data_8CD4 # _entry.id 8CD4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8CD4 pdb_00008cd4 10.2210/pdb8cd4/pdb WWPDB D_1292127982 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-02-21 2 'Structure model' 1 1 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8CD4 _pdbx_database_status.recvd_initial_deposition_date 2023-01-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'contains the same protein diffracted at 296K' _pdbx_database_related.db_id 8C5K _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email redecke@biochem.uni-luebeck.de _pdbx_contact_author.name_first Lars _pdbx_contact_author.name_last Redecke _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5938-9431 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Boger, J.' 1 0000-0003-2030-4370 'Schoenherr, R.' 2 0000-0003-3850-4215 'Lahey-Rudolph, J.M.' 3 0000-0001-5279-7267 'Harms, M.' 4 ? 'Kaiser, J.' 5 ? 'Nachtschatt, S.' 6 ? 'Wobbe, M.' 7 ? 'Koenig, P.' 8 ? 'Bourenkov, G.' 9 0000-0002-2617-5920 'Schneider, T.' 10 ? 'Redecke, L.' 11 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 15 _citation.language ? _citation.page_first 1709 _citation.page_last 1709 _citation.title 'A streamlined approach to structure elucidation using in cellulo crystallized recombinant proteins, InCellCryst.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-024-45985-7 _citation.pdbx_database_id_PubMed 38402242 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schonherr, R.' 1 ? primary 'Boger, J.' 2 0000-0003-2030-4370 primary 'Lahey-Rudolph, J.M.' 3 0000-0001-5279-7267 primary 'Harms, M.' 4 ? primary 'Kaiser, J.' 5 0009-0006-8058-9469 primary 'Nachtschatt, S.' 6 0009-0000-8144-1534 primary 'Wobbe, M.' 7 ? primary 'Duden, R.' 8 ? primary 'Konig, P.' 9 ? primary 'Bourenkov, G.' 10 0000-0002-2617-5920 primary 'Schneider, T.R.' 11 0000-0001-6955-7374 primary 'Redecke, L.' 12 0000-0002-5938-9431 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Woronin body major protein' 19221.742 1 ? ? ? ? 2 water nat water 18.015 90 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGYYDDDAHGHVEADAAPRATTGTGTGSASQTVTIPCHHIRLGDILILQGRPCQVIRISTSAATGQHRYLGVDLFTKQLH EESSFVSNPAPSVVVQTMLGPVFKQYRVLDMQDGSIVAMTETGDVKQNLPVIDQSSLWNRLQKAFESGRGSVRVLVVSDH GREMAVDMKVVHGSRLA ; _entity_poly.pdbx_seq_one_letter_code_can ;MGYYDDDAHGHVEADAAPRATTGTGTGSASQTVTIPCHHIRLGDILILQGRPCQVIRISTSAATGQHRYLGVDLFTKQLH EESSFVSNPAPSVVVQTMLGPVFKQYRVLDMQDGSIVAMTETGDVKQNLPVIDQSSLWNRLQKAFESGRGSVRVLVVSDH GREMAVDMKVVHGSRLA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 TYR n 1 4 TYR n 1 5 ASP n 1 6 ASP n 1 7 ASP n 1 8 ALA n 1 9 HIS n 1 10 GLY n 1 11 HIS n 1 12 VAL n 1 13 GLU n 1 14 ALA n 1 15 ASP n 1 16 ALA n 1 17 ALA n 1 18 PRO n 1 19 ARG n 1 20 ALA n 1 21 THR n 1 22 THR n 1 23 GLY n 1 24 THR n 1 25 GLY n 1 26 THR n 1 27 GLY n 1 28 SER n 1 29 ALA n 1 30 SER n 1 31 GLN n 1 32 THR n 1 33 VAL n 1 34 THR n 1 35 ILE n 1 36 PRO n 1 37 CYS n 1 38 HIS n 1 39 HIS n 1 40 ILE n 1 41 ARG n 1 42 LEU n 1 43 GLY n 1 44 ASP n 