data_8BQ1 # _entry.id 8BQ1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8BQ1 pdb_00008bq1 10.2210/pdb8bq1/pdb WWPDB D_1292126832 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8BQ1 _pdbx_database_status.recvd_initial_deposition_date 2022-11-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pachota, M.' 1 0000-0001-5520-6979 'Grzywa, R.' 2 0000-0002-4064-2409 'Plewka, J.' 3 0000-0002-0307-0907 'Wilk, P.' 4 0000-0001-7217-4163 'Mackereth, C.' 5 0000-0002-0776-7947 'Czarna, A.' 6 0000-0003-1068-0671 'Sienczyk, M.' 7 0000-0002-5528-5264 'Pyrc, K.' 8 0000-0002-3867-7688 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Herpes simplex virus type 1 protease' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Pachota, M.' _citation_author.ordinal 1 _citation_author.identifier_ORCID 0000-0001-5520-6979 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8BQ1 _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.080 _cell.length_a_esd ? _cell.length_b 70.080 _cell.length_b_esd ? _cell.length_c 77.330 _cell.length_c_esd ? _cell.volume 328902.238 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8BQ1 _symmetry.cell_setting ? _symmetry.Int_Tables_number 171 _symmetry.space_group_name_Hall 'P 62' _symmetry.space_group_name_H-M 'P 62' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Assemblin 26651.430 1 3.4.21.97 ? ? ? 2 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 3 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Protease # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAADAPGDRMEEPLPDRAVPIYVAGFLALYDSGDSGELALDPDTVRAALPPDNPLPINVDHRAGCEVGRVLAVVDDPRGP FFVGLIACVQLERVLETAASAAIFERRGPPLSREERLLYLITNYLPSVSLATKRLGGEAHPDRTLFAHVALCAIGRRLGT IVTYDTGLDAAIAPFRHLSPASREGARRLAAEAELALSGRTWAPGVEALTHTLLSTAVNNMMLRDRWSLVAERRRQAGIA GHTYLQA ; _entity_poly.pdbx_seq_one_letter_code_can ;MAADAPGDRMEEPLPDRAVPIYVAGFLALYDSGDSGELALDPDTVRAALPPDNPLPINVDHRAGCEVGRVLAVVDDPRGP FFVGLIACVQLERVLETAASAAIFERRGPPLSREERLLYLITNYLPSVSLATKRLGGEAHPDRTLFAHVALCAIGRRLGT IVTYDTGLDAAIAPFRHLSPASREGARRLAAEAELALSGRTWAPGVEALTHTLLSTAVNNMMLRDRWSLVAERRRQAGIA GHTYLQA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ALA n 1 4 ASP n 1 5 ALA n 1 6 PRO n 1 7 GLY n 1 8 ASP n 1 9 ARG n 1 10 MET n 1 11 GLU n 1 12 GLU n 1 13 PRO n 1 14 LEU n 1 15 PRO n 1 16 ASP n 1 17 ARG n 1 18 ALA n 1 19 VAL n 1 20 PRO n 1 21 ILE n 1 22 TYR n 1 23 VAL n 1 24 ALA n 1 25 GLY n 1 26 PHE n 1 27 LEU n 1 28 ALA n 1 29 LEU n 1 30 TYR n 1 31 ASP n 1 32 SER n 1 33 GLY n 1 34 ASP n 1 35 SER n 1 36 GLY n 1 37 GLU n 1 38 LEU n 1 39 ALA n 1 40 LEU n 1 41 ASP n 1 42 PRO n 1 43 ASP n 1 44 THR n 1 45 VAL n 1 46 ARG n 1 47 ALA n 1 48 ALA n 1 49 LEU n 1 50 PRO n 1 51 PRO n 1 52 ASP n 1 53 ASN n 1 54 PRO n 1 55 LEU n 1 56 PRO n 1 57 ILE n 1 58 ASN n 1 59 VAL n 1 60 ASP n 1 61 HIS n 1 62 ARG n 1 63 ALA n 1 64 GLY n 1 65 CYS n 1 66 GLU n 1 67 VAL n 1 68 GLY n 1 69 ARG n 1 70 VAL n 1 71 LEU n 1 72 ALA n 1 73 VAL n 1 74 VAL n 1 75 ASP n 1 76 ASP n 1 77 PRO n 1 78 ARG n 1 79 GLY n 1 80 PRO n 1 81 PHE n 1 82 PHE n 1 83 VAL n 1 84 GLY n 1 85 LEU n 1 86 ILE n 1 87 ALA n 1 88 CYS n 1 89 VAL n 1 90 GLN n 1 91 LEU n 1 92 GLU n 1 93 ARG n 1 94 VAL n 1 95 LEU n 1 96 GLU n 1 97 THR n 1 98 ALA n 1 99 ALA n 1 100 SER n 1 101 ALA n 1 102 ALA n 1 103 ILE n 1 104 PHE n 1 105 GLU n 1 106 ARG n 1 107 ARG n 1 108 GLY n 1 109 PRO n 1 110 PRO n 1 111 LEU n 1 112 SER n 1 113 ARG n 1 114 GLU n 1 115 GLU n 1 116 ARG