ILE CG1 HG13 sing N N 209 ILE CG2 HG21 sing N N 210 ILE CG2 HG22 sing N N 211 ILE CG2 HG23 sing N N 212 ILE CD1 HD11 sing N N 213 ILE CD1 HD12 sing N N 214 ILE CD1 HD13 sing N N 215 ILE OXT HXT sing N N 216 LEU N CA sing N N 217 LEU N H sing N N 218 LEU N H2 sing N N 219 LEU CA C sing N N 220 LEU CA CB sing N N 221 LEU CA HA sing N N 222 LEU C O doub N N 223 LEU C OXT sing N N 224 LEU CB CG sing N N 225 LEU CB HB2 sing N N 226 LEU CB HB3 sing N N 227 LEU CG CD1 sing N N 228 LEU CG CD2 sing N N 229 LEU CG HG sing N N 230 LEU CD1 HD11 sing N N 231 LEU CD1 HD12 sing N N 232 LEU CD1 HD13 sing N N 233 LEU CD2 HD21 sing N N 234 LEU CD2 HD22 sing N N 235 LEU CD2 HD23 sing N N 236 LEU OXT HXT sing N N 237 LYS N CA sing N N 238 LYS N H sing N N 239 LYS N H2 sing N N 240 LYS CA C sing N N 241 LYS CA CB sing N N 242 LYS CA HA sing N N 243 LYS C O doub N N 244 LYS C OXT sing N N 245 LYS CB CG sing N N 246 LYS CB HB2 sing N N 247 LYS CB HB3 sing N N 248 LYS CG CD sing N N 249 LYS CG HG2 sing N N 250 LYS CG HG3 sing N N 251 LYS CD CE sing N N 252 LYS CD HD2 sing N N 253 LYS CD HD3 sing N N 254 LYS CE NZ sing N N 255 LYS CE HE2 sing N N 256 LYS CE HE3 sing N N 257 LYS NZ HZ1 sing N N 258 LYS NZ HZ2 sing N N 259 LYS NZ HZ3 sing N N 260 LYS OXT HXT sing N N 261 MET N CA sing N N 262 MET N H sing N N 263 MET N H2 sing N N 264 MET CA C sing N N 265 MET CA CB sing N N 266 MET CA HA sing N N 267 MET C O doub N N 268 MET C OXT sing N N 269 MET CB CG sing N N 270 MET CB HB2 sing N N 271 MET CB HB3 sing N N 272 MET CG SD sing N N 273 MET CG HG2 sing N N 274 MET CG HG3 sing N N 275 MET SD CE sing N N 276 MET CE HE1 sing N N 277 MET CE HE2 sing N N 278 MET CE HE3 sing N N 279 MET OXT HXT sing N N 280 PEG C1 O1 sing N N 281 PEG C1 C2 sing N N 282 PEG C1 H11 sing N N 283 PEG C1 H12 sing N N 284 PEG O1 HO1 sing N N 285 PEG C2 O2 sing N N 286 PEG C2 H21 sing N N 287 PEG C2 H22 sing N N 288 PEG O2 C3 sing N N 289 PEG C3 C4 sing N N 290 PEG C3 H31 sing N N 291 PEG C3 H32 sing N N 292 PEG C4 O4 sing N N 293 PEG C4 H41 sing N N 294 PEG C4 H42 sing N N 295 PEG O4 HO4 sing N N 296 PHE N CA sing N N 297 PHE N H sing N N 298 PHE N H2 sing N N 299 PHE CA C sing N N 300 PHE CA CB sing N N 301 PHE CA HA sing N N 302 PHE C O doub N N 303 PHE C OXT sing N N 304 PHE CB CG sing N N 305 PHE CB HB2 sing N N 306 PHE CB HB3 sing N N 307 PHE CG CD1 doub Y N 308 PHE CG CD2 sing Y N 309 PHE CD1 CE1 sing Y N 310 PHE CD1 HD1 sing N N 311 PHE CD2 CE2 doub Y N 312 PHE CD2 HD2 sing N N 313 PHE CE1 CZ doub Y N 314 PHE CE1 HE1 sing N N 315 PHE CE2 CZ sing Y N 316 PHE CE2 HE2 sing N N 317 PHE CZ HZ sing N N 318 PHE OXT HXT sing N N 319 PRO N CA sing N N 320 PRO N CD sing N N 321 PRO N H sing N N 322 PRO CA C sing N N 323 PRO CA CB