data_7VWA # _entry.id 7VWA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7VWA pdb_00007vwa 10.2210/pdb7vwa/pdb WWPDB D_1300025531 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 7VW9 _pdbx_database_related.content_type re-refinement # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7VWA _pdbx_database_status.recvd_initial_deposition_date 2021-11-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zheng, J.' 1 0000-0002-9239-3686 'Chen, Z.' 2 0000-0003-1319-9664 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Int J Mol Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1422-0067 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 23 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural Insights into the Ligand-Binding and -Releasing Mechanism of Helicoverpa armigera Pheromone-Binding Protein PBP1.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/ijms23031190 _citation.pdbx_database_id_PubMed 35163109 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zheng, J.' 1 ? primary 'Yang, M.' 2 ? primary 'Dong, K.' 3 ? primary 'Zhang, J.' 4 ? primary 'Wang, H.' 5 ? primary 'Xie, M.' 6 ? primary 'Wu, W.' 7 ? primary 'Zhang, Y.J.' 8 ? primary 'Chen, Z.' 9 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 98.79 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7VWA _cell.details ? _cell.formula_units_Z ? _cell.length_a 32.907 _cell.length_a_esd ? _cell.length_b 33.356 _cell.length_b_esd ? _cell.length_c 56.044 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7VWA _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man PBP1 16384.785 1 ? ? ? ? 2 non-polymer syn '(Z)-hexadec-9-enal' 238.409 1 ? ? ? ? 3 water nat water 18.015 40 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMASQDVIKNLSMNFAKPLEDCKKEMDLPDSVTTDFYNFWKEGYEFTNRQTGCAILCLSSKLELLDQELKLHHGKAQEF AKKHGADDAMAKQLVDLIHGCAQSTPDVADDPCMKTLNVAKCFKAKIHELNWAPSMELVVGEVLAEV ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMASQDVIKNLSMNFAKPLEDCKKEMDLPDSVTTDFYNFWKEGYEFTNRQTGCAILCLSSKLELLDQELKLHHGKAQEF AKKHGADDAMAKQLVDLIHGCAQSTPDVADDPCMKTLNVAKCFKAKIHELNWAPSMELVVGEVLAEV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 ALA n 1 5 SER n 1 6 GLN n 1 7 ASP n 1 8 VAL n 1 9 ILE n 1 10 LYS n 1 11 ASN n 1 12 LEU n 1 13 SER n 1 14 MET n 1 15 ASN n 1 16 PHE n 1 17 ALA n 1 18 LYS n 1 19 PRO n 1 20 LEU n 1 21 GLU n 1 22 ASP n 1 23 CYS n 1 24 LYS n 1 25 LYS n 1 26 GLU n 1 27 MET n 1 28 ASP n 1 29 LEU n 1 30 PRO n 1 31 ASP n 1 32 SER n 1 33 VAL n 1 34 THR n 1 35 THR n 1 36 ASP n 1 37 PHE n 1 38 TYR n 1 39 ASN n 1 40 PHE n 1 41 TRP n 1 42 LYS n 1 43 GLU n 1 44 GLY n 1 45 TYR n 1 46 GLU n 1 47 PHE n 1 48 THR n 1 49 ASN n 1 50 ARG n 1 51 GLN n 1 52 THR n 1 53 GLY n 1 54 CYS n 1 55 ALA n 1 56 ILE n 1 57 LEU n 1 58 CYS n 1 59 LEU n 1 60 SER n 1 61 SER n 1 62 LYS n 1 63 LEU n 1 64 GLU n 1 65 LEU n 1 66 LEU n 1 67 ASP n 1 68 GLN n 1 69 GLU n 1 70 LEU n 1 71 LYS n 1 72 LEU n 1 73 HIS n 1 74 HIS n 1 75 GLY n 1 76 LYS n 1 77 ALA n 1 78 GLN n 1 79 GLU n 1 80 PHE n 1 81 ALA n 1 82 LYS n 1 83 LYS n 1 84 HIS n 1 85 GLY n 1 86 ALA n 1 87 ASP n 1 88 ASP n 1 89 ALA n 1 90 MET n 1 91 ALA n 1 92 LYS n 1 93 GLN n 1 94 LEU n 1 95 VAL n 1 96 ASP n 1 97 LEU n 1 98 ILE n 1 99 HIS n 1 100 GLY n 1 101 CYS n 1 102 ALA n 1 103 GLN n 1 104 SER n 1 105 THR n 1 106 PRO n 1 107 ASP n 1 108 VAL n 1 109 ALA n 1 110 ASP n 1 111 ASP n 1 112 PRO n 1 113 CYS n 1 114 MET n 1 115 LYS n 1 116 THR n 1 117 LEU n 1 118 ASN n 1 119 VAL n 1 120 ALA n 1 121 LYS n 1 122 CYS n 1 123 PHE n 1 124 LYS n 1 125 ALA n 1 126 LYS n 1 127 ILE n 1 128 HIS n 1 129 GLU n 1 130 LEU n 1 131 ASN n 1 132 TRP n 1 133 ALA n 1 134 PRO n 1 135 SER n 1 136 MET n 1 137 GLU n 1 138 LEU n 1 139 VAL n 1 140 VAL n 1 141 GLY n 1 142 GLU n 1 143 VAL n 1 144 LEU n 1 145 ALA n 1 146 GLU n 1 147 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 147 _entity_src_gen.gene_src_common_name 'Cotton bollworm, Heliothis armigera' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HaOG200775, B5X24_HaOG200775' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Helicoverpa armigera' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 29058 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code F5ANH9_HELAM _struct_ref.pdbx_db_accession F5ANH9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ASQDVIKNLSMNFAKPLEDCKKEMDLPDSVTTDFYNFWKEGYEFTNRQTGCAILCLSSKLELLDQELKLHHGKAQEFAKK HGADDAMAKQLVDLIHGCAQSTPDVADDPCMKTLNVAKCFKAKIHELNWAPSMELVVGEVLAEV ; _struct_ref.pdbx_align_begin 27 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7VWA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 147 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession F5ANH9 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 170 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 27 _struct_ref_seq.pdbx_auth_seq_align_end 170 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7VWA GLY A 1 ? UNP F5ANH9 ? ? 