data_8CMS # _entry.id 8CMS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8CMS pdb_00008cms 10.2210/pdb8cms/pdb WWPDB D_1292127497 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-11-15 2 'Structure model' 1 1 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_entry_details 2 2 'Structure model' pdbx_modification_feature # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8CMS _pdbx_database_status.recvd_initial_deposition_date 2023-02-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email p.p.geurink@lumc.nl _pdbx_contact_author.name_first Paul _pdbx_contact_author.name_last Geurink _pdbx_contact_author.name_mi P _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1849-1111 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gan, J.' 1 0000-0002-8785-3035 'de Vries, J.' 2 0000-0001-6723-0511 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Chem.Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1554-8937 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 18 _citation.language ? _citation.page_first 2003 _citation.page_last 2013 _citation.title 'Cellular Validation of a Chemically Improved Inhibitor Identifies Monoubiquitination on OTUB2.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acschembio.3c00227 _citation.pdbx_database_id_PubMed 37642399 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gan, J.' 1 0000-0002-8785-3035 primary 'de Vries, J.' 2 ? primary 'Akkermans, J.J.L.L.' 3 0000-0002-8000-7952 primary 'Mohammed, Y.' 4 0000-0003-3265-3332 primary 'Tjokrodirijo, R.T.N.' 5 ? primary 'de Ru, A.H.' 6 ? primary 'Kim, R.Q.' 7 0000-0003-1834-8673 primary 'Vargas, D.A.' 8 ? primary 'Pol, V.' 9 ? primary 'Fasan, R.' 10 0000-0003-4636-9578 primary 'van Veelen, P.A.' 11 0000-0002-7898-9408 primary 'Neefjes, J.' 12 ? primary 'van Dam, H.' 13 ? primary 'Ovaa, H.' 14 0000-0002-0068-054X primary 'Sapmaz, A.' 15 0000-0003-3942-7602 primary 'Geurink, P.P.' 16 0000-0003-1849-1111 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ubiquitin thioesterase OTUB2' 27405.096 1 3.4.19.12 ? ? ? 2 non-polymer syn "(1~{S},2~{S})-~{N}'-ethanoyl-2-(3-methylphenyl)cyclopropane-1-carbohydrazide" 232.278 1 ? ? ? ? 3 water nat water 18.015 64 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Deubiquitinating enzyme OTUB2,OTU domain-containing ubiquitin aldehyde-binding protein 2,Otubain-2,Ubiquitin-specific-processing protease OTUB2 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPMSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSREIFKFKERV LQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTSAFIRNRADFFRHFIDEEM DIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVYLLYKTSHYNILYAADKH ; _entity_poly.pdbx_seq_one_letter_code_can ;GPMSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSREIFKFKERV LQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTSAFIRNRADFFRHFIDEEM DIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVYLLYKTSHYNILYAADKH ; _entity_poly.pdbx_strand_id AAA _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "(1~{S},2~{S})-~{N}'-ethanoyl-2-(3-methylphenyl)cyclopropane-1-carbohydrazide" V2X 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 MET n 1 4 SER n 1 5 GLU n 1 6 THR n 1 7 SER n 1 8 PHE n 1 9 ASN n 1 10 LEU n 1 11 ILE n 1 12 SER n 1 13 GLU n 1 14 LYS n 1 15 CYS n 1 16 ASP n 1 17 ILE n 1 18 LEU n 1 19 SER n 1 20 ILE n 1 21 LEU n 1 22 ARG n 1 23 ASP n 1 24 HIS n 1 25 PRO n 1 26 GLU n 1 27 ASN n 1 28 ARG n 1 29 ILE n 1 30 TYR n 1 31 ARG n 1 32 ARG n 1 33 LYS n 1 34 ILE n 1 35 GLU n 1 36 GLU n 1 37 LEU n 1 38 SER n 1 39 LYS n 1 40 ARG n 1 41 PHE n 1 42 THR n 1 43 ALA n 1 44 ILE n 1 45 ARG n 1 46 LYS n 1 47 THR n 1 48 LYS n 1 49 GLY n 1 50 ASP n 1 51 GLY n 1 52 ASN n 1 53 CYS n 1 54 PHE n 1 55 TYR n 1 56 ARG n 1 57 ALA n 1 58 LEU n 1 59 GLY n 1 60 TYR n 1 61 SER n 1 62 TYR n 1 63 LEU n 1 64 GLU n 1 65 SER n 1 66 LEU n 1 67 LEU n 1 68 GLY n 1 69 LYS n 1 70 SER n 1 71 ARG n 1 72 GLU n 1 73 ILE n 1 74 PHE n 1 75 LYS n 1 76 PHE n 1 77 LYS n 1 78 GLU n 1 79 ARG n 1 80 VAL n 1 81 LEU n 1 82 GLN n 1 83 THR n 1 84 PRO n 1 85 ASN n 1 86 ASP n 1 87 LEU n 1 88 LEU n 1 89 ALA n 1 90 ALA n 