1 45 ILE n 1 46 LEU n 1 47 ILE n 1 48 LEU n 1 49 GLN n 1 50 GLY n 1 51 ARG n 1 52 PRO n 1 53 CYS n 1 54 GLN n 1 55 VAL n 1 56 ILE n 1 57 ARG n 1 58 ILE n 1 59 SER n 1 60 THR n 1 61 SER n 1 62 ALA n 1 63 ALA n 1 64 THR n 1 65 GLY n 1 66 GLN n 1 67 HIS n 1 68 ARG n 1 69 TYR n 1 70 LEU n 1 71 GLY n 1 72 VAL n 1 73 ASP n 1 74 LEU n 1 75 PHE n 1 76 THR n 1 77 LYS n 1 78 GLN n 1 79 LEU n 1 80 HIS n 1 81 GLU n 1 82 GLU n 1 83 SER n 1 84 SER n 1 85 PHE n 1 86 VAL n 1 87 SER n 1 88 ASN n 1 89 PRO n 1 90 ALA n 1 91 PRO n 1 92 SER n 1 93 VAL n 1 94 VAL n 1 95 VAL n 1 96 GLN n 1 97 THR n 1 98 MET n 1 99 LEU n 1 100 GLY n 1 101 PRO n 1 102 VAL n 1 103 PHE n 1 104 LYS n 1 105 GLN n 1 106 TYR n 1 107 ARG n 1 108 VAL n 1 109 LEU n 1 110 ASP n 1 111 MET n 1 112 GLN n 1 113 ASP n 1 114 GLY n 1 115 SER n 1 116 ILE n 1 117 VAL n 1 118 ALA n 1 119 MET n 1 120 THR n 1 121 GLU n 1 122 THR n 1 123 GLY n 1 124 ASP n 1 125 VAL n 1 126 LYS n 1 127 GLN n 1 128 ASN n 1 129 LEU n 1 130 PRO n 1 131 VAL n 1 132 ILE n 1 133 ASP n 1 134 GLN n 1 135 SER n 1 136 SER n 1 137 LEU n 1 138 TRP n 1 139 ASN n 1 140 ARG n 1 141 LEU n 1 142 GLN n 1 143 LYS n 1 144 ALA n 1 145 PHE n 1 146 GLU n 1 147 SER n 1 148 GLY n 1 149 ARG n 1 150 GLY n 1 151 SER n 1 152 VAL n 1 153 ARG n 1 154 VAL n 1 155 LEU n 1 156 VAL n 1 157 VAL n 1 158 SER n 1 159 ASP n 1 160 HIS n 1 161 GLY n 1 162 ARG n 1 163 GLU n 1 164 MET n 1 165 ALA n 1 166 VAL n 1 167 ASP n 1 168 MET n 1 169 LYS n 1 170 VAL n 1 171 VAL n 1 172 HIS n 1 173 GLY n 1 174 SER n 1 175 ARG n 1 176 LEU n 1 177 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 177 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'hex-1, NCU08332' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Neurospora crassa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5141 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Trichoplusia ni' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7111 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line 'High Five' _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 TYR 3 3 ? ? ? A . n A 1 4 TYR 4 4 ? ? ? A . n A 1 5 ASP 5 5 ? ? ? A . n A 1 6 ASP 6 6 ? ? ? A . n A 1 7 ASP 7 7 ? ? ? A . n A 1 8 ALA 8 8 ? ? ? A . n A 1 9 HIS 9 9 ? ? ? A . n A 1 10 GLY 10 10 ? ? ? A . n A 1 11 HIS 11 11 ? ? ? A . n A 1 12 VAL 12 12 ? ? ? A . n A 1 13 GLU 13 13 ? ? ? A . n A 1 14 ALA 14 14 ? ? ? A . n A 1 15 ASP 15 15 ? ? ? A . n A 1 16 ALA 16 16 ? ? ? A . n A 1 17 ALA 17 17 ? ? ? A . n A 1 18 PRO 18 18 ? ? ? A . n A 1 19 ARG 19 19 ? ? ? A . n A 1 20 ALA 20 20 ? ? ? A . n A 1 21 THR 21 21 ? ? ? A . n A 1 22 THR 22 22 ? ? ? A . n A 1 23 GLY 23 23 ? ? ? A . n A 1 24 THR 24 24 ? ? ? A . n A 1 25 GLY 25 25 ? ? ? A . n A 1 26 THR 26 26 ? ? ? A . n A 1 27 GLY 27 27 ? ? ? A . n A 1 28 SER 28 28 ? ? ? A . n A 1 29 ALA 29 29 ? ? ? A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 MET 119 119 119 MET MET A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 TRP 138 138 138 TRP TRP A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 