'expression tag' 24 1 1 7VWA SER A 2 ? UNP F5ANH9 ? ? 'expression tag' 25 2 1 7VWA MET A 3 ? UNP F5ANH9 ? ? 'expression tag' 26 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 81K non-polymer . '(Z)-hexadec-9-enal' ? 'C16 H30 O' 238.409 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7VWA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.86 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.70 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details peg _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-10-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7VWA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.09 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7259 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.9 _reflns.pdbx_Rmerge_I_obs 0.057 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 31.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.991 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.09 _reflns_shell.d_res_low 2.13 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 277 _reflns_shell.percent_possible_all 81.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.302 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.953 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.20 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -1.63 _refine.aniso_B[2][2] 0.63 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.31 _refine.B_iso_max ? _refine.B_iso_mean 28.795 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.949 _refine.correlation_coeff_Fo_to_Fc_free 0.932 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7VWA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.10 _refine.ls_d_res_low 32.54 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6682 _refine.ls_number_reflns_R_free 394 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.40 _refine.ls_percent_reflns_R_free 5.6 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20066 _refine.ls_R_factor_R_free 0.23592 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.19863 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7VW9 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.207 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 14.286 _refine.overall_SU_ML 0.164 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 32.54 _refine_hist.number_atoms_solvent 40 _refine_hist.number_atoms_total 1116 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1059 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 17 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.013 1099 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1034 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.515 1.647 1478 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.297 1.633 2404 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.004 5.000 137 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 40.287 26.042 48 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.903 15.000 193 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 12.807 15.000 1 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.062 0.200 142 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1226 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 222 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 0.173 3.098 551 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 0.173 3.097 550 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 0.297 4.644 687 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 0.297 4.645 688 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 0.152 3.122 548 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 0.152 3.122 548 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 0.251 4.671 792 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 0.889 37.116 1228 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 0.852 37.069 1224 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? 0.681 3.000 2133 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.100 _refine_ls_shell.d_res_low 2.154 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 19 _refine_ls_shell.number_reflns_R_work 432 _refine_ls_shell.percent_reflns_obs 87.23 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.371 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.242 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7VWA _struct.title 'Helicoverpa armigera pheromone-binding protein PBP1 with Z-9-hexadecenal' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7VWA _struct_keywords.text 'Helicoverpa armigera, Pheromone binding protein, Ligand binding mechanism, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? LYS A 18 ? GLY A 24 LYS A 41 1 ? 