n 1 117 LEU n 1 118 LEU n 1 119 TYR n 1 120 LEU n 1 121 ILE n 1 122 THR n 1 123 ASN n 1 124 TYR n 1 125 LEU n 1 126 PRO n 1 127 SER n 1 128 VAL n 1 129 SER n 1 130 LEU n 1 131 ALA n 1 132 THR n 1 133 LYS n 1 134 ARG n 1 135 LEU n 1 136 GLY n 1 137 GLY n 1 138 GLU n 1 139 ALA n 1 140 HIS n 1 141 PRO n 1 142 ASP n 1 143 ARG n 1 144 THR n 1 145 LEU n 1 146 PHE n 1 147 ALA n 1 148 HIS n 1 149 VAL n 1 150 ALA n 1 151 LEU n 1 152 CYS n 1 153 ALA n 1 154 ILE n 1 155 GLY n 1 156 ARG n 1 157 ARG n 1 158 LEU n 1 159 GLY n 1 160 THR n 1 161 ILE n 1 162 VAL n 1 163 THR n 1 164 TYR n 1 165 ASP n 1 166 THR n 1 167 GLY n 1 168 LEU n 1 169 ASP n 1 170 ALA n 1 171 ALA n 1 172 ILE n 1 173 ALA n 1 174 PRO n 1 175 PHE n 1 176 ARG n 1 177 HIS n 1 178 LEU n 1 179 SER n 1 180 PRO n 1 181 ALA n 1 182 SER n 1 183 ARG n 1 184 GLU n 1 185 GLY n 1 186 ALA n 1 187 ARG n 1 188 ARG n 1 189 LEU n 1 190 ALA n 1 191 ALA n 1 192 GLU n 1 193 ALA n 1 194 GLU n 1 195 LEU n 1 196 ALA n 1 197 LEU n 1 198 SER n 1 199 GLY n 1 200 ARG n 1 201 THR n 1 202 TRP n 1 203 ALA n 1 204 PRO n 1 205 GLY n 1 206 VAL n 1 207 GLU n 1 208 ALA n 1 209 LEU n 1 210 THR n 1 211 HIS n 1 212 THR n 1 213 LEU n 1 214 LEU n 1 215 SER n 1 216 THR n 1 217 ALA n 1 218 VAL n 1 219 ASN n 1 220 ASN n 1 221 MET n 1 222 MET n 1 223 LEU n 1 224 ARG n 1 225 ASP n 1 226 ARG n 1 227 TRP n 1 228 SER n 1 229 LEU n 1 230 VAL n 1 231 ALA n 1 232 GLU n 1 233 ARG n 1 234 ARG n 1 235 ARG n 1 236 GLN n 1 237 ALA n 1 238 GLY n 1 239 ILE n 1 240 ALA n 1 241 GLY n 1 242 HIS n 1 243 THR n 1 244 TYR n 1 245 LEU n 1 246 GLN n 1 247 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 247 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene UL26 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human alphaherpesvirus 1 strain 17' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10299 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SCAF_HHV11 _struct_ref.pdbx_db_accession P10210 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAADAPGDRMEEPLPDRAVPIYVAGFLALYDSGDSGELALDPDTVRAALPPDNPLPINVDHRAGCEVGRVLAVVDDPRGP FFVGLIACVQLERVLETAASAAIFERRGPPLSREERLLYLITNYLPSVSLATKRLGGEAHPDRTLFAHVALCAIGRRLGT IVTYDTGLDAAIAPFRHLSPASREGARRLAAEAELALSGRTWAPGVEALTHTLLSTAVNNMMLRDRWSLVAERRRQAGIA GHTYLQA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8BQ1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 247 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P10210 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 247 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 247 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8BQ1 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.06 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.20 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '5% PEG400, 1.9M ammonium sulfate, 0.2M sodium nitrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-11-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'LN2 cooled double crystal monochromator' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.03323 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, DESY BEAMLINE P11' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.03323 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline P11 _diffrn_source.pdbx_synchrotron_site 'PETRA III, DESY' # _reflns.B_iso_Wilson_estimate 64.43 _reflns.entry_id 8BQ1 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.32 _reflns.d_resolution_low 47.74 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9338 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.47 _reflns.pdbx_Rmerge_I_obs 0.13 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.93 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.133 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.32 2.46 ? 