1 91 GLY n 1 92 PHE n 1 93 GLU n 1 94 GLU n 1 95 HIS n 1 96 LYS n 1 97 PHE n 1 98 ARG n 1 99 ASN n 1 100 PHE n 1 101 PHE n 1 102 ASN n 1 103 ALA n 1 104 PHE n 1 105 TYR n 1 106 SER n 1 107 VAL n 1 108 VAL n 1 109 GLU n 1 110 LEU n 1 111 VAL n 1 112 GLU n 1 113 LYS n 1 114 ASP n 1 115 GLY n 1 116 SER n 1 117 VAL n 1 118 SER n 1 119 SER n 1 120 LEU n 1 121 LEU n 1 122 LYS n 1 123 VAL n 1 124 PHE n 1 125 ASN n 1 126 ASP n 1 127 GLN n 1 128 SER n 1 129 ALA n 1 130 SER n 1 131 ASP n 1 132 HIS n 1 133 ILE n 1 134 VAL n 1 135 GLN n 1 136 PHE n 1 137 LEU n 1 138 ARG n 1 139 LEU n 1 140 LEU n 1 141 THR n 1 142 SER n 1 143 ALA n 1 144 PHE n 1 145 ILE n 1 146 ARG n 1 147 ASN n 1 148 ARG n 1 149 ALA n 1 150 ASP n 1 151 PHE n 1 152 PHE n 1 153 ARG n 1 154 HIS n 1 155 PHE n 1 156 ILE n 1 157 ASP n 1 158 GLU n 1 159 GLU n 1 160 MET n 1 161 ASP n 1 162 ILE n 1 163 LYS n 1 164 ASP n 1 165 PHE n 1 166 CYS n 1 167 THR n 1 168 HIS n 1 169 GLU n 1 170 VAL n 1 171 GLU n 1 172 PRO n 1 173 MET n 1 174 ALA n 1 175 THR n 1 176 GLU n 1 177 CYS n 1 178 ASP n 1 179 HIS n 1 180 ILE n 1 181 GLN n 1 182 ILE n 1 183 THR n 1 184 ALA n 1 185 LEU n 1 186 SER n 1 187 GLN n 1 188 ALA n 1 189 LEU n 1 190 SER n 1 191 ILE n 1 192 ALA n 1 193 LEU n 1 194 GLN n 1 195 VAL n 1 196 GLU n 1 197 TYR n 1 198 VAL n 1 199 ASP n 1 200 GLU n 1 201 MET n 1 202 ASP n 1 203 THR n 1 204 ALA n 1 205 LEU n 1 206 ASN n 1 207 HIS n 1 208 HIS n 1 209 VAL n 1 210 PHE n 1 211 PRO n 1 212 GLU n 1 213 ALA n 1 214 ALA n 1 215 THR n 1 216 PRO n 1 217 SER n 1 218 VAL n 1 219 TYR n 1 220 LEU n 1 221 LEU n 1 222 TYR n 1 223 LYS n 1 224 THR n 1 225 SER n 1 226 HIS n 1 227 TYR n 1 228 ASN n 1 229 ILE n 1 230 LEU n 1 231 TYR n 1 232 ALA n 1 233 ALA n 1 234 ASP n 1 235 LYS n 1 236 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 236 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'OTUB2, C14orf137, OTB2, OTU2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 V2X non-polymer . "(1~{S},2~{S})-~{N}'-ethanoyl-2-(3-methylphenyl)cyclopropane-1-carbohydrazide" ? 'C13 H16 N2 O2' 232.278 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? AAA . n A 1 2 PRO 2 0 ? ? ? AAA . n A 1 3 MET 3 1 ? ? ? AAA . n A 1 4 SER 4 2 ? ? ? AAA . n A 1 5 GLU 5 3 ? ? ? AAA . n A 1 6 THR 6 4 ? ? ? AAA . n A 1 7 SER 7 5 ? ? ? AAA . n A 1 8 PHE 8 6 6 PHE PHE AAA . n A 1 9 ASN 9 7 7 ASN ASN AAA . n A 1 10 LEU 10 8 8 LEU LEU AAA . n A 1 11 ILE 11 9 9 ILE ILE AAA . n A 1 12 SER 12 10 10 SER SER AAA . n A 1 13 GLU 13 11 11 GLU GLU AAA . n A 1 14 LYS 14 12 12 LYS LYS AAA . n A 1 15 CYS 15 13 13 CYS CYS AAA . n A 1 16 ASP 16 14 14 ASP ASP AAA . n A 1 17 ILE 17 15 15 ILE ILE AAA . n A 1 18 LEU 18 16 16 LEU LEU AAA . n A 1 19 SER 19 17 17 SER SER AAA . n A 1 20 ILE 20 18 18 ILE ILE AAA . n A 1 21 LEU 21 19 19 LEU LEU AAA . n A 1 22 ARG 22 20 20 ARG ARG AAA . n A 1 23 ASP 23 21 21 ASP ASP AAA . n A 1 24 HIS 24 22 22 HIS HIS AAA . n A 1 25 PRO 25 23 23 PRO PRO AAA . n A 1 26 GLU 26 24 24 GLU GLU AAA . n A 1 27 ASN 27 25 25 ASN ASN AAA . n A 1 28 ARG 28 26 26 ARG ARG AAA . n A 1 29 ILE 29 27 27 ILE ILE AAA . n A 1 30 TYR 30 28 28 TYR TYR AAA . n A 1 31 ARG 31 29 29 ARG ARG AAA . n A 1 32 ARG 32 30 30 ARG ARG AAA . n A 1 33 LYS 33 31 31 LYS LYS AAA . n A 1 34 ILE 34 32 32 ILE ILE AAA . n A 1 35 GLU 35 33 33 GLU GLU AAA . n A 1 36 GLU 36 34 34 GLU GLU AAA . n A 1 37 LEU 37 35 35 LEU LEU AAA . n A 1 38 SER 38 36 36 SER SER AAA . n A 1 39 LYS 39 37 37 LYS LYS AAA . n A 1 40 ARG 40 38 38 ARG ARG AAA . n A 1 41 PHE 41 39 39 PHE PHE AAA . n A 1 42 THR 42 40 40 THR THR AAA . n A 1 43 ALA 43 41 41 ALA ALA AAA . n A 1 44 ILE 44 42 42 ILE ILE AAA . n A 1 45 ARG 45 43 43 ARG ARG AAA . n A 1 46 LYS 46 44 44 LYS LYS AAA . n A 1 47 THR 47 45 45 THR THR AAA . n A 1 48 LYS 48 46 46 LYS LYS AAA . n A 1 49 GLY 49 47 47 GLY GLY AAA . n A 1 50 ASP 50 48 48 ASP ASP AAA . n A 1 51 GLY 51 49 49 GLY GLY AAA . n A 1 52 ASN 52 50 50 ASN ASN AAA . n A 1 53 CYS 53 51 51 CYS CYS AAA . n A 1 54 PHE 54 52 52 PHE PHE AAA . n A 1 55 TYR 55 53 53 TYR TYR AAA . n A 1 56 ARG 56 54 54 ARG ARG AAA . n A 1 57 ALA 57 55 55 ALA ALA AAA . n A 1 58 LEU 58 56 56 LEU LEU AAA . n A 