18 HELX_P HELX_P2 AA2 PRO A 19 ? ASP A 28 ? PRO A 42 ASP A 51 1 ? 10 HELX_P HELX_P3 AA3 ASP A 31 ? ASN A 39 ? ASP A 54 ASN A 62 1 ? 9 HELX_P HELX_P4 AA4 ARG A 50 ? LEU A 63 ? ARG A 73 LEU A 86 1 ? 14 HELX_P HELX_P5 AA5 HIS A 73 ? HIS A 84 ? HIS A 96 HIS A 107 1 ? 12 HELX_P HELX_P6 AA6 ASP A 87 ? SER A 104 ? ASP A 110 SER A 127 1 ? 18 HELX_P HELX_P7 AA7 ASP A 111 ? LEU A 130 ? ASP A 134 LEU A 153 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 58 SG ? ? A CYS 46 A CYS 81 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 54 SG ? ? ? 1_555 A CYS 113 SG ? ? A CYS 77 A CYS 136 1_555 ? ? ? ? ? ? ? 2.069 ? ? disulf3 disulf ? ? A CYS 101 SG ? ? ? 1_555 A CYS 122 SG ? ? A CYS 124 A CYS 145 1_555 ? ? ? ? ? ? ? 2.042 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 7VWA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.030389 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004700 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.029980 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018055 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 24 24 GLY GLY A . n A 1 2 SER 2 25 25 SER SER A . n A 1 3 MET 3 26 26 MET MET A . n A 1 4 ALA 4 27 27 ALA ALA A . n A 1 5 SER 5 28 28 SER SER A . n A 1 6 GLN 6 29 29 GLN GLN A . n A 1 7 ASP 7 30 30 ASP ASP A . n A 1 8 VAL 8 31 31 VAL VAL A . n A 1 9 ILE 9 32 32 ILE ILE A . n A 1 10 LYS 10 33 33 LYS LYS A . n A 1 11 ASN 11 34 34 ASN ASN A . n A 1 12 LEU 12 35 35 LEU LEU A . n A 1 13 SER 13 36 36 SER SER A . n A 1 14 MET 14 37 37 MET MET A . n A 1 15 ASN 15 38 38 ASN ASN A . n A 1 16 PHE 16 39 39 PHE PHE A . n A 1 17 ALA 17 40 40 ALA ALA A . n A 1 18 LYS 18 41 41 LYS LYS A . n A 1 19 PRO 19 42 42 PRO PRO A . n A 1 20 LEU 20 43 43 LEU LEU A . n A 1 21 GLU 21 44 44 GLU GLU A . n A 1 22 ASP 22 45 45 ASP ASP A . n A 1 23 CYS 23 46 46 CYS CYS A . n A 1 24 LYS 24 47 47 LYS LYS A . n A 1 25 LYS 25 48 48 LYS LYS A . n A 1 26 GLU 26 49 49 GLU GLU A . n A 1 27 MET 27 50 50 MET MET A . n A 1 28 ASP 28 51 51 ASP ASP A . n A 1 29 LEU 29 52 52 LEU LEU A . n A 1 30 PRO 30 53 53 PRO PRO A . n A 1 31 ASP 31 54 54 ASP ASP A . n A 1 32 SER 32 55 55 SER SER A . n A 1 33 VAL 33 56 56 VAL VAL A . n A 1 34 THR 34 57 57 THR THR A . n A 1 35 THR 35 58 58 THR THR A . n A 1 36 ASP 36 59 59 ASP ASP A . n A 1 37 PHE 37 60 60 PHE PHE A . n A 1 38 TYR 38 61 61 TYR TYR A . n A 1 39 ASN 39 62 62 ASN ASN A . n A 1 40 PHE 40 63 63 PHE PHE A . n A 1 41 TRP 41 64 64 TRP TRP A . n A 1 42 LYS 42 65 65 LYS LYS A . n A 1 43 GLU 43 66 66 GLU GLU A . n A 1 44 GLY 44 67 67 GLY GLY A . n A 1 45 TYR 45 68 68 TYR TYR A . n A 1 46 GLU 46 69 69 GLU GLU A . n A 1 47 PHE 47 70 70 PHE PHE A . n A 1 48 THR 48 71 71 THR THR A . n A 1 49 ASN 49 72 72 ASN ASN A . n A 1 50 ARG 50 73 73 ARG ARG A . n A 1 51 GLN 51 74 74 GLN GLN A . n A 1 52 THR 52 75 75 THR THR A . n A 1 53 GLY 53 76 76 GLY GLY A . n A 1 54 CYS 54 77 77 CYS CYS A . n A 1 55 ALA 55 78 78 ALA ALA A . n A 1 56 ILE 56 79 79 ILE ILE A . n A 1 57 LEU 57 80 80 LEU LEU A . n A 1 58 CYS 58 81 81 CYS CYS A . n A 1 59 LEU 59 82 82 LEU LEU A . n A 1 60 SER 60 83 83 SER SER A . n A 1 61 SER 61 84 84 SER SER A . n A 1 62 LYS 62 85 85 LYS LYS A . n A 1 63 LEU 63 86 86 LEU LEU A . n A 1 64 GLU 64 87 87 GLU GLU A . n A 1 65 LEU 65 88 88 LEU LEU A . n A 1 66 LEU 66 89 89 LEU LEU A . n A 1 67 ASP 67 90 90 ASP ASP A . n A 1 68 GLN 68 91 91 GLN GLN A . n A 1 69 GLU 69 92 92 GLU GLU A . n A 1 70 LEU 70 93 93 LEU LEU A . n A 1 71 LYS 71 94 94 LYS LYS A . n A 1 72 LEU 72 95 95 LEU LEU A . n A 1 73 HIS 73 96 96 HIS HIS A . n A 1 74 HIS 74 97 97 HIS HIS A . n A 1 75 GLY 75 98 98 GLY GLY A . n A 1 76 LYS 76 99 99 LYS LYS A . n A 1 77 ALA 77 100 100 ALA ALA A . n A 1 78 GLN 78 101 101 GLN GLN A . n A 1 79 GLU 79 102 102 GLU GLU A . n A 1 80 PHE 80 103 103 PHE PHE A . n A 1 81 ALA 81 104 104 ALA ALA A . n A 1 82 LYS 82 105 105 LYS LYS A . n A 1 83 LYS 83 106 106 LYS LYS A . n A 1 84 HIS 84 107 107 HIS HIS A . n A 1 85 GLY 85 108 108 GLY GLY A . n A 1 86 ALA 86 109 109 ALA ALA A . n A 1 87 ASP 87 110 110 ASP ASP A . n A 1 88 ASP 88 111 111 ASP ASP A . n A 1 89 ALA 89 112 112 ALA ALA A . n A 1 90 MET 90 113 113 MET MET A . n A 1 91 ALA 91 114 114 ALA ALA A . n A 1 92 LYS 92 115 115 LYS LYS A . n A 1 93 