1.27 ? ? ? ? 1459 97.6 ? ? ? ? 2.918 ? ? ? ? ? ? ? ? 18.92 ? ? ? ? 2.9989 ? ? 1 1 0.5589 ? ? ? ? ? ? ? ? ? ? 2.46 2.63 ? ? ? ? ? ? 1409 99.9 ? ? ? ? 1.828 ? ? ? ? ? ? ? ? ? ? ? ? ? 1.873 ? ? 2 1 0.785 ? ? ? ? ? ? ? ? ? ? 2.63 2.84 ? ? ? ? ? ? 1333 ? ? ? ? ? 1.128 ? ? ? ? ? ? ? ? ? ? ? ? ? 1.156 ? ? 3 1 0.953 ? ? ? ? ? ? ? ? ? ? 2.84 3.11 ? ? ? ? ? ? 1208 ? ? ? ? ? 0.568 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.583 ? ? 4 1 0.981 ? ? ? ? ? ? ? ? ? ? 3.11 3.47 ? ? ? ? ? ? 1117 ? ? ? ? ? 0.272 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.278 ? ? 5 1 0.997 ? ? ? ? ? ? ? ? ? ? 3.47 4.01 ? ? ? ? ? ? 975 ? ? ? ? ? 0.129 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.132 ? ? 6 1 0.998 ? ? ? ? ? ? ? ? ? ? 4.01 4.9 ? ? ? ? ? ? 819 ? ? ? ? ? 0.076 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.078 ? ? 7 1 0.999 ? ? ? ? ? ? ? ? ? ? 4.90 6.89 ? ? ? ? ? ? 655 ? ? ? ? ? 0.07 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.072 ? ? 8 1 0.998 ? ? ? ? ? ? ? ? ? ? 6.89 47.74 ? ? ? ? ? ? 363 ? ? ? ? ? 0.067 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.069 ? ? 9 1 0.998 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 76.14 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8BQ1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.32 _refine.ls_d_res_low 47.74 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9315 _refine.ls_number_reflns_R_free 466 _refine.ls_number_reflns_R_work 8849 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.14 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1973 _refine.ls_R_factor_R_free 0.2440 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1948 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1AT3 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.6949 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4136 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.32 _refine_hist.d_res_low 47.74 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 1491 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1475 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0025 ? 1525 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5586 ? 2083 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0403 ? 246 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0057 ? 273 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 5.3194 ? 222 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.32 2.66 . . 153 2892 98.16 . . . 0.3299 . 0.2996 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.66 3.35 . . 155 2970 99.68 . . . 0.2871 . 0.2509 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.35 47.74 . . 158 2987 99.56 . . . 0.2207 . 0.1660 . . . . . . . . . . . # _struct.entry_id 8BQ1 _struct.title 'Herpes simplex virus type 1 protease' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8BQ1 _struct_keywords.text 'herpes, protease, UL26, VP24, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 41 ? ALA A 48 ? ASP A 41 ALA A 48 1 ? 8 HELX_P HELX_P2 AA2 CYS A 88 ? ALA A 101 ? CYS A 88 ALA A 101 1 ? 