sing N N 324 PRO CA HA sing N N 325 PRO C O doub N N 326 PRO C OXT sing N N 327 PRO CB CG sing N N 328 PRO CB HB2 sing N N 329 PRO CB HB3 sing N N 330 PRO CG CD sing N N 331 PRO CG HG2 sing N N 332 PRO CG HG3 sing N N 333 PRO CD HD2 sing N N 334 PRO CD HD3 sing N N 335 PRO OXT HXT sing N N 336 SER N CA sing N N 337 SER N H sing N N 338 SER N H2 sing N N 339 SER CA C sing N N 340 SER CA CB sing N N 341 SER CA HA sing N N 342 SER C O doub N N 343 SER C OXT sing N N 344 SER CB OG sing N N 345 SER CB HB2 sing N N 346 SER CB HB3 sing N N 347 SER OG HG sing N N 348 SER OXT HXT sing N N 349 THR N CA sing N N 350 THR N H sing N N 351 THR N H2 sing N N 352 THR CA C sing N N 353 THR CA CB sing N N 354 THR CA HA sing N N 355 THR C O doub N N 356 THR C OXT sing N N 357 THR CB OG1 sing N N 358 THR CB CG2 sing N N 359 THR CB HB sing N N 360 THR OG1 HG1 sing N N 361 THR CG2 HG21 sing N N 362 THR CG2 HG22 sing N N 363 THR CG2 HG23 sing N N 364 THR OXT HXT sing N N 365 TYR N CA sing N N 366 TYR N H sing N N 367 TYR N H2 sing N N 368 TYR CA C sing N N 369 TYR CA CB sing N N 370 TYR CA HA sing N N 371 TYR C O doub N N 372 TYR C OXT sing N N 373 TYR CB CG sing N N 374 TYR CB HB2 sing N N 375 TYR CB HB3 sing N N 376 TYR CG CD1 doub Y N 377 TYR CG CD2 sing Y N 378 TYR CD1 CE1 sing Y N 379 TYR CD1 HD1 sing N N 380 TYR CD2 CE2 doub Y N 381 TYR CD2 HD2 sing N N 382 TYR CE1 CZ doub Y N 383 TYR CE1 HE1 sing N N 384 TYR CE2 CZ sing Y N 385 TYR CE2 HE2 sing N N 386 TYR CZ OH sing N N 387 TYR OH HH sing N N 388 TYR OXT HXT sing N N 389 VAL N CA sing N N 390 VAL N H sing N N 391 VAL N H2 sing N N 392 VAL CA C sing N N 393 VAL CA CB sing N N 394 VAL CA HA sing N N 395 VAL C O doub N N 396 VAL C OXT sing N N 397 VAL CB CG1 sing N N 398 VAL CB CG2 sing N N 399 VAL CB HB sing N N 400 VAL CG1 HG11 sing N N 401 VAL CG1 HG12 sing N N 402 VAL CG1 HG13 sing N N 403 VAL CG2 HG21 sing N N 404 VAL CG2 HG22 sing N N 405 VAL CG2 HG23 sing N N 406 VAL OXT HXT sing N N 407 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 45N _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 45N _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6SCB _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 32 2 1' _space_group.name_Hall ;P 32 2" ; _space_group.IT_number 154 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 7O6S _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017352 _atom_sites.fract_transf_matrix[1][2] 0.010018 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020036 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006282 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? ? ? ? ? ? ? ? ? ? ? ? MG ? ? 9.41153 2.53737 ? ? 2.59044 63.03566 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_