GLN 93 116 116 GLN GLN A . n A 1 94 LEU 94 117 117 LEU LEU A . n A 1 95 VAL 95 118 118 VAL VAL A . n A 1 96 ASP 96 119 119 ASP ASP A . n A 1 97 LEU 97 120 120 LEU LEU A . n A 1 98 ILE 98 121 121 ILE ILE A . n A 1 99 HIS 99 122 122 HIS HIS A . n A 1 100 GLY 100 123 123 GLY GLY A . n A 1 101 CYS 101 124 124 CYS CYS A . n A 1 102 ALA 102 125 125 ALA ALA A . n A 1 103 GLN 103 126 126 GLN GLN A . n A 1 104 SER 104 127 127 SER SER A . n A 1 105 THR 105 128 128 THR THR A . n A 1 106 PRO 106 129 129 PRO PRO A . n A 1 107 ASP 107 130 130 ASP ASP A . n A 1 108 VAL 108 131 131 VAL VAL A . n A 1 109 ALA 109 132 132 ALA ALA A . n A 1 110 ASP 110 133 133 ASP ASP A . n A 1 111 ASP 111 134 134 ASP ASP A . n A 1 112 PRO 112 135 135 PRO PRO A . n A 1 113 CYS 113 136 136 CYS CYS A . n A 1 114 MET 114 137 137 MET MET A . n A 1 115 LYS 115 138 138 LYS LYS A . n A 1 116 THR 116 139 139 THR THR A . n A 1 117 LEU 117 140 140 LEU LEU A . n A 1 118 ASN 118 141 141 ASN ASN A . n A 1 119 VAL 119 142 142 VAL VAL A . n A 1 120 ALA 120 143 143 ALA ALA A . n A 1 121 LYS 121 144 144 LYS LYS A . n A 1 122 CYS 122 145 145 CYS CYS A . n A 1 123 PHE 123 146 146 PHE PHE A . n A 1 124 LYS 124 147 147 LYS LYS A . n A 1 125 ALA 125 148 148 ALA ALA A . n A 1 126 LYS 126 149 149 LYS LYS A . n A 1 127 ILE 127 150 150 ILE ILE A . n A 1 128 HIS 128 151 151 HIS HIS A . n A 1 129 GLU 129 152 152 GLU GLU A . n A 1 130 LEU 130 153 153 LEU LEU A . n A 1 131 ASN 131 154 154 ASN ASN A . n A 1 132 TRP 132 155 155 TRP TRP A . n A 1 133 ALA 133 156 156 ALA ALA A . n A 1 134 PRO 134 157 157 PRO PRO A . n A 1 135 SER 135 158 158 SER SER A . n A 1 136 MET 136 159 159 MET MET A . n A 1 137 GLU 137 160 160 GLU GLU A . n A 1 138 LEU 138 161 161 LEU LEU A . n A 1 139 VAL 139 162 ? ? ? A . n A 1 140 VAL 140 163 ? ? ? A . n A 1 141 GLY 141 164 ? ? ? A . n A 1 142 GLU 142 165 ? ? ? A . n A 1 143 VAL 143 166 ? ? ? A . n A 1 144 LEU 144 167 ? ? ? A . n A 1 145 ALA 145 168 ? ? ? A . n A 1 146 GLU 146 169 ? ? ? A . n A 1 147 VAL 147 170 ? ? ? A . n # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 chenzhongzhou@cau.edu.cn Zhongzhou Chen ? 'principal investigator/group leader' 0000-0003-1319-9664 3 zhengjiangge@cfsa.net.cn jiangge zheng ? 'principal investigator/group leader' 0000-0002-9239-3686 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 81K 1 201 326 81K BMZ A . C 3 HOH 1 301 8 HOH HOH A . C 3 HOH 2 302 18 HOH HOH A . C 3 HOH 3 303 26 HOH HOH A . C 3 HOH 4 304 14 HOH HOH A . C 3 HOH 5 305 15 HOH HOH A . C 3 HOH 6 306 24 HOH HOH A . C 3 HOH 7 307 16 HOH HOH A . C 3 HOH 8 308 32 HOH HOH A . C 3 HOH 9 309 36 HOH HOH A . C 3 HOH 10 310 20 HOH HOH A . C 3 HOH 11 311 31 HOH HOH A . C 3 HOH 12 312 19 HOH HOH A . C 3 HOH 13 313 9 HOH HOH A . C 3 HOH 14 314 23 HOH HOH A . C 3 HOH 15 315 38 HOH HOH A . C 3 HOH 16 316 5 HOH HOH A . C 3 HOH 17 317 4 HOH HOH A . C 3 HOH 18 318 30 HOH HOH A . C 3 HOH 19 319 25 HOH HOH A . C 3 HOH 20 320 33 HOH HOH A . C 3 HOH 21 321 39 HOH HOH A . C 3 HOH 22 322 34 HOH HOH A . C 3 HOH 23 323 1 HOH HOH A . C 3 HOH 24 324 6 HOH HOH A . C 3 HOH 25 325 40 HOH HOH A . C 3 HOH 26 326 7 HOH HOH A . C 3 HOH 27 327 2 HOH HOH A . C 3 HOH 28 328 28 HOH HOH A . C 3 HOH 29 329 12 HOH HOH A . C 3 HOH 30 330 22 HOH HOH A . C 3 HOH 31 331 21 HOH HOH A . C 3 HOH 32 332 37 HOH HOH A . C 3 HOH 33 333 11 HOH HOH A . C 3 HOH 34 334 3 HOH HOH A . C 3 HOH 35 335 35 HOH HOH A . C 3 HOH 36 336 13 HOH HOH A . C 3 HOH 37 337 29 HOH HOH A . C 3 HOH 38 338 17 HOH HOH A . C 3 HOH 39 339 27 HOH HOH A . C 3 HOH 40 340 10 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7130 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-02-02 2 'Structure model' 1 1 2022-03-02 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' pdbx_initial_refinement_model # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_citation.pdbx_database_id_PubMed' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? BALBES ? ? ? . 