14 HELX_P HELX_P3 AA3 SER A 112 ? LEU A 125 ? SER A 112 LEU A 125 1 ? 14 HELX_P HELX_P4 AA4 GLY A 167 ? ALA A 173 ? GLY A 167 ALA A 173 1 ? 7 HELX_P HELX_P5 AA5 SER A 179 ? LEU A 197 ? SER A 179 LEU A 197 1 ? 19 HELX_P HELX_P6 AA6 GLY A 205 ? LEU A 214 ? GLY A 205 LEU A 214 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 21 ? PHE A 26 ? ILE A 21 PHE A 26 AA1 2 PHE A 81 ? ILE A 86 ? PHE A 81 ILE A 86 AA1 3 ARG A 62 ? VAL A 74 ? ARG A 62 VAL A 74 AA1 4 PRO A 56 ? VAL A 59 ? PRO A 56 VAL A 59 AA1 5 PHE A 146 ? CYS A 152 ? PHE A 146 CYS A 152 AA1 6 SER A 127 ? THR A 132 ? SER A 127 THR A 132 AA1 7 THR A 160 ? ASP A 165 ? THR A 160 ASP A 165 AA1 8 ILE A 21 ? PHE A 26 ? ILE A 21 PHE A 26 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 21 ? N ILE A 21 O ILE A 86 ? O ILE A 86 AA1 2 3 O PHE A 81 ? O PHE A 81 N VAL A 74 ? N VAL A 74 AA1 3 4 O VAL A 67 ? O VAL A 67 N ILE A 57 ? N ILE A 57 AA1 4 5 N ASN A 58 ? N ASN A 58 O LEU A 151 ? O LEU A 151 AA1 5 6 O HIS A 148 ? O HIS A 148 N ALA A 131 ? N ALA A 131 AA1 6 7 N VAL A 128 ? N VAL A 128 O THR A 160 ? O THR A 160 AA1 7 8 O ASP A 165 ? O ASP A 165 N TYR A 22 ? N TYR A 22 # _atom_sites.entry_id 8BQ1 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014269 _atom_sites.fract_transf_matrix[1][2] 0.008238 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016477 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012932 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 PRO 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 ASP 8 8 ? ? ? A . n A 1 9 ARG 9 9 ? ? ? A . n A 1 10 MET 10 10 ? ? ? A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLY 33 33 ? ? ? A . n A 1 34 ASP 34 34 ? ? ? A . n A 1 35 SER 35 35 ? ? ? A . n A 1 36 GLY 36 36 ? ? ? A . n A 1 37 GLU 37 37 ? ? ? A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 GLY 137 137 ? ? ? A . n A 1 138 GLU 138 138 ? ? ? A . n A 1 139 ALA 139 139 ? ? ? A . n A 1 140 HIS 140 140 ? ? ? A . n A 1 141 PRO 141 141 ? ? ? A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 HIS 148 148 148 HIS HIS A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 CYS 152 152 152 CYS CYS A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 PRO 174 174 174 PRO PRO A . n A 1 175 PHE 175 175 175 PHE PHE A . n A 1 176 ARG 176 176 176 ARG ARG A . n A 1 177 HIS 177 177 177 HIS HIS A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 ARG 183 183 183 ARG ARG A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 ARG 187 187 187 ARG ARG A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 GLY 199 199 199 GLY GLY A . n A 1 200 ARG 200 200 200 ARG ARG A . n A 1 201 THR 201 201 201 THR THR A . n A 1 202 TRP 202 202 202 TRP TRP A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 PRO 204 204 204 PRO PRO A . n A 1 205 GLY 205 205 205 GLY GLY A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 ALA 208 208 208 ALA ALA A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 THR 210 210 210 THR THR A . n A 1 211 HIS 211 211 211 HIS HIS A . n A 1 212 THR 212 212 212 THR THR A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 SER 215 215 ? ? ? A . n A 1 216 THR 216 216 ? ? ? A . n A 1 217 ALA 217 217 ? ? ? A . n A 1 218 VAL 218 218 ? ? ? A . n A 1 219 ASN 219 219 ? ? ? A . n A 1 220 ASN 220 220 ? ? ? A . n A 1 221 MET 221 221 ? ? ? A . n A 1 222 MET 222 222 ? ? ? A . n A 1 223 LEU 223 223 ? ? ? A . n A 1 224 ARG 224 224 ? ? ? A . n A 1 225 ASP 225 225 ? ? ? A . n A 1 226 ARG 226 226 ? ? ? A . n A 1 227 TRP 227 227 ? ? ? A . n A 1 228 SER 228 228 ? ? ? A . n A 1 229 LEU 229 229 ? ? ? A . n A 1 230 VAL 230 230 ? ? ? A . n A 1 231 ALA 231 231 ? ? ? A . n A 1 232 GLU 232 232 ? ? ? A . n A 1 233 ARG 233 233 ? ? ? A . n A 1 234 ARG 234 234 ? ? ? A . n A 1 235 ARG 235 235 ? ? ? A . n A 1 236 GLN 236 236 ? ? ? A . n A 1 237 ALA 237 237 ? ? ? A . n A 1 238 GLY 238 238 ? ? ? A . n A 1 239 ILE 239 239 ? ? ? A . n A 1 240 ALA 240 240 ? ? ? A . n A 1 241 GLY 241 241 ? ? ? A . n A 1 242 HIS 242 242 ? ? ? A . n A 1 243 THR 243 243 ? ? ? A . n A 1 244 TYR 244 244 ? ? ? A . n A 1 245 LEU 245 245 ? ? ? A . n A 1 246 GLN 246 246 ? ? ? A . n A 1 247 ALA 247 247 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email k.a.pyrc@uj.edu.pl _pdbx_contact_author.name_first Krzysztof _pdbx_contact_author.name_last Pyrc _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3867-7688 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 301 1 GOL GOL A . C 3 HOH 1 401 10 HOH HOH A . C 3 HOH 2 402 3 HOH HOH A . C 3 HOH 3 403 5 HOH HOH A . C 3 HOH 4 404 8 HOH HOH A . C 3 HOH 5 405 1 HOH HOH A . C 3 HOH 6 406 2 HOH HOH A . C 3 HOH 7 407 6 HOH HOH A . C 3 HOH 8 408 4 HOH HOH A . C 3 HOH 9 409 9 HOH HOH A . C 3 HOH 10 410 7 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3280 ? 1 MORE -12 ? 1 'SSA (A^2)' 18520 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 70.0800000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 404 ? C HOH . 2 1 A HOH 409 ? C HOH . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/3 3 y,-x+y,z+2/3 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 -x,-y,z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 44.9029812784 21.4287761304 44.0862311274 0.827683038744 ? -0.108528021819 ? -0.202612053485 ? 0.732716918321 ? -0.00818846873458 ? 0.799806295468 ? 0.526850340963 ? -0.203946699339 ? 0.0103882979464 ? 1.16377690414 ? -0.094558374268 ? 0.463750684087 ? 0.394326445288 ? -0.254416007757 ? -1.07799947568 ? 0.794858382932 ? 0.354425041892 ? -2.01724027127 ? 0.414368446059 ? 1.12027386173 ? 0.0871648100789 ? 2 'X-RAY DIFFRACTION' ? refined 19.8491051393 11.8210104058 36.4713276329 0.499103271556 ? 0.033679152166 ? -0.0312077257263 ? 0.478982998638 ? -0.0403354772834 ? 0.640232939645 ? 0.785404893894 ? -0.0963464525076 ? 0.383986314585 ? 1.16532069818 ? -0.724186728856 ? 0.866481961543 ? -0.0461311886575 ? -0.0100206498613 ? -0.0602525909777 ? -0.243692398525 ? 0.0325269475839 ? 0.433729102928 ? -0.272031587719 ? -0.157669277092 ? 0.000269106719574 ? 3 'X-RAY DIFFRACTION' ? refined 46.1352843403 7.79352021864 45.7068429872 0.648101078292 ? 0.0111540585186 ? -0.00819582533138 ? 0.630312321924 ? -0.0292684437063 ? 0.637400988191 ? 0.561393746081 ? -0.0234465330925 ? -0.160430760108 ? 0.0212441819446 ? -0.0973855384291 ? 0.45002486086 ? 0.00476654007975 ? -0.132196892032 ? 0.365977834947 ? 0.244231872453 ? 0.16831870611 ? -0.760897993727 ? 0.111606850092 ? -0.283584193775 ? 0.000446891940308 ? 4 'X-RAY DIFFRACTION' ? refined 26.6077991127 9.04540792798 42.6668954613 0.517731036057 ? 0.0113821685355 ? 0.0633446328231 ? 0.566636926779 ? 0.0329933979319 ? 0.591065243703 ? 0.951789228978 ? 0.0844174137065 ? -0.334857498181 ? 1.29025155434 ? 0.685024055845 ? 1.5798572109 ? -0.00940655084889 ? -0.126067940853 ? -0.0354035383367 ? 0.0516123305081 ? 