1 59 GLY 59 57 57 GLY GLY AAA . n A 1 60 TYR 60 58 58 TYR TYR AAA . n A 1 61 SER 61 59 59 SER SER AAA . n A 1 62 TYR 62 60 60 TYR TYR AAA . n A 1 63 LEU 63 61 61 LEU LEU AAA . n A 1 64 GLU 64 62 62 GLU GLU AAA . n A 1 65 SER 65 63 63 SER SER AAA . n A 1 66 LEU 66 64 64 LEU LEU AAA . n A 1 67 LEU 67 65 65 LEU LEU AAA . n A 1 68 GLY 68 66 66 GLY GLY AAA . n A 1 69 LYS 69 67 67 LYS LYS AAA . n A 1 70 SER 70 68 68 SER SER AAA . n A 1 71 ARG 71 69 69 ARG ARG AAA . n A 1 72 GLU 72 70 70 GLU GLU AAA . n A 1 73 ILE 73 71 71 ILE ILE AAA . n A 1 74 PHE 74 72 72 PHE PHE AAA . n A 1 75 LYS 75 73 73 LYS LYS AAA . n A 1 76 PHE 76 74 74 PHE PHE AAA . n A 1 77 LYS 77 75 75 LYS LYS AAA . n A 1 78 GLU 78 76 76 GLU GLU AAA . n A 1 79 ARG 79 77 77 ARG ARG AAA . n A 1 80 VAL 80 78 78 VAL VAL AAA . n A 1 81 LEU 81 79 79 LEU LEU AAA . n A 1 82 GLN 82 80 80 GLN GLN AAA . n A 1 83 THR 83 81 81 THR THR AAA . n A 1 84 PRO 84 82 82 PRO PRO AAA . n A 1 85 ASN 85 83 83 ASN ASN AAA . n A 1 86 ASP 86 84 84 ASP ASP AAA . n A 1 87 LEU 87 85 85 LEU LEU AAA . n A 1 88 LEU 88 86 86 LEU LEU AAA . n A 1 89 ALA 89 87 87 ALA ALA AAA . n A 1 90 ALA 90 88 88 ALA ALA AAA . n A 1 91 GLY 91 89 89 GLY GLY AAA . n A 1 92 PHE 92 90 90 PHE PHE AAA . n A 1 93 GLU 93 91 91 GLU GLU AAA . n A 1 94 GLU 94 92 92 GLU GLU AAA . n A 1 95 HIS 95 93 93 HIS HIS AAA . n A 1 96 LYS 96 94 94 LYS LYS AAA . n A 1 97 PHE 97 95 95 PHE PHE AAA . n A 1 98 ARG 98 96 96 ARG ARG AAA . n A 1 99 ASN 99 97 97 ASN ASN AAA . n A 1 100 PHE 100 98 98 PHE PHE AAA . n A 1 101 PHE 101 99 99 PHE PHE AAA . n A 1 102 ASN 102 100 100 ASN ASN AAA . n A 1 103 ALA 103 101 101 ALA ALA AAA . n A 1 104 PHE 104 102 102 PHE PHE AAA . n A 1 105 TYR 105 103 103 TYR TYR AAA . n A 1 106 SER 106 104 104 SER SER AAA . n A 1 107 VAL 107 105 105 VAL VAL AAA . n A 1 108 VAL 108 106 106 VAL VAL AAA . n A 1 109 GLU 109 107 107 GLU GLU AAA . n A 1 110 LEU 110 108 108 LEU LEU AAA . n A 1 111 VAL 111 109 109 VAL VAL AAA . n A 1 112 GLU 112 110 110 GLU GLU AAA . n A 1 113 LYS 113 111 111 LYS LYS AAA . n A 1 114 ASP 114 112 112 ASP ASP AAA . n A 1 115 GLY 115 113 113 GLY GLY AAA . n A 1 116 SER 116 114 114 SER SER AAA . n A 1 117 VAL 117 115 115 VAL VAL AAA . n A 1 118 SER 118 116 116 SER SER AAA . n A 1 119 SER 119 117 117 SER SER AAA . n A 1 120 LEU 120 118 118 LEU LEU AAA . n A 1 121 LEU 121 119 119 LEU LEU AAA . n A 1 122 LYS 122 120 120 LYS LYS AAA . n A 1 123 VAL 123 121 121 VAL VAL AAA . n A 1 124 PHE 124 122 122 PHE PHE AAA . n A 1 125 ASN 125 123 123 ASN ASN AAA . n A 1 126 ASP 126 124 124 ASP ASP AAA . n A 1 127 GLN 127 125 125 GLN GLN AAA . n A 1 128 SER 128 126 126 SER SER AAA . n A 1 129 ALA 129 127 127 ALA ALA AAA . n A 1 130 SER 130 128 128 SER SER AAA . n A 1 131 ASP 131 129 129 ASP ASP AAA . n A 1 132 HIS 132 130 130 HIS HIS AAA . n A 1 133 ILE 133 131 131 ILE ILE AAA . n A 1 134 VAL 134 132 132 VAL VAL AAA . n A 1 135 GLN 135 133 133 GLN GLN AAA . n A 1 136 PHE 136 134 134 PHE PHE AAA . n A 1 137 LEU 137 135 135 LEU LEU AAA . n A 1 138 ARG 138 136 136 ARG ARG AAA . n A 1 139 LEU 139 137 137 LEU LEU AAA . n A 1 140 LEU 140 138 138 LEU LEU AAA . n A 1 141 THR 141 139 139 THR THR AAA . n A 1 142 SER 142 140 140 SER SER AAA . n A 1 143 ALA 143 141 141 ALA ALA AAA . n A 1 144 PHE 144 142 142 PHE PHE AAA . n A 1 145 ILE 145 143 143 ILE ILE AAA . n A 1 146 ARG 146 144 144 ARG ARG AAA . n A 1 147 ASN 147 145 145 ASN ASN AAA . n A 1 148 ARG 148 146 146 ARG ARG AAA . n A 1 149 ALA 149 147 147 ALA ALA AAA . n A 1 150 ASP 150 148 148 ASP ASP AAA . n A 1 151 PHE 151 149 149 PHE PHE AAA . n A 1 152 PHE 152 150 150 PHE PHE AAA . n A 1 153 ARG 153 151 151 ARG ARG AAA . n A 1 154 HIS 154 152 152 HIS HIS AAA . n A 1 155 PHE 155 153 153 PHE PHE AAA . n A 1 156 ILE 156 154 154 ILE ILE AAA . n A 1 157 ASP 157 155 155 ASP ASP AAA . n A 1 158 GLU 158 156 156 GLU GLU AAA . n A 1 159 GLU 159 157 157 GLU GLU AAA . n A 1 160 MET 160 158 158 MET MET AAA . n A 1 161 ASP 161 159 159 ASP ASP AAA . n A 1 162 ILE 162 160 160 ILE ILE AAA . n A 1 163 LYS 163 161 161 LYS LYS AAA . n A 1 164 ASP 164 162 162 ASP ASP AAA . n A 1 165 PHE 165 163 163 PHE PHE AAA . n A 