4 # _pdbx_entry_details.entry_id 7VWA _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 130 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -101.84 _pdbx_validate_torsion.psi 77.35 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 25 ? OG ? A SER 2 OG 2 1 Y 1 A MET 26 ? CG ? A MET 3 CG 3 1 Y 1 A MET 26 ? SD ? A MET 3 SD 4 1 Y 1 A MET 26 ? CE ? A MET 3 CE 5 1 Y 1 A LYS 33 ? NZ ? A LYS 10 NZ 6 1 Y 1 A LYS 41 ? NZ ? A LYS 18 NZ 7 1 Y 1 A GLN 91 ? CG ? A GLN 68 CG 8 1 Y 1 A GLN 91 ? CD ? A GLN 68 CD 9 1 Y 1 A GLN 91 ? OE1 ? A GLN 68 OE1 10 1 Y 1 A GLN 91 ? NE2 ? A GLN 68 NE2 11 1 Y 1 A GLU 92 ? OE2 ? A GLU 69 OE2 12 1 Y 1 A MET 137 ? CE ? A MET 114 CE 13 1 Y 1 A MET 159 ? CG ? A MET 136 CG 14 1 Y 1 A MET 159 ? SD ? A MET 136 SD 15 1 Y 1 A MET 159 ? CE ? A MET 136 CE 16 1 Y 1 A GLU 160 ? CG ? A GLU 137 CG 17 1 Y 1 A GLU 160 ? CD ? A GLU 137 CD 18 1 Y 1 A GLU 160 ? OE1 ? A GLU 137 OE1 19 1 Y 1 A GLU 160 ? OE2 ? A GLU 137 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 162 ? A VAL 139 2 1 Y 1 A VAL 163 ? A VAL 140 3 1 Y 1 A GLY 164 ? A GLY 141 4 1 Y 1 A GLU 165 ? A GLU 142 5 1 Y 1 A VAL 166 ? A VAL 143 6 1 Y 1 A LEU 167 ? A LEU 144 7 1 Y 1 A ALA 168 ? A ALA 145 8 1 Y 1 A GLU 169 ? A GLU 146 9 1 Y 1 A VAL 170 ? A VAL 147 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 81K C1 C N N 1 81K C2 C N N 2 81K C3 C N N 3 81K C4 C N N 4 81K C5 C N N 5 81K C6 C N N 6 81K C7 C N N 7 81K C8 C N N 8 81K C16 C N N 9 81K C15 C N N 10 81K C14 C N N 11 81K C13 C N N 12 81K C12 C N N 13 81K C11 C N N 14 81K C10 C N N 15 81K C9 C N N 16 81K O1 O N N 17 81K H1 H N N 18 81K H2 H N N 19 81K H3 H N N 20 81K H4 H N N 21 81K H5 H N N 22 81K H6 H N N 23 81K H7 H N N 24 81K H8 H N N 25 81K H9 H N N 26 81K H10 H N N 27 81K H11 H N N 28 81K H12 H N N 29 81K H13 H N N 30 81K H14 H N N 31 81K H15 H N N 32 81K H16 H N N 33 81K H17 H N N 34 81K H18 H N N 35 81K H19 H N N 36 81K H20 H N N 37 81K H21 H N N 38 81K H22 H N N 39 81K H23 H N N 40 81K H24 H N N 41 81K H25 H N N 42 81K H26 H N N 43 81K H27 H N N 44 81K H28 H N N 45 81K H29 H N N 46 81K H30 H N N 47 ALA N N N N 48 ALA CA C N S 49 ALA C C N N 50 ALA O O N N 51 ALA CB C N N 52 ALA OXT O N N 53 ALA H H N N 54 ALA H2 H N N 55 ALA HA H N N 56 ALA HB1 H N N 57 ALA HB2 H N N 58 ALA HB3 H N N 59 ALA HXT H N N 60 ARG N N N N 61 ARG CA C N S 62 ARG C C N N 63 ARG O O N N 64 ARG CB C N N 65 ARG CG C N N 66 ARG CD C N N 67 ARG NE N N N 68 ARG CZ C N N 69 ARG NH1 N N N 70 ARG NH2 N N N 71 ARG OXT O N N 72 ARG H H N N 73 ARG H2 H N N 74 ARG HA H N N 75 ARG HB2 H N N 76 ARG HB3 H N N 77 ARG HG2 H N N 78 ARG HG3 H N N 79 ARG HD2 H N N 80 ARG HD3 H N N 81 ARG HE H N N 82 ARG HH11 H N N 83 ARG HH12 H N N 84 ARG HH21 H N N 85 ARG HH22 H N N 86 ARG HXT H N N 87 ASN N N N N 88 ASN CA C N S 89 ASN C C N N 90 ASN O O N N 91 ASN CB C N N 92 ASN CG C N N 93 ASN OD1 O N N 94 ASN ND2 N N N 95 ASN OXT O N N 96 ASN H H N N 97 ASN H2 H N N 98 ASN HA H N N 99 ASN HB2 H N N 100 ASN HB3 H N N 101 ASN HD21 H N N 102 ASN HD22 H N N 103 ASN HXT H N N 104 ASP N N N N 105 ASP CA C N S 106 ASP C C N N 107 ASP O O N N 108 ASP CB C N N 109 ASP CG C N N 110 ASP OD1 O N N 111 ASP OD2 O N N 112 ASP OXT O N N 113 ASP H H N N 114 ASP H2 H N N 115 ASP HA H N N 116 ASP HB2 H N N 117 ASP HB3 H N N 118 ASP HD2 H N N 119 ASP HXT H N N 120 CYS N N N N 121 CYS CA C N R 122 CYS C C N N 123 CYS O O N N 124 CYS CB C N N 125 CYS SG S N N 126 CYS OXT O N N 127 CYS H H N N 128 CYS H2 H N N 129 CYS HA H N N 130 CYS HB2 H N N 131 CYS HB3 H N N 132 CYS HG H N N 133 CYS HXT H N N 134 GLN N N N N 135 GLN CA C N S 136 GLN C C N N 137 GLN O O N N 138 GLN CB C N N 139 GLN CG C N N 140 GLN CD C N N 141 GLN OE1 O N N 142 GLN NE2 N N N 143 GLN OXT O N N 144 GLN H H N N 145 GLN H2 H N N 146 GLN HA H N N 147 GLN HB2 H N N 148 GLN HB3 H N N 149 GLN HG2 H N N 150 GLN HG3 H N N 151 GLN HE21 H N N 152 GLN HE22 H N N 153 GLN HXT H N N 154 GLU N N N N 155 GLU CA C N S 156 GLU C C N N 157 GLU O O N N 158 GLU CB C N N 159 GLU CG C N N 160 GLU CD C N N 161 GLU OE1 O N N 162 GLU OE2 O N N 163 GLU OXT O N N 164 GLU H H N N 165 GLU H2 H N N 166 GLU HA H N N 167 GLU HB2 H N N 168 GLU HB3 H N N 169 GLU HG2 H N N 170 GLU HG3 H N N 171 GLU HE2 H N N 172 GLU HXT H N N 173 GLY N N N N 174 GLY CA C N N 175 GLY C C N N 176 GLY O O N N 177 GLY OXT O N N 178 GLY H H N N 179 GLY H2 H N N 180 GLY HA2 H N N 181 GLY HA3 H N N 182 GLY HXT H N N 183 HIS N N N N 184 HIS CA C N S 185 HIS C C N N 186 HIS O O N N 187 HIS CB C N N 188 HIS CG C Y N 189 HIS ND1 N Y N 190 HIS CD2 C Y N 191 HIS CE1 C Y N 192 HIS NE2 N Y N 193 HIS OXT O N N 194 HIS H H N N 195 HIS H2 H N N 196 HIS HA H N N 197 HIS HB2 H N N 198 HIS HB3 H N N 199 HIS HD1 H N N 200 HIS HD2 H N N 201 HIS HE1 H N N 202 HIS HE2 H N N 203 HIS HXT H N N 204 HOH O O N N 205 HOH H1 H N N 206 HOH H2 H N N 207 ILE N N N N 208 ILE CA C N S 209 ILE C C N N 210 ILE O O N N 211 ILE CB C N S 212 ILE CG1 C N N 213 ILE CG2 C N N 214 ILE CD1 C N N 215 ILE OXT O N N 216 ILE H H N N 217 ILE H2 H N N 218 ILE HA H N N 219 ILE HB H N N 220 ILE HG12 H N N 221 ILE HG13 H N N 222 ILE HG21 H N N 223 ILE HG22 H N N 224 ILE HG23 H N N 225 ILE HD11 H N N 226 ILE HD12 H N N 227 ILE HD13 H N N 228 ILE HXT H N N 229 LEU N N N N 230 LEU CA C N S 231 LEU C C N N 232 LEU O O N N 233 LEU