0.0326558008179 ? 0.0576816258626 ? 0.134588334441 ? 0.011750055496 ? 0.000892068649312 ? 5 'X-RAY DIFFRACTION' ? refined 30.1948485429 7.33367384237 28.2207863574 0.736961046613 ? -0.0534024065356 ? -0.070732002804 ? 0.612416016064 ? -0.0272792100971 ? 0.65580918107 ? 0.221988669685 ? -0.278285025109 ? -0.0392431084959 ? 0.373731216115 ? 0.136578873595 ? 0.119963680739 ? 0.192580363365 ? 0.417990627931 ? -0.617393366204 ? -1.1053182043 ? -0.0764700408556 ? 0.352220885208 ? 0.5908583879 ? 0.224448430781 ? 0.00230311431405 ? 6 'X-RAY DIFFRACTION' ? refined 29.195272974 18.4086971726 37.0338266393 0.811141926131 ? 0.0806848492642 ? 0.000347977577599 ? 0.651953660602 ? -0.0696309133274 ? 0.633347081674 ? 0.816781717381 ? 1.25621328203 ? -0.0775448890632 ? 1.60193033619 ? -0.235852585179 ? 0.238197824213 ? 0.00615451097148 ? 0.299522936792 ? -0.0934387868617 ? -0.0175999233469 ? 0.356743536572 ? 0.235374995084 ? 0.051618985773 ? 0.657133762722 ? 0.00226265932593 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 11 ? A 10 A 20 ? ? ;chain 'A' and (resid 11 through 20 ) ; 2 'X-RAY DIFFRACTION' 2 A 11 A 21 ? A 73 A 88 ? ? ;chain 'A' and (resid 21 through 88 ) ; 3 'X-RAY DIFFRACTION' 3 A 74 A 89 ? A 97 A 112 ? ? ;chain 'A' and (resid 89 through 112 ) ; 4 'X-RAY DIFFRACTION' 4 A 98 A 113 ? A 141 A 161 ? ? ;chain 'A' and (resid 113 through 161 ) ; 5 'X-RAY DIFFRACTION' 5 A 142 A 162 ? A 159 A 179 ? ? ;chain 'A' and (resid 162 through 179 ) ; 6 'X-RAY DIFFRACTION' 6 A 160 A 180 ? A 194 A 214 ? ? ;chain 'A' and (resid 180 through 214 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 # _pdbx_entry_details.entry_id 8BQ1 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 96 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NH1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 116 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 65 ? ? -97.90 49.88 2 1 LEU A 197 ? ? -96.24 36.63 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A ASP 4 ? A ASP 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A PRO 6 ? A PRO 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A ASP 8 ? A ASP 8 9 1 Y 1 A ARG 9 ? A ARG 9 10 1 Y 1 A MET 10 ? A MET 10 11 1 Y 1 A GLY 33 ? A GLY 33 12 1 Y 1 A ASP 34 ? A ASP 34 13 1 Y 1 A SER 35 ? A SER 35 14 1 Y 1 A GLY 36 ? A GLY 36 15 1 Y 1 A GLU 37 ? A GLU 37 16 1 Y 1 A GLY 137 ? A GLY 137 17 1 Y 1 A GLU 138 ? A GLU 138 18 1 Y 1 A ALA 139 ? A ALA 139 19 1 Y 1 A HIS 140 ? A HIS 140 20 1 Y 1 A PRO 141 ? A PRO 141 21 1 Y 1 A SER 215 ? A SER 215 22 1 Y 1 A THR 216 ? A THR 216 23 1 Y 1 A ALA 217 ? A ALA 217 24 1 Y 1 A VAL 218 ? A VAL 218 25 1 Y 1 A ASN 219 ? A ASN 219 26 1 Y 1 A ASN 220 ? A ASN 220 27 1 Y 1 A MET 221 ? A MET 221 28 1 Y 1 A MET 222 ? A MET 222 29 1 Y 1 A LEU 223 ? A LEU 223 30 1 Y 1 A ARG 224 ? A ARG 224 31 1 Y 1 A ASP 225 ? A ASP 225 32 1 Y 1 A ARG 226 ? A ARG 226 33 1 Y 1 A TRP 227 ? A TRP 227 34 1 Y 1 A SER 228 ? A SER 228 35 1 Y 1 A LEU 229 ? A LEU 229 36 1 Y 1 A VAL 230 ? A VAL 230 37 1 Y 1 A ALA 231 ? A ALA 231 38 1 Y 1 A GLU 232 ? A GLU 232 39 1 Y 1 A ARG 233 ? A ARG 233 40 1 Y 1 A ARG 234 ? A ARG 234 41 1 Y 1 A ARG 235 ? A ARG 235 42 1 Y 1 A GLN 236 ? A GLN 236 43 1 Y 1 A ALA 237 ? A ALA 237 44 1 Y 1 A GLY 238 ? A GLY 238 45 1 Y 1 A ILE 239 ? A ILE 239 46 1 Y 1 A ALA 240 ? A ALA 240 47 1 Y 1 A GLY 241 ? A GLY 241 48 1 Y 1 A HIS 242 ? A HIS 242 49 1 Y 1 A THR 243 ? A THR 243 50 1 Y 1 A TYR 244 ? A TYR 244 51 1 Y 1 A LEU 245 ? A LEU 245 52 1 Y 1 A GLN 246 ? A GLN 246 53 1 Y 1 A ALA 247 ? A ALA 247 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MET N N N N 244 MET CA C N S 245 MET C C N N 246 MET O O N N 247 MET CB C N N 248 MET CG C N N 249 MET SD S N N 250 MET CE C N N 251 MET OXT O N N 252 MET H H N N 253 MET H2 H N N 254 MET HA H N N 255 MET HB2 H N N 256 MET HB3 H N N 257 MET HG2 H N N 258 MET HG3 H N N 259 MET HE1 H N N 260 MET HE2 H N N 261 MET HE3 H N N 262 MET HXT H N N 263 PHE N N N N 264 PHE CA C N S 265 PHE C C N N 266 PHE O O N N 267 PHE CB C N N 268 PHE CG C Y N 269 PHE CD1 C Y N 270 PHE CD2 C Y N 271 PHE CE1 C Y N 272 PHE CE2 C Y N 273 PHE CZ C Y N 274 PHE OXT O N N 275 PHE H H N N 276 PHE H2 H N N 277 PHE HA H N N 278 PHE HB2 H N N 279 PHE HB3 H N N 280 PHE HD1 H N N 281 PHE HD2 H N N 282 PHE HE1 H N N 283 PHE HE2 H N N 284 PHE HZ H N N 285 PHE HXT H N N 286 PRO N N N N 287 PRO CA C N S 288 PRO C C N N 289 PRO O O N N 290 PRO CB C N N 291 PRO CG C N N 292 PRO CD C N N 293 PRO OXT O N N 294 PRO H H N N 295 PRO HA H N N 296 PRO HB2 H N N 297 PRO HB3 H N N 298 PRO HG2 H N N 299 PRO HG3 H N N 300 PRO HD2 H N N 301 PRO HD3 H N N 302 PRO HXT H N N 303 SER N N N N 304 SER CA C N S 305 SER C C N N 306 SER O O N N 307 SER CB C N N 308 SER OG O N N 309 SER OXT O N N 310 SER H H N N 311 SER H2 H N N 312 SER HA H N N 313 SER HB2 H N N 314 SER HB3 H N N 315 SER HG H N N 316 SER HXT H N N 317 THR N N N N 318 THR CA C N S 319 THR C C N N 320 THR O O N N 321 THR CB C N R 322 THR OG1 O N N 323 THR CG2 C N N 324 THR OXT O N N 325 THR H H N N 326 THR H2 H N N 327 THR HA H N N 328 THR HB H N N 329 THR HG1 H N N 330 THR HG21 H N N 331 THR HG22 H N N 332 THR HG23 H N N 333 THR HXT H N N 334 TRP N N N N 335 TRP CA C N S 336 TRP C C N N 337 TRP O O N N 338 TRP CB C N N 339 TRP CG C Y N 340 TRP CD1 C Y N 341 TRP CD2 C Y N 342 TRP NE1 N Y N 343 TRP CE2 C Y N 344 TRP CE3 C Y N 345 TRP CZ2 C Y N 346 TRP CZ3 C Y N 347 TRP CH2 C Y N 348 TRP OXT O N N 349 TRP H H N N 350 TRP H2 H N N 351 TRP HA H N N 352 TRP HB2 H N N 353 TRP HB3 H N N 354 TRP HD1 H N N 355 TRP HE1 H N N 356 TRP HE3 H N N 357 TRP HZ2 H N N 358 TRP HZ3 H N N 359 TRP HH2 H N N 360 TRP HXT H N N 361 TYR N N N N 362 TYR CA C N S 363 TYR C C N N 364 TYR O O N N 365 TYR CB C N N 366 TYR CG C Y N 367 TYR CD1 C Y N 368 TYR CD2 C Y N 369 TYR CE1 C Y N 370 TYR CE2 C Y N 371 TYR CZ C Y N 372 TYR OH O N N 373 TYR OXT O N N 374 TYR H H N N 375 TYR H2 H N N 376 TYR HA H N N 377 TYR HB2 H N N 378 TYR HB3 H N N 379 TYR HD1 H N N 380 TYR HD2 H N N 381 TYR HE1 H N N 382 TYR HE2 H N N 383 TYR HH H N N 384 TYR HXT H N N 385 VAL N N N N 386 VAL CA C N S 387 VAL C C N N 388 VAL O O N N 389 VAL CB C N N 390 VAL CG1 C N N 391 VAL CG2 C N N 392 VAL OXT O N N 393 VAL H H N N 394 VAL H2 H N N 395 VAL HA H N N 396 VAL HB H N N 397 VAL HG11 H N N 398 VAL HG12 H N N 399 VAL HG13 H N N 400 VAL HG21 H N N 401 VAL HG22 H N N 402 VAL HG23 H N N 403 VAL HXT H N N 404 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 PHE N CA sing N N 250 PHE N H sing N N 251 PHE N H2 sing N N 252 PHE CA C sing N N 253 PHE CA CB sing N N 254 PHE CA HA sing N N 255 PHE C O doub N N 256 PHE C OXT sing N N 257 PHE CB CG sing N N 258 PHE CB HB2 sing N N 259 PHE CB HB3 sing N N 260 PHE CG CD1 doub Y N 261 PHE CG CD2 sing Y N 262 PHE CD1 CE1 sing Y N 263 PHE CD1 HD1 sing N N 264 PHE CD2 CE2 doub