1 166 CYS 166 164 164 CYS CYS AAA . n A 1 167 THR 167 165 165 THR THR AAA . n A 1 168 HIS 168 166 166 HIS HIS AAA . n A 1 169 GLU 169 167 167 GLU GLU AAA . n A 1 170 VAL 170 168 168 VAL VAL AAA . n A 1 171 GLU 171 169 169 GLU GLU AAA . n A 1 172 PRO 172 170 170 PRO PRO AAA . n A 1 173 MET 173 171 171 MET MET AAA . n A 1 174 ALA 174 172 172 ALA ALA AAA . n A 1 175 THR 175 173 173 THR THR AAA . n A 1 176 GLU 176 174 174 GLU GLU AAA . n A 1 177 CYS 177 175 175 CYS CYS AAA . n A 1 178 ASP 178 176 176 ASP ASP AAA . n A 1 179 HIS 179 177 177 HIS HIS AAA . n A 1 180 ILE 180 178 178 ILE ILE AAA . n A 1 181 GLN 181 179 179 GLN GLN AAA . n A 1 182 ILE 182 180 180 ILE ILE AAA . n A 1 183 THR 183 181 181 THR THR AAA . n A 1 184 ALA 184 182 182 ALA ALA AAA . n A 1 185 LEU 185 183 183 LEU LEU AAA . n A 1 186 SER 186 184 184 SER SER AAA . n A 1 187 GLN 187 185 185 GLN GLN AAA . n A 1 188 ALA 188 186 186 ALA ALA AAA . n A 1 189 LEU 189 187 187 LEU LEU AAA . n A 1 190 SER 190 188 188 SER SER AAA . n A 1 191 ILE 191 189 189 ILE ILE AAA . n A 1 192 ALA 192 190 190 ALA ALA AAA . n A 1 193 LEU 193 191 191 LEU LEU AAA . n A 1 194 GLN 194 192 192 GLN GLN AAA . n A 1 195 VAL 195 193 193 VAL VAL AAA . n A 1 196 GLU 196 194 194 GLU GLU AAA . n A 1 197 TYR 197 195 195 TYR TYR AAA . n A 1 198 VAL 198 196 196 VAL VAL AAA . n A 1 199 ASP 199 197 197 ASP ASP AAA . n A 1 200 GLU 200 198 198 GLU GLU AAA . n A 1 201 MET 201 199 199 MET MET AAA . n A 1 202 ASP 202 200 200 ASP ASP AAA . n A 1 203 THR 203 201 201 THR THR AAA . n A 1 204 ALA 204 202 202 ALA ALA AAA . n A 1 205 LEU 205 203 203 LEU LEU AAA . n A 1 206 ASN 206 204 204 ASN ASN AAA . n A 1 207 HIS 207 205 205 HIS HIS AAA . n A 1 208 HIS 208 206 206 HIS HIS AAA . n A 1 209 VAL 209 207 207 VAL VAL AAA . n A 1 210 PHE 210 208 208 PHE PHE AAA . n A 1 211 PRO 211 209 209 PRO PRO AAA . n A 1 212 GLU 212 210 210 GLU GLU AAA . n A 1 213 ALA 213 211 211 ALA ALA AAA . n A 1 214 ALA 214 212 212 ALA ALA AAA . n A 1 215 THR 215 213 213 THR THR AAA . n A 1 216 PRO 216 214 214 PRO PRO AAA . n A 1 217 SER 217 215 215 SER SER AAA . n A 1 218 VAL 218 216 216 VAL VAL AAA . n A 1 219 TYR 219 217 217 TYR TYR AAA . n A 1 220 LEU 220 218 218 LEU LEU AAA . n A 1 221 LEU 221 219 219 LEU LEU AAA . n A 1 222 TYR 222 220 220 TYR TYR AAA . n A 1 223 LYS 223 221 221 LYS LYS AAA . n A 1 224 THR 224 222 222 THR THR AAA . n A 1 225 SER 225 223 223 SER SER AAA . n A 1 226 HIS 226 224 224 HIS HIS AAA . n A 1 227 TYR 227 225 225 TYR TYR AAA . n A 1 228 ASN 228 226 226 ASN ASN AAA . n A 1 229 ILE 229 227 227 ILE ILE AAA . n A 1 230 LEU 230 228 228 LEU LEU AAA . n A 1 231 TYR 231 229 229 TYR TYR AAA . n A 1 232 ALA 232 230 230 ALA ALA AAA . n A 1 233 ALA 233 231 231 ALA ALA AAA . n A 1 234 ASP 234 232 ? ? ? AAA . n A 1 235 LYS 235 233 ? ? ? AAA . n A 1 236 HIS 236 234 ? ? ? AAA . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id V2X _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id V2X _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 V2X 1 301 301 V2X V45 AAA . C 3 HOH 1 401 27 HOH HOH AAA . C 3 HOH 2 402 132 HOH HOH AAA . C 3 HOH 3 403 58 HOH HOH AAA . C 3 HOH 4 404 61 HOH HOH AAA . C 3 HOH 5 405 32 HOH HOH AAA . C 3 HOH 6 406 63 HOH HOH AAA . C 3 HOH 7 407 15 HOH HOH AAA . C 3 HOH 8 408 31 HOH HOH AAA . C 3 HOH 9 409 91 HOH HOH AAA . C 3 HOH 10 410 73 HOH HOH AAA . C 3 HOH 11 411 12 HOH HOH AAA . C 3 HOH 12 412 36 HOH HOH AAA . C 3 HOH 13 413 50 HOH HOH AAA . C 3 HOH 14 414 72 HOH HOH AAA . C 3 HOH 15 415 118 HOH HOH AAA . C 3 HOH 16 416 45 HOH HOH AAA . C 3 HOH 17 417 56 HOH HOH AAA . C 3 HOH 18 418 5 HOH HOH AAA . C 3 HOH 19 419 17 HOH HOH AAA . C 3 HOH 20 420 3 HOH HOH AAA . C 3 HOH 21 421 42 HOH HOH AAA . C 3 HOH 22 422 14 HOH HOH AAA . C 3 HOH 23 423 85 HOH HOH AAA . C 3 HOH 24 424 89 HOH HOH AAA . C 3 HOH 25 425 116 HOH HOH AAA . C 3 HOH 26 426 29 HOH HOH AAA . C 3 HOH 27 427 37 HOH HOH AAA . C 3 HOH 28 428 30 HOH HOH AAA . C 3 HOH 29 429 9 HOH HOH AAA . C 3 HOH 30 430 21 HOH HOH AAA . C 3 HOH 31 431 67 HOH HOH AAA . C 3 HOH 32 432 34 HOH HOH AAA . C 3 HOH 33 433 23 HOH HOH AAA . C 3 HOH 34 434 20 HOH HOH AAA . C 3 HOH 35 435 2 HOH HOH AAA . C 3 HOH 36 436 10 HOH HOH AAA . C 3 HOH 37 437 62 HOH HOH AAA . C 3 HOH 38 438 54 HOH HOH AAA . C 3 HOH 39 439 68 HOH HOH AAA . C 3 HOH 40 440 11 HOH HOH AAA . C 3 HOH 41 441 7 HOH HOH AAA . C 3 HOH 42 442 6 HOH HOH AAA . C 3 HOH 43 443 8 HOH HOH AAA . C 3 HOH 44 444 78 HOH HOH AAA . C 3 HOH 45 445 44 HOH HOH AAA . C 3 HOH 46 446 121 HOH HOH AAA . C 3 HOH 47 447 80 HOH HOH AAA . C 3 HOH 48 448 39 HOH HOH AAA . C 3 HOH 49 449 24 HOH HOH AAA . C 3 HOH 50 450 28 HOH HOH AAA . C 3 HOH 51 451 22 HOH HOH AAA . C 3 HOH 52 452 84 HOH HOH AAA . C 3 HOH 53 453 4 HOH HOH AAA . C 3 HOH 54 454 41 HOH HOH AAA . C 3 HOH 55 455 87 HOH HOH AAA . C 3 HOH 56 456 131 HOH HOH AAA . C 3 HOH 57 457 43 HOH HOH AAA . C 3 HOH 58 458 25 HOH HOH AAA . C 3 HOH 59 459 47 HOH HOH AAA . C 3 HOH 60 460 76 HOH HOH AAA . C 3 HOH 61 461 100 HOH HOH AAA . C 3 HOH 62 462 35 HOH HOH AAA . C 3 HOH 63 463 79 HOH HOH AAA . C 3 HOH 64 464 70 HOH HOH AAA . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 96.050 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8CMS _cell.details ? _cell.formula_units_Z ? _cell.length_a 47.650 _cell.length_a_esd ? _cell.length_b 45.250 _cell.length_b_esd ? _cell.length_c 58.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8CMS _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8CMS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.27 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.79 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;20 %v/v 2-Propanol 13 %w/v PEG 4K 0.1 M HEPES pH 8 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-02-16 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.92 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8CMS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.77 _reflns.d_resolution_low 47.43 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24095 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.142 _reflns.pdbx_Rpim_I_all 0.077 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.994 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.118 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.77 _reflns_shell.d_res_low 1.81 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1360 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.7 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.985 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.338 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.6 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.295 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.805 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] -0.657 _refine.aniso_B[2][2] -0.279 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -0.378 _refine.B_iso_max ? _refine.B_iso_mean 25.720 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.952 _refine.correlation_coeff_Fo_to_Fc_free 0.929 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8CMS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.770 _refine.ls_d_res_low 47.430 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24082 _refine.ls_number_reflns_R_free 1229 _refine.ls_number_reflns_R_work 22853 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.591 _refine.ls_percent_reflns_R_free 5.103 _refine.ls_R_factor_all 0.212 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2521 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2099 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.136 _refine.pdbx_overall_ESU_R_Free 0.133 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.127 _refine.overall_SU_ML 0.120 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1857 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 17 _refine_hist.number_atoms_solvent 64 _refine_hist.number_atoms_total 1938 _refine_hist.d_res_high 1.770 _refine_hist.d_res_low 47.430 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.013 1924 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1761 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.654 1.636 2597 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.408 1.586 4071 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.988 5.000 227 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 29.263 21.842 114 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.396 15.000 336 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 8.610 15.000 1 ? r_dihedral_angle_other_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.980 15.000 14 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.081 0.200 248 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 2200 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 446 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.218 0.200 414 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.177 0.200 1668 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.180 0.200 941 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.078 0.200 967 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.150 0.200 75 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.123 0.200 1 ? r_symmetry_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.373 0.200 14 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.215 0.200 55 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.223 0.200 3 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 2.120 2.454 908 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.103 2.452 907 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.186 3.675 1136 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.180 3.674 1136 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.399 2.966 1016 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.398 2.968 1017 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 5.370 4.275 1458 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.368 4.278 1459 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 6.628 29.126 2159 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 6.633 29.108 2153 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.770 1.816 . . 88 1694 99.6644 . . . . 0.371 . . . . . . . . . . . 0.400 'X-RAY DIFFRACTION' 1.816 1.866 . . 90 1610 99.8238 . . . . 0.331 . . . . . . . . . . . 0.354 'X-RAY DIFFRACTION' 1.866 1.920 . . 78 1615 99.5297 . . . . 0.303 . . . . . . . . . . . 0.309 'X-RAY DIFFRACTION' 1.920 1.979 . . 99 1540 99.5143 . . . . 0.290 . . . . . . . . . . . 0.301 'X-RAY DIFFRACTION' 1.979 2.044 . . 81 1479 99.7442 . . . . 0.254 . . . . . . . . . . . 0.305 'X-RAY DIFFRACTION' 2.044 2.115 . . 67 1453 99.2815 . . . . 0.239 . . . . . . . . . . . 0.266 'X-RAY DIFFRACTION' 2.115 2.195 . . 78 1393 99.8642 . . . . 0.219 . . . . . . . . . . . 0.261 'X-RAY DIFFRACTION' 2.195 2.284 . . 80 1361 99.6542 . . . . 0.209 . . . . . . . . . . . 0.240 'X-RAY DIFFRACTION' 2.284 2.386 . . 73 1296 99.7813 . . . . 0.194 . . . . . . . . . . . 0.235 'X-RAY DIFFRACTION' 2.386 2.502 . . 71 1225 99.8459 . . . . 0.197 . . . . . . . . . . . 0.270 'X-RAY DIFFRACTION' 2.502 2.637 . . 57 1204 99.5264 . . . . 0.180 . . . . . . . . . . . 0.292 'X-RAY DIFFRACTION' 2.637 2.797 . . 62 1094 99.7412 . . . . 0.201 . . . . . . . . . . . 0.223 'X-RAY DIFFRACTION' 2.797 2.989 . . 56 1053 99.5512 . . . . 0.202 . . . . . . . . . . . 0.288 'X-RAY DIFFRACTION' 2.989 3.228 . . 50 991 99.4269 . . . . 0.219 . . . . . . . . . . . 0.258 'X-RAY DIFFRACTION' 3.228 3.535 . . 54 890 99.7886 . . . . 0.202 . . . . . . . . . . . 0.256 'X-RAY DIFFRACTION' 3.535 3.951 . . 51 813 99.1963 . . . . 0.173 . . . . . . . . . . . 0.165 'X-RAY DIFFRACTION' 3.951 4.558 . . 35 727 99.4778 . . . . 0.155 . . . . . . . . . . . 0.178 'X-RAY DIFFRACTION' 4.558 5.574 . . 23 633 98.9442 . . . . 0.174 . . . . . . . . . . . 0.244 'X-RAY DIFFRACTION' 5.574 7.846 . . 24 491 99.4209 . . . . 0.232 . . . . . . . . . . . 0.290 'X-RAY DIFFRACTION' 7.846 47.43 . . 12 291 99.0196 . . . . 0.196 . . . . . . . . . . . 0.284 # _struct.entry_id 8CMS _struct.title 'OTUB2 in covalent complex with LN5P45' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8CMS _struct_keywords.text 'Chemical modification, ubiquitin, deubiquitinase, inhibitor, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code OTUB2_HUMAN _struct_ref.pdbx_db_accession Q96DC9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSREIFKFKERVLQ TPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTSAFIRNRADFFRHFIDEEMDI KDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVYLLYKTSHYNILYAADKH ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8CMS _struct_ref_seq.pdbx_strand_id AAA _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 236 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96DC9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 234 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 234 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8CMS GLY AAA 1 ? UNP Q96DC9 ? ? 'expression tag' -1 1 1 8CMS PRO AAA 2 ? UNP Q96DC9 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 11620 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details 'Single compound bound to active site cysteine (confirmed with mutant)' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 18 ? ASP A 23 ? LEU AAA 16 ASP AAA 21 1 ? 6 HELX_P HELX_P2 AA2 HIS A 24 ? ILE A 29 ? HIS AAA 22 ILE AAA 27 5 ? 6 HELX_P HELX_P3 AA3 TYR A 30 ? ARG A 40 ? TYR AAA 28 ARG AAA 38 1 ? 11 HELX_P HELX_P4 AA4 ASN A 52 ? LEU A 66 ? ASN AAA 50 LEU AAA 64 1 ? 15 HELX_P HELX_P5 AA5 LYS A 69 ? ALA A 90 ? LYS AAA 67 ALA AAA 88 1 ? 22 HELX_P HELX_P6 AA6 GLU A 93 ? LYS A 113 ? GLU AAA 91 LYS AAA 111 1 ? 21 HELX_P HELX_P7 AA7 SER A 116 ? ASN A 125 ? SER AAA 114 ASN AAA 123 1 ? 10 HELX_P HELX_P8 AA8 ASP A 126 ? ARG A 148 ? ASP AAA 124 ARG AAA 146 1 ? 23 HELX_P HELX_P9 AA9 ARG A 148 ? ARG A 153 ? ARG AAA 146 ARG AAA 151 1 ? 6 HELX_P HELX_P10 AB1 HIS A 154 ? ILE A 156 ? HIS AAA 152 ILE AAA 154 5 ? 3 HELX_P HELX_P11 AB2 ASP A 161 ? VAL A 170 ? ASP AAA 159 VAL AAA 168 1 ? 10 HELX_P HELX_P12 AB3 ASP A 178 ? LEU A 189 ? ASP AAA 176 LEU AAA 187 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 53 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id V2X _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C11 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id AAA _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 51 _struct_conn.ptnr2_auth_asym_id AAA _struct_conn.ptnr2_auth_comp_id V2X _struct_conn.ptnr2_auth_seq_id 301 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.648 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id V2X _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 53 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id V2X _pdbx_modification_feature.auth_asym_id AAA _pdbx_modification_feature.auth_seq_id 301 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id AAA _pdbx_modification_feature.modified_residue_auth_seq_id 51 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C11 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id V2X _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 15 ? ASP A 16 ? CYS AAA 13 ASP AAA 14 AA1 2 PHE A 41 ? ARG A 45 ? PHE AAA 39 ARG AAA 43 AA1 3 HIS A 226 ? ALA A 232 ? HIS AAA 224 ALA AAA 230 AA1 4 VAL A 218 ? LYS A 223 ? VAL AAA 216 LYS AAA 221 AA1 5 LEU A 193 ? TYR A 197 ? LEU AAA 191 TYR AAA 195 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N CYS A 15 ? N CYS AAA 13 O ILE A 44 ? O ILE AAA 42 AA1 2 3 N ARG A 45 ? N ARG AAA 43 O ILE A 229 ? O ILE AAA 227 AA1 3 4 O ASN A 228 ? O ASN AAA 226 N LEU A 221 ? N LEU AAA 219 AA1 4 5 O TYR A 222 ? O TYR AAA 220 N GLU A 196 ? N GLU AAA 194 # _pdbx_entry_details.entry_id 8CMS _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OH _pdbx_validate_symm_contact.auth_asym_id_1 AAA _pdbx_validate_symm_contact.auth_comp_id_1 TYR _pdbx_validate_symm_contact.auth_seq_id_1 103 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NE2 _pdbx_validate_symm_contact.auth_asym_id_2 AAA _pdbx_validate_symm_contact.auth_comp_id_2 HIS _pdbx_validate_symm_contact.auth_seq_id_2 152 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_546 _pdbx_validate_symm_contact.dist 1.98 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS AAA 67 ? ? -105.13 77.43 2 1 LYS AAA 111 ? ? -92.23 53.37 3 1 ASP AAA 112 ? ? 76.99 -41.22 4 1 ASP AAA 155 ? ? -8.85 115.94 5 1 VAL AAA 168 ? ? -124.65 -55.27 6 1 ASP AAA 176 ? ? -123.77 -169.70 7 1 ASP AAA 176 ? ? -110.63 -169.70 8 1 ALA AAA 202 ? ? -34.06 114.63 9 1 THR AAA 222 ? ? 39.55 71.96 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ILE _pdbx_validate_peptide_omega.auth_asym_id_1 AAA _pdbx_validate_peptide_omega.auth_seq_id_1 154 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ASP _pdbx_validate_peptide_omega.auth_asym_id_2 AAA _pdbx_validate_peptide_omega.auth_seq_id_2 155 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 148.34 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AAA GLY -1 ? A GLY 1 2 1 Y 1 AAA PRO 0 ? A PRO 2 3 1 Y 1 AAA MET 1 ? A MET 3 4 1 Y 1 AAA SER 2 ? A SER 4 5 1 Y 1 AAA GLU 3 ? A GLU 5 6 1 Y 1 AAA THR 4 ? A THR 6 7 1 Y 1 AAA SER 5 ? A SER 7 8 1 Y 1 AAA ASP 232 ? A ASP 234 9 1 Y 1 AAA LYS 233 ? A LYS 235 10 1 Y 1 AAA HIS 234 ? A HIS 236 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TYR N N N N 321 TYR CA C N S 322 TYR C C N N 323 TYR O O N N 324 TYR CB C N N 325 TYR CG C Y N 326 TYR CD1 C Y N 327 TYR CD2 C Y N 328 TYR CE1 C Y N 329 TYR CE2 C Y N 330 TYR CZ C Y N 331 TYR OH O N N 332 TYR OXT O N N 333 TYR H H N N 334 TYR H2 H N N 335 TYR HA H N N 336 TYR HB2 H N N 337 TYR HB3 H N N 338 TYR HD1 H N N 339 TYR HD2 H N N 340 TYR HE1 H N N 341 TYR HE2 H N N 342 TYR HH H N N 343 TYR HXT H N N 344 V2X C10 C N N 345 V2X C11 C N N 346 V2X C12 C Y N 347 V2X C1 C Y N 348 V2X C2 C Y N 349 V2X C3 C Y N 350 V2X C4 C Y N 351 V2X C5 C Y N 352 V2X C6 C N S 353 V2X C7 C N N 354 V2X O1 O N N 355 V2X N1 N N N 356 V2X N N N N 357 V2X C9 C N N 358 V2X O O N N 359 V2X C8 C N S 360 V2X C C N N 361 V2X H1 H N N 362 V2X H2 H N N 363 V2X H3 H N N 364 V2X H4 H N N 365 V2X H5 H N N 366 V2X H6 H N N 367 V2X H7 H N N 368 V2X H8 H N N 369 V2X H9 H N N 370 V2X H10 H N N 371 V2X H11 H N N 372 V2X H12 H N N 373 V2X H13 H N N 374 V2X H14 H N N 375 V2X H15 H N N 376 V2X H16 H N N 377 VAL N N N N 378 VAL CA C N S 379 VAL C C N N 380 VAL O O N N 381 VAL CB C N N 382 VAL CG1 C N N 383 VAL CG2 C N N 384 VAL OXT O N N 385 VAL H H N N 386 VAL H2 H N N 387 VAL HA H N N 388 VAL HB H N N 389 VAL HG11 H N N 390 VAL HG12 H N N 391 VAL HG13 H N N 392 VAL HG21 H N N 393 VAL HG22 H N N 394 VAL HG23 H N N 395 VAL HXT H N N 396 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 V2X C C1 sing N N 330 V2X C1 C2 doub Y N 331 V2X C1 C12 sing Y N 332 V2X C2 C3 sing Y N 333 V2X C12 C5 doub Y N 334 V2X C3 C4 doub Y N 335 V2X C5 C4 sing Y N 336 V2X C5 C6 sing N N 337 V2X C6 C7 sing N N 338 V2X C6 C8 sing N N 339 V2X C7 C8 sing N N 340 V2X C8 C9 sing N N 341 V2X O C9 doub N N 342 V2X C9 N sing N N 343 V2X N N1 sing N N 344 V2X N1 C10 sing N N 345 V2X O1 C10 doub N N 346 V2X C10 C11 sing N N 347 V2X C11 H1 sing N N 348 V2X C11 H2 sing N N 349 V2X C11 H3 sing N N 350 V2X C12 H4 sing N N 351 V2X C2 H5 sing N N 352 V2X C3 H6 sing N N 353 V2X C4 H7 sing N N 354 V2X C6 H8 sing N N 355 V2X C7 H9 sing N N 356 V2X C7 H10 sing N N 357 V2X N1 H11 sing N N 358 V2X N H12 sing N N 359 V2X C8 H13 sing N N 360 V2X C H14 sing N N 361 V2X C H15 sing N N 362 V2X C H16 sing N N 363 VAL N CA sing N N 364 VAL N H sing N N 365 VAL N H2 sing N N 366 VAL CA C sing N N 367 VAL CA CB sing N N 368 VAL CA HA sing N N 369 VAL C O doub N N 370 VAL C OXT sing N N 371 VAL CB CG1 sing N N 372 VAL CB CG2 sing N N 373 VAL CB HB sing N N 374 VAL CG1 HG11 sing N N 375 VAL CG1 HG12 sing N N 376 VAL CG1 HG13 sing N N 377 VAL CG2 HG21 sing N N 378 VAL CG2 HG22 sing N N 379 VAL CG2 HG23 sing N N 380 VAL OXT HXT sing N N 381 # _pdbx_audit_support.funding_organization 'Netherlands Organisation for Scientific Research (NWO)' _pdbx_audit_support.country Netherlands _pdbx_audit_support.grant_number 724.013.002 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5QIO _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8CMS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020986 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002224 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022099 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017338 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 CL 17 17 11.460 0.010 7.196 1.166 6.255 18.519 1.645 47.778 -9.366 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.030 # loop_ #