CB C N N 234 LEU CG C N N 235 LEU CD1 C N N 236 LEU CD2 C N N 237 LEU OXT O N N 238 LEU H H N N 239 LEU H2 H N N 240 LEU HA H N N 241 LEU HB2 H N N 242 LEU HB3 H N N 243 LEU HG H N N 244 LEU HD11 H N N 245 LEU HD12 H N N 246 LEU HD13 H N N 247 LEU HD21 H N N 248 LEU HD22 H N N 249 LEU HD23 H N N 250 LEU HXT H N N 251 LYS N N N N 252 LYS CA C N S 253 LYS C C N N 254 LYS O O N N 255 LYS CB C N N 256 LYS CG C N N 257 LYS CD C N N 258 LYS CE C N N 259 LYS NZ N N N 260 LYS OXT O N N 261 LYS H H N N 262 LYS H2 H N N 263 LYS HA H N N 264 LYS HB2 H N N 265 LYS HB3 H N N 266 LYS HG2 H N N 267 LYS HG3 H N N 268 LYS HD2 H N N 269 LYS HD3 H N N 270 LYS HE2 H N N 271 LYS HE3 H N N 272 LYS HZ1 H N N 273 LYS HZ2 H N N 274 LYS HZ3 H N N 275 LYS HXT H N N 276 MET N N N N 277 MET CA C N S 278 MET C C N N 279 MET O O N N 280 MET CB C N N 281 MET CG C N N 282 MET SD S N N 283 MET CE C N N 284 MET OXT O N N 285 MET H H N N 286 MET H2 H N N 287 MET HA H N N 288 MET HB2 H N N 289 MET HB3 H N N 290 MET HG2 H N N 291 MET HG3 H N N 292 MET HE1 H N N 293 MET HE2 H N N 294 MET HE3 H N N 295 MET HXT H N N 296 PHE N N N N 297 PHE CA C N S 298 PHE C C N N 299 PHE O O N N 300 PHE CB C N N 301 PHE CG C Y N 302 PHE CD1 C Y N 303 PHE CD2 C Y N 304 PHE CE1 C Y N 305 PHE CE2 C Y N 306 PHE CZ C Y N 307 PHE OXT O N N 308 PHE H H N N 309 PHE H2 H N N 310 PHE HA H N N 311 PHE HB2 H N N 312 PHE HB3 H N N 313 PHE HD1 H N N 314 PHE HD2 H N N 315 PHE HE1 H N N 316 PHE HE2 H N N 317 PHE HZ H N N 318 PHE HXT H N N 319 PRO N N N N 320 PRO CA C N S 321 PRO C C N N 322 PRO O O N N 323 PRO CB C N N 324 PRO CG C N N 325 PRO CD C N N 326 PRO OXT O N N 327 PRO H H N N 328 PRO HA H N N 329 PRO HB2 H N N 330 PRO HB3 H N N 331 PRO HG2 H N N 332 PRO HG3 H N N 333 PRO HD2 H N N 334 PRO HD3 H N N 335 PRO HXT H N N 336 SER N N N N 337 SER CA C N S 338 SER C C N N 339 SER O O N N 340 SER CB C N N 341 SER OG O N N 342 SER OXT O N N 343 SER H H N N 344 SER H2 H N N 345 SER HA H N N 346 SER HB2 H N N 347 SER HB3 H N N 348 SER HG H N N 349 SER HXT H N N 350 THR N N N N 351 THR CA C N S 352 THR C C N N 353 THR O O N N 354 THR CB C N R 355 THR OG1 O N N 356 THR CG2 C N N 357 THR OXT O N N 358 THR H H N N 359 THR H2 H N N 360 THR HA H N N 361 THR HB H N N 362 THR HG1 H N N 363 THR HG21 H N N 364 THR HG22 H N N 365 THR HG23 H N N 366 THR HXT H N N 367 TRP N N N N 368 TRP CA C N S 369 TRP C C N N 370 TRP O O N N 371 TRP CB C N N 372 TRP CG C Y N 373 TRP CD1 C Y N 374 TRP CD2 C Y N 375 TRP NE1 N Y N 376 TRP CE2 C Y N 377 TRP CE3 C Y N 378 TRP CZ2 C Y N 379 TRP CZ3 C Y N 380 TRP CH2 C Y N 381 TRP OXT O N N 382 TRP H H N N 383 TRP H2 H N N 384 TRP HA H N N 385 TRP HB2 H N N 386 TRP HB3 H N N 387 TRP HD1 H N N 388 TRP HE1 H N N 389 TRP HE3 H N N 390 TRP HZ2 H N N 391 TRP HZ3 H N N 392 TRP HH2 H N N 393 TRP HXT H N N 394 TYR N N N N 395 TYR CA C N S 396 TYR C C N N 397 TYR O O N N 398 TYR CB C N N 399 TYR CG C Y N 400 TYR CD1 C Y N 401 TYR CD2 C Y N 402 TYR CE1 C Y N 403 TYR CE2 C Y N 404 TYR CZ C Y N 405 TYR OH O N N 406 TYR OXT O N N 407 TYR H H N N 408 TYR H2 H N N 409 TYR HA H N N 410 TYR HB2 H N N 411 TYR HB3 H N N 412 TYR HD1 H N N 413 TYR HD2 H N N 414 TYR HE1 H N N 415 TYR HE2 H N N 416 TYR HH H N N 417 TYR HXT H N N 418 VAL N N N N 419 VAL CA C N S 420 VAL C C N N 421 VAL O O N N 422 VAL CB C N N 423 VAL CG1 C N N 424 VAL CG2 C N N 425 VAL OXT O N N 426 VAL H H N N 427 VAL H2 H N N 428 VAL HA H N N 429 VAL HB H N N 430 VAL HG11 H N N 431 VAL HG12 H N N 432 VAL HG13 H N N 433 VAL HG21 H N N 434 VAL HG22 H N N 435 VAL HG23 H N N 436 VAL HXT H N N 437 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 81K C16 C15 sing N N 1 81K C15 C14 sing N N 2 81K C14 C13 sing N N 3 81K C13 C12 sing N N 4 81K C12 C11 sing N N 5 81K C11 C10 sing N N 6 81K C10 C9 doub N Z 7 81K C9 C8 sing N N 8 81K C8 C7 sing N N 9 81K C7 C6 sing N N 10 81K C6 C5 sing N N 11 81K C5 C4 sing N N 12 81K O1 C1 doub N N 13 81K C4 C3 sing N N 14 81K C1 C2 sing N N 15 81K C3 C2 sing N N 16 81K C1 H1 sing N N 17 81K C2 H2 sing N N 18 81K C2 H3 sing N N 19 81K C3 H4 sing N N 20 81K C3 H5 sing N N 21 81K C4 H6 sing N N 22 81K C4 H7 sing N N 23 81K C5 H8 sing N N 24 81K C5 H9 sing N N 25 81K C6 H10 sing N N 26 81K C6 H11 sing N N 27 81K C7 H12 sing N N 28 81K C7 H13 sing N N 29 81K C8 H14 sing N N 30 81K C8 H15 sing N N 31 81K C16 H16 sing N N 32 81K C16 H17 sing N N 33 81K C16 H18 sing N N 34 81K C15 H19 sing N N 35 81K C15 H20 sing N N 36 81K C14 H21 sing N N 37 81K C14 H22 sing N N 38 81K C13 H23 sing N N 39 81K C13 H24 sing N N 40 81K C12 H25 sing N N 41 81K C12 H26 sing N N 42 81K C11 H27 sing N N 43 