HIS 160 160 160 HIS HIS A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 MET 164 164 164 MET MET A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 MET 168 168 168 MET MET A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 GLY 173 173 ? ? ? A . n A 1 174 SER 174 174 ? ? ? A . n A 1 175 ARG 175 175 ? ? ? A . n A 1 176 LEU 176 176 ? ? ? A . n A 1 177 ALA 177 177 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 55 HOH HOH A . B 2 HOH 2 202 59 HOH HOH A . B 2 HOH 3 203 32 HOH HOH A . B 2 HOH 4 204 89 HOH HOH A . B 2 HOH 5 205 20 HOH HOH A . B 2 HOH 6 206 27 HOH HOH A . B 2 HOH 7 207 11 HOH HOH A . B 2 HOH 8 208 9 HOH HOH A . B 2 HOH 9 209 42 HOH HOH A . B 2 HOH 10 210 22 HOH HOH A . B 2 HOH 11 211 39 HOH HOH A . B 2 HOH 12 212 25 HOH HOH A . B 2 HOH 13 213 2 HOH HOH A . B 2 HOH 14 214 18 HOH HOH A . B 2 HOH 15 215 66 HOH HOH A . B 2 HOH 16 216 81 HOH HOH A . B 2 HOH 17 217 28 HOH HOH A . B 2 HOH 18 218 1 HOH HOH A . B 2 HOH 19 219 14 HOH HOH A . B 2 HOH 20 220 17 HOH HOH A . B 2 HOH 21 221 38 HOH HOH A . B 2 HOH 22 222 21 HOH HOH A . B 2 HOH 23 223 10 HOH HOH A . B 2 HOH 24 224 12 HOH HOH A . B 2 HOH 25 225 6 HOH HOH A . B 2 HOH 26 226 24 HOH HOH A . B 2 HOH 27 227 16 HOH HOH A . B 2 HOH 28 228 68 HOH HOH A . B 2 HOH 29 229 49 HOH HOH A . B 2 HOH 30 230 4 HOH HOH A . B 2 HOH 31 231 88 HOH HOH A . B 2 HOH 32 232 3 HOH HOH A . B 2 HOH 33 233 69 HOH HOH A . B 2 HOH 34 234 67 HOH HOH A . B 2 HOH 35 235 26 HOH HOH A . B 2 HOH 36 236 75 HOH HOH A . B 2 HOH 37 237 13 HOH HOH A . B 2 HOH 38 238 54 HOH HOH A . B 2 HOH 39 239 30 HOH HOH A . B 2 HOH 40 240 5 HOH HOH A . B 2 HOH 41 241 46 HOH HOH A . B 2 HOH 42 242 29 HOH HOH A . B 2 HOH 43 243 36 HOH HOH A . B 2 HOH 44 244 77 HOH HOH A . B 2 HOH 45 245 45 HOH HOH A . B 2 HOH 46 246 23 HOH HOH A . B 2 HOH 47 247 52 HOH HOH A . B 2 HOH 48 248 34 HOH HOH A . B 2 HOH 49 249 51 HOH HOH A . B 2 HOH 50 250 86 HOH HOH A . B 2 HOH 51 251 53 HOH HOH A . B 2 HOH 52 252 64 HOH HOH A . B 2 HOH 53 253 19 HOH HOH A . B 2 HOH 54 254 8 HOH HOH A . B 2 HOH 55 255 37 HOH HOH A . B 2 HOH 56 256 44 HOH HOH A . B 2 HOH 57 257 43 HOH HOH A . B 2 HOH 58 258 7 HOH HOH A . B 2 HOH 59 259 65 HOH HOH A . B 2 HOH 60 260 83 HOH HOH A . B 2 HOH 61 261 60 HOH HOH A . B 2 HOH 62 262 15 HOH HOH A . B 2 HOH 63 263 73 HOH HOH A . B 2 HOH 64 264 56 HOH HOH A . B 2 HOH 65 265 72 HOH HOH A . B 2 HOH 66 266 41 HOH HOH A . B 2 HOH 67 267 40 HOH HOH A . B 2 HOH 68 268 61 HOH HOH A . B 2 HOH 69 269 58 HOH HOH A . B 2 HOH 70 270 85 HOH HOH A . B 2 HOH 71 271 57 HOH HOH A . B 2 HOH 72 272 70 HOH HOH A . B 2 HOH 73 273 71 HOH HOH A . B 2 HOH 74 274 90 HOH HOH A . B 2 HOH 75 275 78 HOH HOH A . B 2 HOH 76 276 62 HOH HOH A . B 2 HOH 77 277 82 HOH HOH A . B 2 HOH 78 278 87 HOH HOH A . B 2 HOH 79 279 63 HOH HOH A . B 2 HOH 80 280 79 HOH HOH A . B 2 HOH 81 281 74 HOH HOH A . B 2 HOH 82 282 35 HOH HOH A . B 2 HOH 83 283 76 HOH HOH A . B 2 HOH 84 284 50 HOH HOH A . B 2 HOH 85 285 80 HOH HOH A . B 2 HOH 86 286 33 HOH