Y N 265 PHE CD2 HD2 sing N N 266 PHE CE1 CZ doub Y N 267 PHE CE1 HE1 sing N N 268 PHE CE2 CZ sing Y N 269 PHE CE2 HE2 sing N N 270 PHE CZ HZ sing N N 271 PHE OXT HXT sing N N 272 PRO N CA sing N N 273 PRO N CD sing N N 274 PRO N H sing N N 275 PRO CA C sing N N 276 PRO CA CB sing N N 277 PRO CA HA sing N N 278 PRO C O doub N N 279 PRO C OXT sing N N 280 PRO CB CG sing N N 281 PRO CB HB2 sing N N 282 PRO CB HB3 sing N N 283 PRO CG CD sing N N 284 PRO CG HG2 sing N N 285 PRO CG HG3 sing N N 286 PRO CD HD2 sing N N 287 PRO CD HD3 sing N N 288 PRO OXT HXT sing N N 289 SER N CA sing N N 290 SER N H sing N N 291 SER N H2 sing N N 292 SER CA C sing N N 293 SER CA CB sing N N 294 SER CA HA sing N N 295 SER C O doub N N 296 SER C OXT sing N N 297 SER CB OG sing N N 298 SER CB HB2 sing N N 299 SER CB HB3 sing N N 300 SER OG HG sing N N 301 SER OXT HXT sing N N 302 THR N CA sing N N 303 THR N H sing N N 304 THR N H2 sing N N 305 THR CA C sing N N 306 THR CA CB sing N N 307 THR CA HA sing N N 308 THR C O doub N N 309 THR C OXT sing N N 310 THR CB OG1 sing N N 311 THR CB CG2 sing N N 312 THR CB HB sing N N 313 THR OG1 HG1 sing N N 314 THR CG2 HG21 sing N N 315 THR CG2 HG22 sing N N 316 THR CG2 HG23 sing N N 317 THR OXT HXT sing N N 318 TRP N CA sing N N 319 TRP N H sing N N 320 TRP N H2 sing N N 321 TRP CA C sing N N 322 TRP CA CB sing N N 323 TRP CA HA sing N N 324 TRP C O doub N N 325 TRP C OXT sing N N 326 TRP CB CG sing N N 327 TRP CB HB2 sing N N 328 TRP CB HB3 sing N N 329 TRP CG CD1 doub Y N 330 TRP CG CD2 sing Y N 331 TRP CD1 NE1 sing Y N 332 TRP CD1 HD1 sing N N 333 TRP CD2 CE2 doub Y N 334 TRP CD2 CE3 sing Y N 335 TRP NE1 CE2 sing Y N 336 TRP NE1 HE1 sing N N 337 TRP CE2 CZ2 sing Y N 338 TRP CE3 CZ3 doub Y N 339 TRP CE3 HE3 sing N N 340 TRP CZ2 CH2 doub Y N 341 TRP CZ2 HZ2 sing N N 342 TRP CZ3 CH2 sing Y N 343 TRP CZ3 HZ3 sing N N 344 TRP CH2 HH2 sing N N 345 TRP OXT HXT sing N N 346 TYR N CA sing N N 347 TYR N H sing N N 348 TYR N H2 sing N N 349 TYR CA C sing N N 350 TYR CA CB sing N N 351 TYR CA HA sing N N 352 TYR C O doub N N 353 TYR C OXT sing N N 354 TYR CB CG sing N N 355 TYR CB HB2 sing N N 356 TYR CB HB3 sing N N 357 TYR CG CD1 doub Y N 358 TYR CG CD2 sing Y N 359 TYR CD1 CE1 sing Y N 360 TYR CD1 HD1 sing N N 361 TYR CD2 CE2 doub Y N 362 TYR CD2 HD2 sing N N 363 TYR CE1 CZ doub Y N 364 TYR CE1 HE1 sing N N 365 TYR CE2 CZ sing Y N 366 TYR CE2 HE2 sing N N 367 TYR CZ OH sing N N 368 TYR OH HH sing N N 369 TYR OXT HXT sing N N 370 VAL N CA sing N N 371 VAL N H sing N N 372 VAL N H2 sing N N 373 VAL CA C sing N N 374 VAL CA CB sing N N 375 VAL CA HA sing N N 376 VAL C O doub N N 377 VAL C OXT sing N N 378 VAL CB CG1 sing N N 379 VAL CB CG2 sing N N 380 VAL CB HB sing N N 381 VAL CG1 HG11 sing N N 382 VAL CG1 HG12 sing N N 383 VAL CG1 HG13 sing N N 384 VAL CG2 HG21 sing N N 385 VAL CG2 HG22 sing N N 386 VAL CG2 HG23 sing N N 387 VAL OXT HXT sing N N 388 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Polish National Science Centre' Poland 2017/27/N/NZ6/02328 1 'Foundation for Polish Science' Poland 'TEAM TECH CORE FACILITY/2017-4/6' 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'Homodimer indicated by PDBePISA and by similarity to previously known structures.' # _space_group.name_H-M_alt 'P 62' _space_group.name_Hall 'P 62' _space_group.IT_number 171 _space_group.crystal_system hexagonal _space_group.id 1 #