81K C11 H28 sing N N 44 81K C10 H29 sing N N 45 81K C9 H30 sing N N 46 ALA N CA sing N N 47 ALA N H sing N N 48 ALA N H2 sing N N 49 ALA CA C sing N N 50 ALA CA CB sing N N 51 ALA CA HA sing N N 52 ALA C O doub N N 53 ALA C OXT sing N N 54 ALA CB HB1 sing N N 55 ALA CB HB2 sing N N 56 ALA CB HB3 sing N N 57 ALA OXT HXT sing N N 58 ARG N CA sing N N 59 ARG N H sing N N 60 ARG N H2 sing N N 61 ARG CA C sing N N 62 ARG CA CB sing N N 63 ARG CA HA sing N N 64 ARG C O doub N N 65 ARG C OXT sing N N 66 ARG CB CG sing N N 67 ARG CB HB2 sing N N 68 ARG CB HB3 sing N N 69 ARG CG CD sing N N 70 ARG CG HG2 sing N N 71 ARG CG HG3 sing N N 72 ARG CD NE sing N N 73 ARG CD HD2 sing N N 74 ARG CD HD3 sing N N 75 ARG NE CZ sing N N 76 ARG NE HE sing N N 77 ARG CZ NH1 sing N N 78 ARG CZ NH2 doub N N 79 ARG NH1 HH11 sing N N 80 ARG NH1 HH12 sing N N 81 ARG NH2 HH21 sing N N 82 ARG NH2 HH22 sing N N 83 ARG OXT HXT sing N N 84 ASN N CA sing N N 85 ASN N H sing N N 86 ASN N H2 sing N N 87 ASN CA C sing N N 88 ASN CA CB sing N N 89 ASN CA HA sing N N 90 ASN C O doub N N 91 ASN C OXT sing N N 92 ASN CB CG sing N N 93 ASN CB HB2 sing N N 94 ASN CB HB3 sing N N 95 ASN CG OD1 doub N N 96 ASN CG ND2 sing N N 97 ASN ND2 HD21 sing N N 98 ASN ND2 HD22 sing N N 99 ASN OXT HXT sing N N 100 ASP N CA sing N N 101 ASP N H sing N N 102 ASP N H2 sing N N 103 ASP CA C sing N N 104 ASP CA CB sing N N 105 ASP CA HA sing N N 106 ASP C O doub N N 107 ASP C OXT sing N N 108 ASP CB CG sing N N 109 ASP CB HB2 sing N N 110 ASP CB HB3 sing N N 111 ASP CG OD1 doub N N 112 ASP CG OD2 sing N N 113 ASP OD2 HD2 sing N N 114 ASP OXT HXT sing N N 115 CYS N CA sing N N 116 CYS N H sing N N 117 CYS N H2 sing N N 118 CYS CA C sing N N 119 CYS CA CB sing N N 120 CYS CA HA sing N N 121 CYS C O doub N N 122 CYS C OXT sing N N 123 CYS CB SG sing N N 124 CYS CB HB2 sing N N 125 CYS CB HB3 sing N N 126 CYS SG HG sing N N 127 CYS OXT HXT sing N N 128 GLN N CA sing N N 129 GLN N H sing N N 130 GLN N H2 sing N N 131 GLN CA C sing N N 132 GLN CA CB sing N N 133 GLN CA HA sing N N 134 GLN C O doub N N 135 GLN C OXT sing N N 136 GLN CB CG sing N N 137 GLN CB HB2 sing N N 138 GLN CB HB3 sing N N 139 GLN CG CD sing N N 140 GLN CG HG2 sing N N 141 GLN CG HG3 sing N N 142 GLN CD OE1 doub N N 143 GLN CD NE2 sing N N 144 GLN NE2 HE21 sing N N 145 GLN NE2 HE22 sing N N 146 GLN OXT HXT sing N N 147 GLU N CA sing N N 148 GLU N H sing N N 149 GLU N H2 sing N N 150 GLU CA C sing N N 151 GLU CA CB sing N N 152 GLU CA HA sing N N 153 GLU C O doub N N 154 GLU C OXT sing N N 155 GLU CB CG sing N N 156 GLU CB HB2 sing N N 157 GLU CB HB3 sing N N 158 GLU CG CD sing N N 159 GLU CG HG2 sing N N 160 GLU CG HG3 sing N N 161 GLU CD OE1 doub N N 162 GLU CD OE2 sing N N 163 GLU OE2 HE2 sing N N 164 GLU OXT HXT sing N N 165 GLY N CA sing N N 166 GLY N H sing N N 167 GLY N H2 sing N N 168 GLY CA C sing N N 169 GLY CA HA2 sing N N 170 GLY CA HA3 sing N N 171 GLY C O doub N N 172 GLY C OXT sing N N 173 GLY OXT HXT sing N N 174 HIS N CA sing N N 175 HIS N H sing N N 176 HIS N H2 sing N N 177 HIS CA C sing N N 178 HIS CA CB sing N N 179 HIS CA HA sing N N 180 HIS C O doub N N 181 HIS C OXT sing N N 182 HIS CB CG sing N N 183 HIS CB HB2 sing N N 184 HIS CB HB3 sing N N 185 HIS CG ND1 sing Y N 186 HIS CG CD2 doub Y N 187 HIS ND1 CE1 doub Y N 188 HIS ND1 HD1 sing N N 189 HIS CD2 NE2 sing Y N 190 HIS CD2 HD2 sing N N 191 HIS CE1 NE2 sing Y N 192 HIS CE1 HE1 sing N N 193 HIS NE2 HE2 sing N N 194 HIS OXT HXT sing N N 195 HOH O H1 sing N N 196 HOH O H2 sing N N 197 ILE N CA sing N N 198 ILE N H sing N N 199 ILE N H2 sing N N 200 ILE CA C sing N N 201 ILE CA CB sing N N 202 ILE CA HA sing N N 203 ILE C O doub N N 204 ILE C OXT sing N N 205 ILE CB CG1 sing N N 206 ILE CB CG2 sing N N 207 ILE CB HB sing N N 208 ILE CG1 CD1 sing N N 209 ILE CG1 HG12 sing N N 210 ILE CG1 HG13 sing N N 211 ILE CG2 HG21 sing N N 212 ILE CG2 HG22 sing N N 213 ILE CG2 HG23 sing N N 214 ILE CD1 HD11 sing N N 215 ILE CD1 HD12 sing N N 216 ILE CD1 HD13 sing N N 217 ILE OXT HXT sing N N 218 LEU N CA sing N N 219 LEU N H sing N N 220 LEU N H2 sing N N 221 LEU CA C sing N N 222 LEU CA CB sing N N 223 LEU CA HA sing N N 224 LEU C O doub N N 225 LEU C OXT sing N N 226 LEU CB CG sing N N 227 LEU CB HB2 sing N N 228 LEU CB HB3 sing N N 229 LEU CG CD1 sing N N 230 LEU CG CD2 sing N N 231 LEU CG HG sing N N 232 LEU CD1 HD11 sing N N 233 LEU CD1 HD12 sing N N 234 LEU CD1 HD13 sing N N 235 LEU CD2 HD21 sing N N 236 LEU CD2 HD22 sing N N 237 LEU CD2 HD23 sing N N 238 LEU OXT HXT sing N N 239 LYS N CA sing N N 240 LYS N H sing N N 241 LYS N H2 