HOH A . B 2 HOH 87 287 84 HOH HOH A . B 2 HOH 88 288 47 HOH HOH A . B 2 HOH 89 289 31 HOH HOH A . B 2 HOH 90 290 48 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 31 ? CG ? A GLN 31 CG 2 1 Y 1 A GLN 31 ? CD ? A GLN 31 CD 3 1 Y 1 A GLN 31 ? OE1 ? A GLN 31 OE1 4 1 Y 1 A GLN 31 ? NE2 ? A GLN 31 NE2 5 1 Y 1 A GLN 112 ? CG ? A GLN 112 CG 6 1 Y 1 A GLN 112 ? CD ? A GLN 112 CD 7 1 Y 1 A GLN 112 ? OE1 ? A GLN 112 OE1 8 1 Y 1 A GLN 112 ? NE2 ? A GLN 112 NE2 9 1 Y 1 A ASP 113 ? CG ? A ASP 113 CG 10 1 Y 1 A ASP 113 ? OD1 ? A ASP 113 OD1 11 1 Y 1 A ASP 113 ? OD2 ? A ASP 113 OD2 12 1 Y 1 A LYS 143 ? CG ? A LYS 143 CG 13 1 Y 1 A LYS 143 ? CD ? A LYS 143 CD 14 1 Y 1 A LYS 143 ? CE ? A LYS 143 CE 15 1 Y 1 A LYS 143 ? NZ ? A LYS 143 NZ 16 1 Y 1 A GLU 146 ? CG ? A GLU 146 CG 17 1 Y 1 A GLU 146 ? CD ? A GLU 146 CD 18 1 Y 1 A GLU 146 ? OE1 ? A GLU 146 OE1 19 1 Y 1 A GLU 146 ? OE2 ? A GLU 146 OE2 20 1 Y 1 A ARG 162 ? CG ? A ARG 162 CG 21 1 Y 1 A ARG 162 ? CD ? A ARG 162 CD 22 1 Y 1 A ARG 162 ? NE ? A ARG 162 NE 23 1 Y 1 A ARG 162 ? CZ ? A ARG 162 CZ 24 1 Y 1 A ARG 162 ? NH1 ? A ARG 162 NH1 25 1 Y 1 A ARG 162 ? NH2 ? A ARG 162 NH2 26 1 Y 1 A LYS 169 ? CG ? A LYS 169 CG 27 1 Y 1 A LYS 169 ? CD ? A LYS 169 CD 28 1 Y 1 A LYS 169 ? CE ? A LYS 169 CE 29 1 Y 1 A LYS 169 ? NZ ? A LYS 169 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8CD4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.950 _cell.length_a_esd ? _cell.length_b 57.950 _cell.length_b_esd ? _cell.length_c 192.600 _cell.length_c_esd ? _cell.volume 560136.399 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8CD4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall 'P 65 2 (x,y,z+1/12)' _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8CD4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.35 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'IN CELL' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'baculovirus infected and grown in Trichoplusia ni (High Five) cells in adhesion culture (MOI 1)' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 300 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment Y # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-08-24 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P14 (MX2)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P14 (MX2)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate 31.65 _reflns.entry_id 8CD4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.83 _reflns.d_resolution_low 50.19 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 31913 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.92 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1382 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.16 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.9994 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.83 _reflns_shell.d_res_low 1.895 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1730 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.2745 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 39.19 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8CD4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.83 _refine.ls_d_res_low 50.19 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 31913 _refine.ls_number_reflns_R_free 2375 _refine.ls_number_reflns_R_work 29538 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.95 _refine.ls_percent_reflns_R_free 7.44 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1934 _refine.ls_R_factor_R_free 0.2144 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1918 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1khi _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.9115 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2358 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.83 _refine_hist.d_res_low 50.19 _refine_hist.number_atoms_solvent 90 _refine_hist.number_atoms_total 1170 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1080 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0105 ? 1116 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.0157 ? 1520 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0789 ? 183 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0075 ? 196 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.0522 ? 406 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.83 1.87 . . 144 1754 99.32 . . . . 0.3662 . . . . . . . . . . . 0.3690 'X-RAY DIFFRACTION' 1.87 1.91 . . 140 1693 99.95 . . . . 0.3225 . . . . . . . . . . . 0.3295 'X-RAY DIFFRACTION' 1.91 1.95 . . 142 1757 99.89 . . . . 0.2848 . . . . . . . . . . . 0.3187 'X-RAY DIFFRACTION' 1.95 2.00 . . 143 1744 100.00 . . . . 0.2567 . . . . . . . . . . . 0.2913 'X-RAY DIFFRACTION' 2.00 2.06 . . 137 1719 100.00 . . . . 0.2178 . . . . . . . . . . . 0.2658 'X-RAY DIFFRACTION' 2.06 2.12 . . 138 1727 100.00 . . . . 0.1997 . . . . . . . . . . . 0.2749 'X-RAY DIFFRACTION' 2.12 2.18 . . 144 1752 100.00 . . . . 0.1925 . . . . . . . . . . . 0.2088 'X-RAY DIFFRACTION' 2.18 2.26 . . 130 1743 99.95 . . . . 0.1900 . . . . . . . . . . . 0.2703 'X-RAY DIFFRACTION' 2.26 2.35 . . 141 1724 100.00 . . . . 0.1879 . . . . . . . . . . . 0.2086 'X-RAY DIFFRACTION' 2.35 2.46 . . 145 1751 100.00 . . . . 0.1940 . . . . . . . . . . . 0.2104 'X-RAY DIFFRACTION' 2.46 2.59 . . 139 1718 100.00 . . . . 0.1984 . . . . . . . . . . . 0.2441 'X-RAY DIFFRACTION' 2.59 2.75 . . 137 1764 100.00 . . . . 0.1913 . . . . . . . . . . . 0.2713 'X-RAY DIFFRACTION' 2.75 2.96 . . 139 1716 100.00 . . . . 0.1905 . . . . . . . . . . . 0.2135 'X-RAY DIFFRACTION' 2.96 3.26 . . 140 1748 100.00 . . . . 0.2058 . . . . . . . . . . . 0.2395 'X-RAY DIFFRACTION' 3.26 3.73 . . 139 1741 100.00 . . . . 0.1675 . . . . . . . . . . . 0.1929 'X-RAY DIFFRACTION' 3.73 4.70 . . 135 1741 100.00 . . . . 0.1586 . . . . . . . . . . . 0.1569 'X-RAY DIFFRACTION' 4.71 50.19 . . 142 1746 100.00 . . . . 0.1883 . . . . . . . . . . . 0.1884 # _struct.entry_id 8CD4 _struct.title 'structure of HEX-1 from N. crassa crystallized in cellulo (cytosol), diffracted at 100K and resolved using CrystFEL' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8CD4 _struct_keywords.text 'naturally crystallizing, Woronin body, self-assembly, HEX-1, in vivo, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HEX1_NEUCR _struct_ref.pdbx_db_accession P87252 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGYYDDDAHGHVEADAAPRATTGTGTGSASQTVTIPCHHIRLGDILILQGRPCQVIRISTSAATGQHRYLGVDLFTKQLH EESSFVSNPAPSVVVQTMLGPVFKQYRVLDMQDGSIVAMTETGDVKQNLPVIDQSSLWNRLQKAFESGRGSVRVLVVSDH GREMAVDMKVVHGSRL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8CD4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 176 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P87252 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 176 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 176 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8CD4 _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 177 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P87252 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'cloning artifact' _struct_ref_seq_dif.pdbx_auth_seq_num 177 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8380 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 38 ? ILE A 40 ? HIS A 38 ILE A 40 5 ? 3 HELX_P HELX_P2 AA2 SER A 136 ? GLY A 148 ? SER A 136 GLY A 148 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? AA3 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 32 ? PRO A 36 ? THR A 32 PRO A 36 AA1 2 VAL A 93 ? PRO A 101 ? VAL A 93 PRO A 101 AA1 3 PHE A 85 ? ALA A 90 ? PHE A 85 ALA A 90 AA2 1 ILE A 45 ? LEU A 48 ? ILE A 45 LEU A 48 AA2 2 ARG A 51 ? THR A 60 ? ARG A 51 THR A 60 AA2 3 HIS A 67 ? ASP A 73 ? HIS A 67 ASP A 73 AA2 4 LEU A 79 ? SER A 83 ? LEU A 79 SER A 83 AA3 1 VAL A 125 ? PRO A 130 ? VAL A 125 PRO A 130 AA3 2 SER A 115 ? MET A 119 ? SER A 115 MET A 119 AA3 3 LYS A 104 ? GLN A 112 ? LYS A 104 GLN A 112 AA3 4 VAL A 152 ? ASP A 159 ? VAL A 152 ASP A 159 AA3 5 ARG A 162 ? VAL A 170 ? ARG A 162 VAL A 170 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 35 ? N ILE A 35 O MET A 98 ? O MET A 98 AA1 2 3 O VAL A 95 ? O VAL A 95 N SER A 87 ? N SER A 87 AA2 1 2 N LEU A 48 ? N LEU A 48 O ARG A 51 ? O ARG A 51 AA2 2 3 N ILE A 56 ? N ILE A 56 O LEU A 70 ? O LEU A 70 AA2 3 4 N GLY A 71 ? N GLY A 71 O HIS A 80 ? O HIS A 80 AA3 1 2 O LYS A 126 ? O LYS A 126 N ALA A 118 ? N ALA A 118 AA3 2 3 O VAL A 117 ? O VAL A 117 N LEU A 109 ? N LEU A 109 AA3 3 4 N LYS A 104 ? N LYS A 104 O VAL A 156 ? O VAL A 156 AA3 4 5 N ASP A 159 ? N ASP A 159 O ARG A 162 ? O ARG A 162 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLN _pdbx_validate_close_contact.auth_seq_id_1 127 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 201 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.14 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 267 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+5/6 3 y,-x+y,z+1/6 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 x-y,-y,-z 7 -x,-x+y,-z+1/3 8 -x,-y,z+1/2 9 y,x,-z+2/3 10 -y,-x,-z+1/6 11 -x+y,y,-z+1/2 12 x,x-y,-z+5/6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A TYR 3 ? A TYR 3 4 1 Y 1 A TYR 4 ? A TYR 4 5 1 Y 1 A ASP 5 ? A ASP 5 6 1 Y 1 A ASP 6 ? A ASP 6 7 1 Y 1 A ASP 7 ? A ASP 7 8 1 Y 1 A ALA 8 ? A ALA 8 9 1 Y 1 A HIS 9 ? A HIS 9 10 1 Y 1 A GLY 10 ? A GLY 10 11 1 Y 1 A HIS 11 ? A HIS 11 12 1 Y 1 A VAL 12 ? A VAL 12 13 1 Y 1 A GLU 13 ? A GLU 13 14 1 Y 1 A ALA 14 ? A ALA 14 15 1 Y 1 A ASP 15 ? A ASP 15 16 1 Y 1 A ALA 16 ? A ALA 16 17 1 Y 1 A ALA 17 ? A ALA 17 18 1 Y 1 A PRO 18 ? A PRO 18 19 1 Y 1 A ARG 19 ? A ARG 19 20 1 Y 1 A ALA 20 ? A ALA 20 21 1 Y 1 A THR 21 ? A THR 21 22 1 Y 1 A THR 22 ? A THR 22 23 1 Y 1 A GLY 23 ? A GLY 23 24 1 Y 1 A THR 24 ? A THR 24 25 1 Y 1 A GLY 25 ? A GLY 25 26 1 Y 1 A THR 26 ? A THR 26 27 1 Y 1 A GLY 27 ? A GLY 27 28 1 Y 1 A SER 28 ? A SER 28 29 1 Y 1 A ALA 29 ? A ALA 29 30 1 Y 1 A GLY 173 ? A GLY 173 31 1 Y 1 A SER 174 ? A SER 174 32 1 Y 1 A ARG 175 ? A ARG 175 33 1 Y 1 A LEU 176 ? A LEU 176 34 1 Y 1 A ALA 177 ? A ALA 177 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'German Federal Ministry for Education and Research' Germany 'FoeKz 05K18FLA, InCellSX' 1 'Joachim Herz Stiftung' Germany 'PhD scholarship' 2 'German Research Foundation (DFG)' Germany EXC306 3 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1khi _pdbx_initial_refinement_model.details ? # _pdbx_serial_crystallography_sample_delivery.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery.description ? _pdbx_serial_crystallography_sample_delivery.method 'fixed target' # _pdbx_serial_crystallography_sample_delivery_fixed_target.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery_fixed_target.description 'Micro mesh mount' _pdbx_serial_crystallography_sample_delivery_fixed_target.sample_holding mesh _pdbx_serial_crystallography_sample_delivery_fixed_target.support_base goniometer _pdbx_serial_crystallography_sample_delivery_fixed_target.sample_unit_size ? _pdbx_serial_crystallography_sample_delivery_fixed_target.crystals_per_unit ? _pdbx_serial_crystallography_sample_delivery_fixed_target.sample_solvent ? _pdbx_serial_crystallography_sample_delivery_fixed_target.sample_dehydration_prevention ? _pdbx_serial_crystallography_sample_delivery_fixed_target.motion_control ? _pdbx_serial_crystallography_sample_delivery_fixed_target.velocity_horizontal ? _pdbx_serial_crystallography_sample_delivery_fixed_target.velocity_vertical ? _pdbx_serial_crystallography_sample_delivery_fixed_target.details ? # _space_group.name_H-M_alt 'P 65 2 2' _space_group.name_Hall 'P 65 2 (x,y,z+1/12)' _space_group.IT_number 179 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 8CD4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017256 _atom_sites.fract_transf_matrix[1][2] 0.009963 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019926 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005192 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_