sing N N 242 LYS CA C sing N N 243 LYS CA CB sing N N 244 LYS CA HA sing N N 245 LYS C O doub N N 246 LYS C OXT sing N N 247 LYS CB CG sing N N 248 LYS CB HB2 sing N N 249 LYS CB HB3 sing N N 250 LYS CG CD sing N N 251 LYS CG HG2 sing N N 252 LYS CG HG3 sing N N 253 LYS CD CE sing N N 254 LYS CD HD2 sing N N 255 LYS CD HD3 sing N N 256 LYS CE NZ sing N N 257 LYS CE HE2 sing N N 258 LYS CE HE3 sing N N 259 LYS NZ HZ1 sing N N 260 LYS NZ HZ2 sing N N 261 LYS NZ HZ3 sing N N 262 LYS OXT HXT sing N N 263 MET N CA sing N N 264 MET N H sing N N 265 MET N H2 sing N N 266 MET CA C sing N N 267 MET CA CB sing N N 268 MET CA HA sing N N 269 MET C O doub N N 270 MET C OXT sing N N 271 MET CB CG sing N N 272 MET CB HB2 sing N N 273 MET CB HB3 sing N N 274 MET CG SD sing N N 275 MET CG HG2 sing N N 276 MET CG HG3 sing N N 277 MET SD CE sing N N 278 MET CE HE1 sing N N 279 MET CE HE2 sing N N 280 MET CE HE3 sing N N 281 MET OXT HXT sing N N 282 PHE N CA sing N N 283 PHE N H sing N N 284 PHE N H2 sing N N 285 PHE CA C sing N N 286 PHE CA CB sing N N 287 PHE CA HA sing N N 288 PHE C O doub N N 289 PHE C OXT sing N N 290 PHE CB CG sing N N 291 PHE CB HB2 sing N N 292 PHE CB HB3 sing N N 293 PHE CG CD1 doub Y N 294 PHE CG CD2 sing Y N 295 PHE CD1 CE1 sing Y N 296 PHE CD1 HD1 sing N N 297 PHE CD2 CE2 doub Y N 298 PHE CD2 HD2 sing N N 299 PHE CE1 CZ doub Y N 300 PHE CE1 HE1 sing N N 301 PHE CE2 CZ sing Y N 302 PHE CE2 HE2 sing N N 303 PHE CZ HZ sing N N 304 PHE OXT HXT sing N N 305 PRO N CA sing N N 306 PRO N CD sing N N 307 PRO N H sing N N 308 PRO CA C sing N N 309 PRO CA CB sing N N 310 PRO CA HA sing N N 311 PRO C O doub N N 312 PRO C OXT sing N N 313 PRO CB CG sing N N 314 PRO CB HB2 sing N N 315 PRO CB HB3 sing N N 316 PRO CG CD sing N N 317 PRO CG HG2 sing N N 318 PRO CG HG3 sing N N 319 PRO CD HD2 sing N N 320 PRO CD HD3 sing N N 321 PRO OXT HXT sing N N 322 SER N CA sing N N 323 SER N H sing N N 324 SER N H2 sing N N 325 SER CA C sing N N 326 SER CA CB sing N N 327 SER CA HA sing N N 328 SER C O doub N N 329 SER C OXT sing N N 330 SER CB OG sing N N 331 SER CB HB2 sing N N 332 SER CB HB3 sing N N 333 SER OG HG sing N N 334 SER OXT HXT sing N N 335 THR N CA sing N N 336 THR N H sing N N 337 THR N H2 sing N N 338 THR CA C sing N N 339 THR CA CB sing N N 340 THR CA HA sing N N 341 THR C O doub N N 342 THR C OXT sing N N 343 THR CB OG1 sing N N 344 THR CB CG2 sing N N 345 THR CB HB sing N N 346 THR OG1 HG1 sing N N 347 THR CG2 HG21 sing N N 348 THR CG2 HG22 sing N N 349 THR CG2 HG23 sing N N 350 THR OXT HXT sing N N 351 TRP N CA sing N N 352 TRP N H sing N N 353 TRP N H2 sing N N 354 TRP CA C sing N N 355 TRP CA CB sing N N 356 TRP CA HA sing N N 357 TRP C O doub N N 358 TRP C OXT sing N N 359 TRP CB CG sing N N 360 TRP CB HB2 sing N N 361 TRP CB HB3 sing N N 362 TRP CG CD1 doub Y N 363 TRP CG CD2 sing Y N 364 TRP CD1 NE1 sing Y N 365 TRP CD1 HD1 sing N N 366 TRP CD2 CE2 doub Y N 367 TRP CD2 CE3 sing Y N 368 TRP NE1 CE2 sing Y N 369 TRP NE1 HE1 sing N N 370 TRP CE2 CZ2 sing Y N 371 TRP CE3 CZ3 doub Y N 372 TRP CE3 HE3 sing N N 373 TRP CZ2 CH2 doub Y N 374 TRP CZ2 HZ2 sing N N 375 TRP CZ3 CH2 sing Y N 376 TRP CZ3 HZ3 sing N N 377 TRP CH2 HH2 sing N N 378 TRP OXT HXT sing N N 379 TYR N CA sing N N 380 TYR N H sing N N 381 TYR N H2 sing N N 382 TYR CA C sing N N 383 TYR CA CB sing N N 384 TYR CA HA sing N N 385 TYR C O doub N N 386 TYR C OXT sing N N 387 TYR CB CG sing N N 388 TYR CB HB2 sing N N 389 TYR CB HB3 sing N N 390 TYR CG CD1 doub Y N 391 TYR CG CD2 sing Y N 392 TYR CD1 CE1 sing Y N 393 TYR CD1 HD1 sing N N 394 TYR CD2 CE2 doub Y N 395 TYR CD2 HD2 sing N N 396 TYR CE1 CZ doub Y N 397 TYR CE1 HE1 sing N N 398 TYR CE2 CZ sing Y N 399 TYR CE2 HE2 sing N N 400 TYR CZ OH sing N N 401 TYR OH HH sing N N 402 TYR OXT HXT sing N N 403 VAL N CA sing N N 404 VAL N H sing N N 405 VAL N H2 sing N N 406 VAL CA C sing N N 407 VAL CA CB sing N N 408 VAL CA HA sing N N 409 VAL C O doub N N 410 VAL C OXT sing N N 411 VAL CB CG1 sing N N 412 VAL CB CG2 sing N N 413 VAL CB HB sing N N 414 VAL CG1 HG11 sing N N 415 VAL CG1 HG12 sing N N 416 VAL CG1 HG13 sing N N 417 VAL CG2 HG21 sing N N 418 VAL CG2 HG22 sing N N 419 VAL CG2 HG23 sing N N 420 VAL OXT HXT sing N N 421 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31872713 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 81K _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 81K _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(Z)-hexadec-9-enal' 81K 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7VW9 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #