data_8D6E # _entry.id 8D6E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8D6E pdb_00008d6e 10.2210/pdb8d6e/pdb WWPDB D_1000266031 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8D6E _pdbx_database_status.recvd_initial_deposition_date 2022-06-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pau, V.P.T.' 1 0000-0002-3093-2330 'Mao, D.Y.L.' 2 0000-0001-9562-7225 'Mader, P.' 3 0000-0002-0820-2761 'Orlicky, S.' 4 0000-0002-8172-2042 'Sicheri, F.' 5 0000-0002-9824-2117 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 10251 _citation.page_last 10284 _citation.title 'Discovery of an Orally Bioavailable and Selective PKMYT1 Inhibitor, RP-6306.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.2c00552 _citation.pdbx_database_id_PubMed 35880755 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Szychowski, J.' 1 ? primary 'Papp, R.' 2 ? primary 'Dietrich, E.' 3 ? primary 'Liu, B.' 4 ? primary 'Vallee, F.' 5 ? primary 'Leclaire, M.E.' 6 ? primary 'Fourtounis, J.' 7 ? primary 'Martino, G.' 8 ? primary 'Perryman, A.L.' 9 ? primary 'Pau, V.' 10 ? primary 'Yin, S.Y.' 11 ? primary 'Mader, P.' 12 ? primary 'Roulston, A.' 13 ? primary 'Truchon, J.F.' 14 ? primary 'Marshall, C.G.' 15 ? primary 'Diallo, M.' 16 ? primary 'Duffy, N.M.' 17 ? primary 'Stocco, R.' 18 ? primary 'Godbout, C.' 19 ? primary 'Bonneau-Fortin, A.' 20 ? primary 'Kryczka, R.' 21 ? primary 'Bhaskaran, V.' 22 ? primary 'Mao, D.' 23 ? primary 'Orlicky, S.' 24 ? primary 'Beaulieu, P.' 25 ? primary 'Turcotte, P.' 26 ? primary 'Kurinov, I.' 27 ? primary 'Sicheri, F.' 28 ? primary 'Mamane, Y.' 29 ? primary 'Gallant, M.' 30 ? primary 'Black, W.C.' 31 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 109.870 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8D6E _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.243 _cell.length_a_esd ? _cell.length_b 112.014 _cell.length_b_esd ? _cell.length_c 72.978 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8D6E _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase' 34498.133 2 2.7.11.1 ? 'KINASE DOMAIN, UNP RESIDUES 75-362' ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 non-polymer syn '(1P)-2-amino-1-(3-hydroxy-2,6-dimethylphenyl)-5,6-dimethyl-1H-pyrrolo[2,3-b]pyridine-3-carboxamide' 324.377 2 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 3 ? ? ? ? 5 non-polymer syn 1,2-ETHANEDIOL 62.068 12 ? ? ? ? 6 water nat water 18.015 94 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Myt1 kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGVDLGTENLYFQSMHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKE DGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQVW GYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFS LGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLRQP ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGVDLGTENLYFQSMHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKE DGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQVW GYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFS LGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLRQP ; _entity_poly.pdbx_strand_id B,A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 VAL n 1 12 ASP n 1 13 LEU n 1 14 GLY n 1 15 THR n 1 16 GLU n 1 17 ASN n 1 18 LEU n 1 19 TYR n 1 20 PHE n 1 21 GLN n 1 22 SER n 1 23 MET n 1 24 HIS n 1 25 GLN n 1 26 LEU n 1 27 GLN n 1 28 PRO n 1 29 ARG n 1 30 ARG n 1 31 VAL n 1 32 SER n 1 33 PHE n 1 34 ARG n 1 35 GLY n 1 36 GLU n 1 37 ALA n 1 38 SER n 1 39 GLU n 1 40 THR n 1 41 LEU n 1 42 GLN n 1 43 SER n 1 44 PRO n 1 45 GLY n 1 46 TYR n 1 47 ASP n 1 48 PRO n 1 49 SER n 1 50 ARG n 1 51 PRO n 1 52 GLU n 1 53 SER n 1 54 PHE n 1 55 PHE n 1 56 GLN n 1 57 GLN n 1 58 SER n 1 59 PHE n 1 60 GLN n 1 61 ARG n 1 62 LEU n 1 63 SER n 1 64 ARG n 1 65 LEU n 1 66 GLY n 1 67 HIS n 1 68 GLY n 1 69 SER n 1 70 TYR n 1 71 GLY n 1 72 GLU n 1 73 VAL n 1 74 PHE n 1 75 LYS n 1 76 VAL n 1 77 ARG n 1 78 SER n 1 79 LYS n 1 80 GLU n 1 81 ASP n 1 82 GLY n 1 83 ARG n 1 84 LEU n 1 85 TYR n 1 86 ALA n 1 87 VAL n 1 88 LYS n 1 89 ARG n 1 90 SER n 1 91 MET n 1 92 SER n 1 93 PRO n 1 94 PHE n 1 95 ARG n 1 96 GLY n 1 97 PRO n 1 98 LYS n 1 99 ASP n 1 100 ARG n 1 101 ALA n 1 102 ARG n 1 103 LYS n 1 104 LEU n 1 105 ALA n 1 106 GLU n 1 107 VAL n 1 108 GLY n 1 109 SER n 1 110 HIS n 1 111 GLU n 1 112 LYS n 1 113 VAL n 1 114 GLY n 1 115 GLN n 1 116 HIS n 1 117 PRO n 1 118 CYS n 1 119 CYS n 1 120 VAL n 1 121 ARG n 1 122 LEU n 1 123 GLU n 1 124 GLN n 1 125 ALA n 1 126 TRP n 1 127 GLU n 1 128 GLU n 1 129 GLY n 1 130 GLY n 1 131 ILE n 1 132 LEU n 1 133 TYR n 1 134 LEU n 1 135 GLN n 1 136 THR n 1 137 GLU n 1 138 LEU n 1 139 CYS n 1 140 GLY n 1 141 PRO n 1 142 SER n 1 143 LEU n 1 144 GLN n 1 145 GLN n 1 146 HIS n 1 147 CYS n 1 148 GLU n 1 149 ALA n 1 150 TRP n 1 151 GLY n 1 152 ALA n 1 153 SER n 1 154 LEU n 1 155 PRO n 1 156 GLU n 1 157 ALA n 1 158 GLN n 1 159 VAL n 1 160 TRP n 1 161 GLY n 1 162 TYR n 1 163 LEU n 1 164 ARG n 1 165 ASP n 1 166 THR n 1 167 LEU n 1 168 LEU n 1 169 ALA n 1 170 LEU n 1 171 ALA n 1 172 HIS n 1 173 LEU n 1 174 HIS n 1 175 SER n 1 176 GLN n 1 177 GLY n 1 178 LEU n 1 179 VAL n 1 180 HIS n 1 181 LEU n 1 182 ASP n 1 183 VAL n 1 184 LYS n 1 185 PRO n 1 186 ALA n 1 187 ASN n 1 188 ILE n 1 189 PHE n 1 190 LEU n 1 191 GLY n 1 192 PRO n 1 193 ARG n 1 194 GLY n 1 195 ARG n 1 196 CYS n 1 197 LYS n 1 198 LEU n 1 199 GLY n 1 200 ASP n 1 201 PHE n 1 202 GLY n 1 203 LEU n 1 204 LEU n 1 205 VAL n 1 206 GLU n 1 207 LEU n 1 208 GLY n 1 209 THR n 1 210 ALA n 1 211 GLY n 1 212 ALA n 1 213 GLY n 1 214 GLU n 1 215 VAL n 1 216 GLN n 1 217 GLU n 1 218 GLY n 1 219 ASP n 1 220 PRO n 1 221 ARG n 1 222 TYR n 1 223 MET n 1 224 ALA n 1 225 PRO n 1 226 GLU n 1 227 LEU n 1 228 LEU n 1 229 GLN n 1 230 GLY n 1 231 SER n 1 232 TYR n 1 233 GLY n 1 234 THR n 1 235 ALA n 1 236 ALA n 1 237 ASP n 1 238 VAL n 1 239 PHE n 1 240 SER n 1 241 LEU n 1 242 GLY n 1 243 LEU n 1 244 THR n 1 245 ILE n 1 246 LEU n 1 247 GLU n 1 248 VAL n 1 249 ALA n 1 250 CYS n 1 251 ASN n 1 252 MET n 1 253 GLU n 1 254 LEU n 1 255 PRO n 1 256 HIS n 1 257 GLY n 1 258 GLY n 1 259 GLU n 1 260 GLY n 1 261 TRP n 1 262 GLN n 1 263 GLN n 1 264 LEU n 1 265 ARG n 1 266 GLN n 1 267 GLY n 1 268 TYR n 1 269 LEU n 1 270 PRO n 1 271 PRO n 1 272 GLU n 1 273 PHE n 1 274 THR n 1 275 ALA n 1 276 GLY n 1 277 LEU n 1 278 SER n 1 279 SER n 1 280 GLU n 1 281 LEU n 1 282 ARG n 1 283 SER n 1 284 VAL n 1 285 LEU n 1 286 VAL n 1 287 MET n 1 288 MET n 1 289 LEU n 1 290 GLU n 1 291 PRO n 1 292 ASP n 1 293 PRO n 1 294 LYS n 1 295 LEU n 1 296 ARG n 1 297 ALA n 1 298 THR n 1 299 ALA n 1 300 GLU n 1 301 ALA n 1 302 LEU n 1 303 LEU n 1 304 ALA n 1 305 LEU n 1 306 PRO n 1 307 VAL n 1 308 LEU n 1 309 ARG n 1 310 GLN n 1 311 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 311 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PKMYT1, MYT1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pNIC28-Bsa4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PMYT1_HUMAN _struct_ref.pdbx_db_accession Q99640 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;HQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARK LAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDV KPANIFLGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVACNMELPHGGEGWQQ LRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLRQP ; _struct_ref.pdbx_align_begin 75 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8D6E B 24 ? 311 ? Q99640 75 ? 362 ? 75 362 2 1 8D6E A 24 ? 311 ? Q99640 75 ? 362 ? 75 362 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8D6E MET B 1 ? UNP Q99640 ? ? 'initiating methionine' 52 1 1 8D6E HIS B 2 ? UNP Q99640 ? ? 'expression tag' 53 2 1 8D6E HIS B 3 ? UNP Q99640 ? ? 'expression tag' 54 3 1 8D6E HIS B 4 ? UNP Q99640 ? ? 'expression tag' 55 4 1 8D6E HIS B 5 ? UNP Q99640 ? ? 'expression tag' 56 5 1 8D6E HIS B 6 ? UNP Q99640 ? ? 'expression tag' 57 6 1 8D6E HIS B 7 ? UNP Q99640 ? ? 'expression tag' 58 7 1 8D6E SER B 8 ? UNP Q99640 ? ? 'expression tag' 59 8 1 8D6E SER B 9 ? UNP Q99640 ? ? 'expression tag' 60 9 1 8D6E GLY B 10 ? UNP Q99640 ? ? 'expression tag' 61 10 1 8D6E VAL B 11 ? UNP Q99640 ? ? 'expression tag' 62 11 1 8D6E ASP B 12 ? UNP Q99640 ? ? 'expression tag' 63 12 1 8D6E LEU B 13 ? UNP Q99640 ? ? 'expression tag' 64 13 1 8D6E GLY B 14 ? UNP Q99640 ? ? 'expression tag' 65 14 1 8D6E THR B 15 ? UNP Q99640 ? ? 'expression tag' 66 15 1 8D6E GLU B 16 ? UNP Q99640 ? ? 'expression tag' 67 16 1 8D6E ASN B 17 ? UNP Q99640 ? ? 'expression tag' 68 17 1 8D6E LEU B 18 ? UNP Q99640 ? ? 'expression tag' 69 18 1 8D6E TYR B 19 ? UNP Q99640 ? ? 'expression tag' 70 19 1 8D6E PHE B 20 ? UNP Q99640 ? ? 'expression tag' 71 20 1 8D6E GLN B 21 ? UNP Q99640 ? ? 'expression tag' 72 21 1 8D6E SER B 22 ? UNP Q99640 ? ? 'expression tag' 73 22 1 8D6E MET B 23 ? UNP Q99640 ? ? 'expression tag' 74 23 2 8D6E MET A 1 ? UNP Q99640 ? ? 'initiating methionine' 52 24 2 8D6E HIS A 2 ? UNP Q99640 ? ? 'expression tag' 53 25 2 8D6E HIS A 3 ? UNP Q99640 ? ? 'expression tag' 54 26 2 8D6E HIS A 4 ? UNP Q99640 ? ? 'expression tag' 55 27 2 8D6E HIS A 5 ? UNP Q99640 ? ? 'expression tag' 56 28 2 8D6E HIS A 6 ? UNP Q99640 ? ? 'expression tag' 57 29 2 8D6E HIS A 7 ? UNP Q99640 ? ? 'expression tag' 58 30 2 8D6E SER A 8 ? UNP Q99640 ? ? 'expression tag' 59 31 2 8D6E SER A 9 ? UNP Q99640 ? ? 'expression tag' 60 32 2 8D6E GLY A 10 ? UNP Q99640 ? ? 'expression tag' 61 33 2 8D6E VAL A 11 ? UNP Q99640 ? ? 'expression tag' 62 34 2 8D6E ASP A 12 ? UNP Q99640 ? ? 'expression tag' 63 35 2 8D6E LEU A 13 ? UNP Q99640 ? ? 'expression tag' 64 36 2 8D6E GLY A 14 ? UNP Q99640 ? ? 'expression tag' 65 37 2 8D6E THR A 15 ? UNP Q99640 ? ? 'expression tag' 66 38 2 8D6E GLU A 16 ? UNP Q99640 ? ? 'expression tag' 67 39 2 8D6E ASN A 17 ? UNP Q99640 ? ? 'expression tag' 68 40 2 8D6E LEU A 18 ? UNP Q99640 ? ? 'expression tag' 69 41 2 8D6E TYR A 19 ? UNP Q99640 ? ? 'expression tag' 70 42 2 8D6E PHE A 20 ? UNP Q99640 ? ? 'expression tag' 71 43 2 8D6E GLN A 21 ? UNP Q99640 ? ? 'expression tag' 72 44 2 8D6E SER A 22 ? UNP Q99640 ? ? 'expression tag' 73 45 2 8D6E MET A 23 ? UNP Q99640 ? ? 'expression tag' 74 46 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 QGI non-polymer . '(1P)-2-amino-1-(3-hydroxy-2,6-dimethylphenyl)-5,6-dimethyl-1H-pyrrolo[2,3-b]pyridine-3-carboxamide' ? 'C18 H20 N4 O2' 324.377 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8D6E _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.78 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.8 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.25 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details '277K for 1 day and then 293K for a week' _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '5.6 to 6.6% PEG3350, 0.2 M Na2SO4, 0.1 M Tris-HCl and 10% EG' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-09-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 72.702 _reflns.entry_id 8D6E _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.150 _reflns.d_resolution_low 47.820 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 40791 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 86.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.997 _reflns.pdbx_Rmerge_I_obs 0.021 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.970 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.872 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.029 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 144392 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.150 2.280 ? 0.750 ? 23563 13449 ? 11324 84.200 ? ? ? ? 1.032 ? ? ? ? ? ? ? ? 2.081 ? ? ? ? 1.408 ? ? 1 1 0.356 ? ? ? ? ? ? ? ? ? ? 2.280 2.430 ? 1.570 ? 22141 12732 ? 10946 86.000 ? ? ? ? 0.484 ? ? ? ? ? ? ? ? 2.023 ? ? ? ? 0.661 ? ? 2 1 0.709 ? ? ? ? ? ? ? ? ? ? 2.430 2.630 ? 3.210 ? 19727 11765 ? 10056 85.500 ? ? ? ? 0.240 ? ? ? ? ? ? ? ? 1.962 ? ? ? ? 0.328 ? ? 3 1 0.913 ? ? ? ? ? ? ? ? ? ? 2.630 2.880 ? 7.040 ? 19759 10848 ? 9565 88.200 ? ? ? ? 0.112 ? ? ? ? ? ? ? ? 2.066 ? ? ? ? 0.154 ? ? 4 1 0.980 ? ? ? ? ? ? ? ? ? ? 2.880 3.220 ? 14.800 ? 17283 9835 ? 8620 87.600 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 2.005 ? ? ? ? 0.070 ? ? 5 1 0.995 ? ? ? ? ? ? ? ? ? ? 3.220 3.710 ? 30.580 ? 13903 8675 ? 7398 85.300 ? ? ? ? 0.023 ? ? ? ? ? ? ? ? 1.879 ? ? ? ? 0.031 ? ? 6 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.710 4.540 ? 48.590 ? 13044 7333 ? 6548 89.300 ? ? ? ? 0.014 ? ? ? ? ? ? ? ? 1.992 ? ? ? ? 0.019 ? ? 7 1 0.999 ? ? ? ? ? ? ? ? ? ? 4.540 6.390 ? 53.010 ? 9748 5705 ? 5073 88.900 ? ? ? ? 0.013 ? ? ? ? ? ? ? ? 1.922 ? ? ? ? 0.019 ? ? 8 1 0.999 ? ? ? ? ? ? ? ? ? ? 6.390 47.820 ? 58.140 ? 5224 3177 ? 2757 86.800 ? ? ? ? 0.010 ? ? ? ? ? ? ? ? 1.895 ? ? ? ? 0.014 ? ? 9 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 208.810 _refine.B_iso_mean 89.4569 _refine.B_iso_min 48.310 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8D6E _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1500 _refine.ls_d_res_low 47.8200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 40771 _refine.ls_number_reflns_R_free 2036 _refine.ls_number_reflns_R_work 38735 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.4500 _refine.ls_percent_reflns_R_free 4.9900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1915 _refine.ls_R_factor_R_free 0.2177 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1900 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3P1A _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.0900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1500 _refine_hist.d_res_low 47.8200 _refine_hist.number_atoms_solvent 94 _refine_hist.number_atoms_total 4396 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 559 _refine_hist.pdbx_B_iso_mean_ligand 87.49 _refine_hist.pdbx_B_iso_mean_solvent 78.69 _refine_hist.pdbx_number_atoms_protein 4178 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 124 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 2462 6.229 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 2462 6.229 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1500 2.2000 2557 . 126 2431 92.0000 . . . 0.3713 0.0000 0.3493 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.2000 2.2500 2714 . 137 2577 97.0000 . . . 0.3647 0.0000 0.3333 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.2500 2.3100 2741 . 136 2605 97.0000 . . . 0.3360 0.0000 0.2977 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.3100 2.3800 2702 . 136 2566 97.0000 . . . 0.3051 0.0000 0.2729 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.3800 2.4600 2744 . 133 2611 97.0000 . . . 0.3014 0.0000 0.2600 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.4600 2.5500 2615 . 133 2482 94.0000 . . . 0.2820 0.0000 0.2385 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.5500 2.6500 2718 . 135 2583 97.0000 . . . 0.2693 0.0000 0.2197 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.6500 2.7700 2740 . 137 2603 97.0000 . . . 0.2638 0.0000 0.2123 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.7700 2.9100 2785 . 141 2644 98.0000 . . . 0.2458 0.0000 0.2304 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 2.9100 3.1000 2716 . 134 2582 97.0000 . . . 0.2737 0.0000 0.2391 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.1000 3.3300 2766 . 141 2625 98.0000 . . . 0.2330 0.0000 0.2157 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.3400 3.6700 2681 . 133 2548 95.0000 . . . 0.2440 0.0000 0.1987 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 3.6700 4.2000 2756 . 137 2619 98.0000 . . . 0.2260 0.0000 0.1690 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 4.2000 5.2900 2780 . 138 2642 98.0000 . . . 0.1799 0.0000 0.1620 . . . . . . . 15 . . . 'X-RAY DIFFRACTION' 5.2900 47.8200 2756 . 139 2617 95.0000 . . . 0.1671 0.0000 0.1616 . . . . . . . 15 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 77 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB or name CG )) or resid 167 through 243 or (resid 244 and (name N or name CA or name C or name O or name CB or name CG )) or resid 245 through 261 or (resid 265 and (name N or name CA or name C or name O or name CB )) or resid 266 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 332 or resid 334 through 350 or resid 352 through 359 or resid 361 or resid 401 through 501 or resid 701 through 1001)) ; 1 2 ;(chain B and ((resid 77 through 78 and (name N or name CA or name C or name O or name CB )) or resid 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or (resid 81 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 82 through 84 or (resid 85 and (name N or name CA or name C or name O or name CB )) or resid 86 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG )) or resid 135 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 153 or (resid 154 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE )) or resid 155 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB or name CG )) or resid 258 through 261 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )) or resid 305 through 332 or resid 334 through 350 or resid 352 through 359 or resid 361 or resid 401 through 501 or resid 701 through 1001)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 B LEU 26 . B GLY 114 . A LEU 77 A GLY 165 ? ;(chain A and (resid 77 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB or name CG )) or resid 167 through 243 or (resid 244 and (name N or name CA or name C or name O or name CB or name CG )) or resid 245 through 261 or (resid 265 and (name N or name CA or name C or name O or name CB )) or resid 266 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 332 or resid 334 through 350 or resid 352 through 359 or resid 361 or resid 401 through 501 or resid 701 through 1001)) ; 1 1 2 B GLN 115 . B GLN 115 . A GLN 166 A GLN 166 ? ;(chain A and (resid 77 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB or name CG )) or resid 167 through 243 or (resid 244 and (name N or name CA or name C or name O or name CB or name CG )) or resid 245 through 261 or (resid 265 and (name N or name CA or name C or name O or name CB )) or resid 266 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 332 or resid 334 through 350 or resid 352 through 359 or resid 361 or resid 401 through 501 or resid 701 through 1001)) ; 1 1 3 B LEU 26 . B GLN 310 . A LEU 77 A GLN 361 ? ;(chain A and (resid 77 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB or name CG )) or resid 167 through 243 or (resid 244 and (name N or name CA or name C or name O or name CB or name CG )) or resid 245 through 261 or (resid 265 and (name N or name CA or name C or name O or name CB )) or resid 266 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 332 or resid 334 through 350 or resid 352 through 359 or resid 361 or resid 401 through 501 or resid 701 through 1001)) ; 1 1 4 B LEU 26 . B GLN 310 . A LEU 77 A GLN 361 ? ;(chain A and (resid 77 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB or name CG )) or resid 167 through 243 or (resid 244 and (name N or name CA or name C or name O or name CB or name CG )) or resid 245 through 261 or (resid 265 and (name N or name CA or name C or name O or name CB )) or resid 266 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 332 or resid 334 through 350 or resid 352 through 359 or resid 361 or resid 401 through 501 or resid 701 through 1001)) ; 1 1 5 B LEU 26 . B GLN 310 . A LEU 77 A GLN 361 ? ;(chain A and (resid 77 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB or name CG )) or resid 167 through 243 or (resid 244 and (name N or name CA or name C or name O or name CB or name CG )) or resid 245 through 261 or (resid 265 and (name N or name CA or name C or name O or name CB )) or resid 266 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 332 or resid 334 through 350 or resid 352 through 359 or resid 361 or resid 401 through 501 or resid 701 through 1001)) ; 1 1 6 B LEU 26 . B GLN 310 . A LEU 77 A GLN 361 ? ;(chain A and (resid 77 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB or name CG )) or resid 167 through 243 or (resid 244 and (name N or name CA or name C or name O or name CB or name CG )) or resid 245 through 261 or (resid 265 and (name N or name CA or name C or name O or name CB )) or resid 266 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 332 or resid 334 through 350 or resid 352 through 359 or resid 361 or resid 401 through 501 or resid 701 through 1001)) ; 1 1 7 B LEU 26 . B GLN 310 . A LEU 77 A GLN 361 ? ;(chain A and (resid 77 through 165 or (resid 166 and (name N or name CA or name C or name O or name CB or name CG )) or resid 167 through 243 or (resid 244 and (name N or name CA or name C or name O or name CB or name CG )) or resid 245 through 261 or (resid 265 and (name N or name CA or name C or name O or name CB )) or resid 266 through 322 or (resid 323 and (name N or name CA or name C or name O or name CB )) or resid 324 through 332 or resid 334 through 350 or resid 352 through 359 or resid 361 or resid 401 through 501 or resid 701 through 1001)) ; 1 2 1 A LEU 26 . A GLN 27 . B LEU 77 B GLN 78 ? ;(chain B and ((resid 77 through 78 and (name N or name CA or name C or name O or name CB )) or resid 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or (resid 81 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 82 through 84 or (resid 85 and (name N or name CA or name C or name O or name CB )) or resid 86 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG )) or resid 135 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 153 or (resid 154 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE )) or resid 155 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB or name CG )) or resid 258 through 261 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )) or resid 305 through 332 or resid 334 through 350 or resid 352 through 359 or resid 361 or resid 401 through 501 or resid 701 through 1001)) ; 1 2 2 A LEU 26 . A GLN 310 . B LEU 77 B GLN 361 ? ;(chain B and ((resid 77 through 78 and (name N or name CA or name C or name O or name CB )) or resid 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or (resid 81 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 82 through 84 or (resid 85 and (name N or name CA or name C or name O or name CB )) or resid 86 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG )) or resid 135 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 153 or (resid 154 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE )) or resid 155 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB or name CG )) or resid 258 through 261 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )) or resid 305 through 332 or resid 334 through 350 or resid 352 through 359 or resid 361 or resid 401 through 501 or resid 701 through 1001)) ; 1 2 3 A LEU 26 . A GLN 310 . B LEU 77 B GLN 361 ? ;(chain B and ((resid 77 through 78 and (name N or name CA or name C or name O or name CB )) or resid 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or (resid 81 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 82 through 84 or (resid 85 and (name N or name CA or name C or name O or name CB )) or resid 86 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG )) or resid 135 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 153 or (resid 154 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE )) or resid 155 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB or name CG )) or resid 258 through 261 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )) or resid 305 through 332 or resid 334 through 350 or resid 352 through 359 or resid 361 or resid 401 through 501 or resid 701 through 1001)) ; 1 2 4 A LEU 26 . A GLN 310 . B LEU 77 B GLN 361 ? ;(chain B and ((resid 77 through 78 and (name N or name CA or name C or name O or name CB )) or resid 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or (resid 81 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 82 through 84 or (resid 85 and (name N or name CA or name C or name O or name CB )) or resid 86 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG )) or resid 135 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 153 or (resid 154 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE )) or resid 155 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB or name CG )) or resid 258 through 261 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )) or resid 305 through 332 or resid 334 through 350 or resid 352 through 359 or resid 361 or resid 401 through 501 or resid 701 through 1001)) ; 1 2 5 A LEU 26 . A GLN 310 . B LEU 77 B GLN 361 ? ;(chain B and ((resid 77 through 78 and (name N or name CA or name C or name O or name CB )) or resid 79 or (resid 80 and (name N or name CA or name C or name O or name CB )) or (resid 81 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 82 through 84 or (resid 85 and (name N or name CA or name C or name O or name CB )) or resid 86 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133 or (resid 134 and (name N or name CA or name C or name O or name CB or name CG )) or resid 135 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB or name CG )) or resid 150 through 153 or (resid 154 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE )) or resid 155 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB or name CG )) or resid 258 through 261 or resid 265 through 303 or (resid 304 and (name N or name CA or name C or name O or name CB )) or resid 305 through 332 or resid 334 through 350 or resid 352 through 359 or resid 361 or resid 401 through 501 or resid 701 through 1001)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 8D6E _struct.title 'Crystal Structure of Human Myt1 Kinase domain Bounded with RP-6306' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8D6E _struct_keywords.text 'Kinase Inhibitor complex, SIGNALING PROTEIN, Transferase-Inhibitor complex' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN, Transferase/Inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? G N N 5 ? H N N 5 ? I N N 5 ? J N N 4 ? K N N 4 ? L N N 5 ? M N N 5 ? N N N 2 ? O N N 3 ? P N N 5 ? Q N N 5 ? R N N 5 ? S N N 5 ? T N N 5 ? U N N 5 ? V N N 6 ? W N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 53 ? SER A 58 ? SER B 104 SER B 109 1 ? 6 HELX_P HELX_P2 AA2 GLY A 96 ? GLY A 114 ? GLY B 147 GLY B 165 1 ? 19 HELX_P HELX_P3 AA3 SER A 142 ? GLY A 151 ? SER B 193 GLY B 202 1 ? 10 HELX_P HELX_P4 AA4 PRO A 155 ? GLN A 176 ? PRO B 206 GLN B 227 1 ? 22 HELX_P HELX_P5 AA5 LYS A 184 ? ALA A 186 ? LYS B 235 ALA B 237 5 ? 3 HELX_P HELX_P6 AA6 PRO A 192 ? GLY A 194 ? PRO B 243 GLY B 245 5 ? 3 HELX_P HELX_P7 AA7 ASP A 219 ? MET A 223 ? ASP B 270 MET B 274 5 ? 5 HELX_P HELX_P8 AA8 ALA A 224 ? GLY A 230 ? ALA B 275 GLY B 281 5 ? 7 HELX_P HELX_P9 AA9 THR A 234 ? ASN A 251 ? THR B 285 ASN B 302 1 ? 18 HELX_P HELX_P10 AB1 GLY A 257 ? LEU A 264 ? GLY B 308 LEU B 315 1 ? 8 HELX_P HELX_P11 AB2 PRO A 270 ? ALA A 275 ? PRO B 321 ALA B 326 1 ? 6 HELX_P HELX_P12 AB3 SER A 278 ? LEU A 289 ? SER B 329 LEU B 340 1 ? 12 HELX_P HELX_P13 AB4 THR A 298 ? ALA A 304 ? THR B 349 ALA B 355 1 ? 7 HELX_P HELX_P14 AB5 SER B 53 ? SER B 58 ? SER A 104 SER A 109 1 ? 6 HELX_P HELX_P15 AB6 GLY B 96 ? GLY B 114 ? GLY A 147 GLY A 165 1 ? 19 HELX_P HELX_P16 AB7 SER B 142 ? GLY B 151 ? SER A 193 GLY A 202 1 ? 10 HELX_P HELX_P17 AB8 PRO B 155 ? GLN B 176 ? PRO A 206 GLN A 227 1 ? 22 HELX_P HELX_P18 AB9 LYS B 184 ? ALA B 186 ? LYS A 235 ALA A 237 5 ? 3 HELX_P HELX_P19 AC1 PRO B 192 ? GLY B 194 ? PRO A 243 GLY A 245 5 ? 3 HELX_P HELX_P20 AC2 ASP B 219 ? MET B 223 ? ASP A 270 MET A 274 5 ? 5 HELX_P HELX_P21 AC3 ALA B 224 ? GLY B 230 ? ALA A 275 GLY A 281 5 ? 7 HELX_P HELX_P22 AC4 THR B 234 ? ASN B 251 ? THR A 285 ASN A 302 1 ? 18 HELX_P HELX_P23 AC5 GLY B 257 ? LEU B 264 ? GLY A 308 LEU A 315 1 ? 8 HELX_P HELX_P24 AC6 PRO B 270 ? ALA B 275 ? PRO A 321 ALA A 326 1 ? 6 HELX_P HELX_P25 AC7 SER B 278 ? LEU B 289 ? SER A 329 LEU A 340 1 ? 12 HELX_P HELX_P26 AC8 THR B 298 ? ALA B 304 ? THR A 349 ALA A 355 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 6 ? AA5 ? 2 ? AA6 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA4 5 6 ? anti-parallel AA5 1 2 ? anti-parallel AA6 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 29 ? ARG A 30 ? ARG B 80 ARG B 81 AA1 2 LEU A 122 ? GLU A 128 ? LEU B 173 GLU B 179 AA1 3 ILE A 131 ? GLU A 137 ? ILE B 182 GLU B 188 AA1 4 LEU A 84 ? SER A 90 ? LEU B 135 SER B 141 AA1 5 GLY A 71 ? SER A 78 ? GLY B 122 SER B 129 AA1 6 PHE A 59 ? GLY A 68 ? PHE B 110 GLY B 119 AA2 1 LEU A 178 ? VAL A 179 ? LEU B 229 VAL B 230 AA2 2 VAL A 205 ? GLU A 206 ? VAL B 256 GLU B 257 AA3 1 ILE A 188 ? LEU A 190 ? ILE B 239 LEU B 241 AA3 2 CYS A 196 ? LEU A 198 ? CYS B 247 LEU B 249 AA4 1 ARG B 29 ? ARG B 30 ? ARG A 80 ARG A 81 AA4 2 LEU B 122 ? GLU B 128 ? LEU A 173 GLU A 179 AA4 3 ILE B 131 ? GLU B 137 ? ILE A 182 GLU A 188 AA4 4 LEU B 84 ? SER B 90 ? LEU A 135 SER A 141 AA4 5 GLY B 71 ? SER B 78 ? GLY A 122 SER A 129 AA4 6 PHE B 59 ? GLY B 68 ? PHE A 110 GLY A 119 AA5 1 LEU B 178 ? VAL B 179 ? LEU A 229 VAL A 230 AA5 2 VAL B 205 ? GLU B 206 ? VAL A 256 GLU A 257 AA6 1 ILE B 188 ? LEU B 190 ? ILE A 239 LEU A 241 AA6 2 CYS B 196 ? LEU B 198 ? CYS A 247 LEU A 249 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 29 ? N ARG B 80 O GLU A 127 ? O GLU B 178 AA1 2 3 N GLN A 124 ? N GLN B 175 O GLN A 135 ? O GLN B 186 AA1 3 4 O THR A 136 ? O THR B 187 N ALA A 86 ? N ALA B 137 AA1 4 5 O TYR A 85 ? O TYR B 136 N VAL A 76 ? N VAL B 127 AA1 5 6 O VAL A 73 ? O VAL B 124 N LEU A 65 ? N LEU B 116 AA2 1 2 N VAL A 179 ? N VAL B 230 O VAL A 205 ? O VAL B 256 AA3 1 2 N PHE A 189 ? N PHE B 240 O LYS A 197 ? O LYS B 248 AA4 1 2 N ARG B 29 ? N ARG A 80 O GLU B 127 ? O GLU A 178 AA4 2 3 N GLU B 123 ? N GLU A 174 O GLN B 135 ? O GLN A 186 AA4 3 4 O THR B 136 ? O THR A 187 N ALA B 86 ? N ALA A 137 AA4 4 5 O TYR B 85 ? O TYR A 136 N VAL B 76 ? N VAL A 127 AA4 5 6 O VAL B 73 ? O VAL A 124 N GLY B 66 ? N GLY A 117 AA5 1 2 N VAL B 179 ? N VAL A 230 O VAL B 205 ? O VAL A 256 AA6 1 2 N PHE B 189 ? N PHE A 240 O LYS B 197 ? O LYS A 248 # _atom_sites.entry_id 8D6E _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019515 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.007053 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008927 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014570 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 52 ? ? ? B . n A 1 2 HIS 2 53 ? ? ? B . n A 1 3 HIS 3 54 ? ? ? B . n A 1 4 HIS 4 55 ? ? ? B . n A 1 5 HIS 5 56 ? ? ? B . n A 1 6 HIS 6 57 ? ? ? B . n A 1 7 HIS 7 58 ? ? ? B . n A 1 8 SER 8 59 ? ? ? B . n A 1 9 SER 9 60 ? ? ? B . n A 1 10 GLY 10 61 ? ? ? B . n A 1 11 VAL 11 62 ? ? ? B . n A 1 12 ASP 12 63 ? ? ? B . n A 1 13 LEU 13 64 ? ? ? B . n A 1 14 GLY 14 65 ? ? ? B . n A 1 15 THR 15 66 ? ? ? B . n A 1 16 GLU 16 67 ? ? ? B . n A 1 17 ASN 17 68 ? ? ? B . n A 1 18 LEU 18 69 ? ? ? B . n A 1 19 TYR 19 70 ? ? ? B . n A 1 20 PHE 20 71 ? ? ? B . n A 1 21 GLN 21 72 ? ? ? B . n A 1 22 SER 22 73 ? ? ? B . n A 1 23 MET 23 74 ? ? ? B . n A 1 24 HIS 24 75 ? ? ? B . n A 1 25 GLN 25 76 ? ? ? B . n A 1 26 LEU 26 77 77 LEU LEU B . n A 1 27 GLN 27 78 78 GLN GLN B . n A 1 28 PRO 28 79 79 PRO PRO B . n A 1 29 ARG 29 80 80 ARG ARG B . n A 1 30 ARG 30 81 81 ARG ARG B . n A 1 31 VAL 31 82 82 VAL VAL B . n A 1 32 SER 32 83 83 SER SER B . n A 1 33 PHE 33 84 84 PHE PHE B . n A 1 34 ARG 34 85 85 ARG ARG B . n A 1 35 GLY 35 86 86 GLY GLY B . n A 1 36 GLU 36 87 87 GLU GLU B . n A 1 37 ALA 37 88 88 ALA ALA B . n A 1 38 SER 38 89 89 SER SER B . n A 1 39 GLU 39 90 90 GLU GLU B . n A 1 40 THR 40 91 ? ? ? B . n A 1 41 LEU 41 92 ? ? ? B . n A 1 42 GLN 42 93 ? ? ? B . n A 1 43 SER 43 94 ? ? ? B . n A 1 44 PRO 44 95 95 PRO PRO B . n A 1 45 GLY 45 96 96 GLY GLY B . n A 1 46 TYR 46 97 97 TYR TYR B . n A 1 47 ASP 47 98 98 ASP ASP B . n A 1 48 PRO 48 99 99 PRO PRO B . n A 1 49 SER 49 100 100 SER SER B . n A 1 50 ARG 50 101 101 ARG ARG B . n A 1 51 PRO 51 102 102 PRO PRO B . n A 1 52 GLU 52 103 103 GLU GLU B . n A 1 53 SER 53 104 104 SER SER B . n A 1 54 PHE 54 105 105 PHE PHE B . n A 1 55 PHE 55 106 106 PHE PHE B . n A 1 56 GLN 56 107 107 GLN GLN B . n A 1 57 GLN 57 108 108 GLN GLN B . n A 1 58 SER 58 109 109 SER SER B . n A 1 59 PHE 59 110 110 PHE PHE B . n A 1 60 GLN 60 111 111 GLN GLN B . n A 1 61 ARG 61 112 112 ARG ARG B . n A 1 62 LEU 62 113 113 LEU LEU B . n A 1 63 SER 63 114 114 SER SER B . n A 1 64 ARG 64 115 115 ARG ARG B . n A 1 65 LEU 65 116 116 LEU LEU B . n A 1 66 GLY 66 117 117 GLY GLY B . n A 1 67 HIS 67 118 118 HIS HIS B . n A 1 68 GLY 68 119 119 GLY GLY B . n A 1 69 SER 69 120 120 SER SER B . n A 1 70 TYR 70 121 121 TYR TYR B . n A 1 71 GLY 71 122 122 GLY GLY B . n A 1 72 GLU 72 123 123 GLU GLU B . n A 1 73 VAL 73 124 124 VAL VAL B . n A 1 74 PHE 74 125 125 PHE PHE B . n A 1 75 LYS 75 126 126 LYS LYS B . n A 1 76 VAL 76 127 127 VAL VAL B . n A 1 77 ARG 77 128 128 ARG ARG B . n A 1 78 SER 78 129 129 SER SER B . n A 1 79 LYS 79 130 130 LYS LYS B . n A 1 80 GLU 80 131 131 GLU GLU B . n A 1 81 ASP 81 132 132 ASP ASP B . n A 1 82 GLY 82 133 133 GLY GLY B . n A 1 83 ARG 83 134 134 ARG ARG B . n A 1 84 LEU 84 135 135 LEU LEU B . n A 1 85 TYR 85 136 136 TYR TYR B . n A 1 86 ALA 86 137 137 ALA ALA B . n A 1 87 VAL 87 138 138 VAL VAL B . n A 1 88 LYS 88 139 139 LYS LYS B . n A 1 89 ARG 89 140 140 ARG ARG B . n A 1 90 SER 90 141 141 SER SER B . n A 1 91 MET 91 142 142 MET MET B . n A 1 92 SER 92 143 143 SER SER B . n A 1 93 PRO 93 144 144 PRO PRO B . n A 1 94 PHE 94 145 145 PHE PHE B . n A 1 95 ARG 95 146 146 ARG ARG B . n A 1 96 GLY 96 147 147 GLY GLY B . n A 1 97 PRO 97 148 148 PRO PRO B . n A 1 98 LYS 98 149 149 LYS LYS B . n A 1 99 ASP 99 150 150 ASP ASP B . n A 1 100 ARG 100 151 151 ARG ARG B . n A 1 101 ALA 101 152 152 ALA ALA B . n A 1 102 ARG 102 153 153 ARG ARG B . n A 1 103 LYS 103 154 154 LYS LYS B . n A 1 104 LEU 104 155 155 LEU LEU B . n A 1 105 ALA 105 156 156 ALA ALA B . n A 1 106 GLU 106 157 157 GLU GLU B . n A 1 107 VAL 107 158 158 VAL VAL B . n A 1 108 GLY 108 159 159 GLY GLY B . n A 1 109 SER 109 160 160 SER SER B . n A 1 110 HIS 110 161 161 HIS HIS B . n A 1 111 GLU 111 162 162 GLU GLU B . n A 1 112 LYS 112 163 163 LYS LYS B . n A 1 113 VAL 113 164 164 VAL VAL B . n A 1 114 GLY 114 165 165 GLY GLY B . n A 1 115 GLN 115 166 166 GLN GLN B . n A 1 116 HIS 116 167 167 HIS HIS B . n A 1 117 PRO 117 168 168 PRO PRO B . n A 1 118 CYS 118 169 169 CYS CYS B . n A 1 119 CYS 119 170 170 CYS CYS B . n A 1 120 VAL 120 171 171 VAL VAL B . n A 1 121 ARG 121 172 172 ARG ARG B . n A 1 122 LEU 122 173 173 LEU LEU B . n A 1 123 GLU 123 174 174 GLU GLU B . n A 1 124 GLN 124 175 175 GLN GLN B . n A 1 125 ALA 125 176 176 ALA ALA B . n A 1 126 TRP 126 177 177 TRP TRP B . n A 1 127 GLU 127 178 178 GLU GLU B . n A 1 128 GLU 128 179 179 GLU GLU B . n A 1 129 GLY 129 180 180 GLY GLY B . n A 1 130 GLY 130 181 181 GLY GLY B . n A 1 131 ILE 131 182 182 ILE ILE B . n A 1 132 LEU 132 183 183 LEU LEU B . n A 1 133 TYR 133 184 184 TYR TYR B . n A 1 134 LEU 134 185 185 LEU LEU B . n A 1 135 GLN 135 186 186 GLN GLN B . n A 1 136 THR 136 187 187 THR THR B . n A 1 137 GLU 137 188 188 GLU GLU B . n A 1 138 LEU 138 189 189 LEU LEU B . n A 1 139 CYS 139 190 190 CYS CYS B . n A 1 140 GLY 140 191 191 GLY GLY B . n A 1 141 PRO 141 192 192 PRO PRO B . n A 1 142 SER 142 193 193 SER SER B . n A 1 143 LEU 143 194 194 LEU LEU B . n A 1 144 GLN 144 195 195 GLN GLN B . n A 1 145 GLN 145 196 196 GLN GLN B . n A 1 146 HIS 146 197 197 HIS HIS B . n A 1 147 CYS 147 198 198 CYS CYS B . n A 1 148 GLU 148 199 199 GLU GLU B . n A 1 149 ALA 149 200 200 ALA ALA B . n A 1 150 TRP 150 201 201 TRP TRP B . n A 1 151 GLY 151 202 202 GLY GLY B . n A 1 152 ALA 152 203 203 ALA ALA B . n A 1 153 SER 153 204 204 SER SER B . n A 1 154 LEU 154 205 205 LEU LEU B . n A 1 155 PRO 155 206 206 PRO PRO B . n A 1 156 GLU 156 207 207 GLU GLU B . n A 1 157 ALA 157 208 208 ALA ALA B . n A 1 158 GLN 158 209 209 GLN GLN B . n A 1 159 VAL 159 210 210 VAL VAL B . n A 1 160 TRP 160 211 211 TRP TRP B . n A 1 161 GLY 161 212 212 GLY GLY B . n A 1 162 TYR 162 213 213 TYR TYR B . n A 1 163 LEU 163 214 214 LEU LEU B . n A 1 164 ARG 164 215 215 ARG ARG B . n A 1 165 ASP 165 216 216 ASP ASP B . n A 1 166 THR 166 217 217 THR THR B . n A 1 167 LEU 167 218 218 LEU LEU B . n A 1 168 LEU 168 219 219 LEU LEU B . n A 1 169 ALA 169 220 220 ALA ALA B . n A 1 170 LEU 170 221 221 LEU LEU B . n A 1 171 ALA 171 222 222 ALA ALA B . n A 1 172 HIS 172 223 223 HIS HIS B . n A 1 173 LEU 173 224 224 LEU LEU B . n A 1 174 HIS 174 225 225 HIS HIS B . n A 1 175 SER 175 226 226 SER SER B . n A 1 176 GLN 176 227 227 GLN GLN B . n A 1 177 GLY 177 228 228 GLY GLY B . n A 1 178 LEU 178 229 229 LEU LEU B . n A 1 179 VAL 179 230 230 VAL VAL B . n A 1 180 HIS 180 231 231 HIS HIS B . n A 1 181 LEU 181 232 232 LEU LEU B . n A 1 182 ASP 182 233 233 ASP ASP B . n A 1 183 VAL 183 234 234 VAL VAL B . n A 1 184 LYS 184 235 235 LYS LYS B . n A 1 185 PRO 185 236 236 PRO PRO B . n A 1 186 ALA 186 237 237 ALA ALA B . n A 1 187 ASN 187 238 238 ASN ASN B . n A 1 188 ILE 188 239 239 ILE ILE B . n A 1 189 PHE 189 240 240 PHE PHE B . n A 1 190 LEU 190 241 241 LEU LEU B . n A 1 191 GLY 191 242 242 GLY GLY B . n A 1 192 PRO 192 243 243 PRO PRO B . n A 1 193 ARG 193 244 244 ARG ARG B . n A 1 194 GLY 194 245 245 GLY GLY B . n A 1 195 ARG 195 246 246 ARG ARG B . n A 1 196 CYS 196 247 247 CYS CYS B . n A 1 197 LYS 197 248 248 LYS LYS B . n A 1 198 LEU 198 249 249 LEU LEU B . n A 1 199 GLY 199 250 250 GLY GLY B . n A 1 200 ASP 200 251 251 ASP ASP B . n A 1 201 PHE 201 252 252 PHE PHE B . n A 1 202 GLY 202 253 253 GLY GLY B . n A 1 203 LEU 203 254 254 LEU LEU B . n A 1 204 LEU 204 255 255 LEU LEU B . n A 1 205 VAL 205 256 256 VAL VAL B . n A 1 206 GLU 206 257 257 GLU GLU B . n A 1 207 LEU 207 258 258 LEU LEU B . n A 1 208 GLY 208 259 259 GLY GLY B . n A 1 209 THR 209 260 260 THR THR B . n A 1 210 ALA 210 261 261 ALA ALA B . n A 1 211 GLY 211 262 262 GLY GLY B . n A 1 212 ALA 212 263 263 ALA ALA B . n A 1 213 GLY 213 264 264 GLY GLY B . n A 1 214 GLU 214 265 265 GLU GLU B . n A 1 215 VAL 215 266 266 VAL VAL B . n A 1 216 GLN 216 267 267 GLN GLN B . n A 1 217 GLU 217 268 268 GLU GLU B . n A 1 218 GLY 218 269 269 GLY GLY B . n A 1 219 ASP 219 270 270 ASP ASP B . n A 1 220 PRO 220 271 271 PRO PRO B . n A 1 221 ARG 221 272 272 ARG ARG B . n A 1 222 TYR 222 273 273 TYR TYR B . n A 1 223 MET 223 274 274 MET MET B . n A 1 224 ALA 224 275 275 ALA ALA B . n A 1 225 PRO 225 276 276 PRO PRO B . n A 1 226 GLU 226 277 277 GLU GLU B . n A 1 227 LEU 227 278 278 LEU LEU B . n A 1 228 LEU 228 279 279 LEU LEU B . n A 1 229 GLN 229 280 280 GLN GLN B . n A 1 230 GLY 230 281 281 GLY GLY B . n A 1 231 SER 231 282 282 SER SER B . n A 1 232 TYR 232 283 283 TYR TYR B . n A 1 233 GLY 233 284 284 GLY GLY B . n A 1 234 THR 234 285 285 THR THR B . n A 1 235 ALA 235 286 286 ALA ALA B . n A 1 236 ALA 236 287 287 ALA ALA B . n A 1 237 ASP 237 288 288 ASP ASP B . n A 1 238 VAL 238 289 289 VAL VAL B . n A 1 239 PHE 239 290 290 PHE PHE B . n A 1 240 SER 240 291 291 SER SER B . n A 1 241 LEU 241 292 292 LEU LEU B . n A 1 242 GLY 242 293 293 GLY GLY B . n A 1 243 LEU 243 294 294 LEU LEU B . n A 1 244 THR 244 295 295 THR THR B . n A 1 245 ILE 245 296 296 ILE ILE B . n A 1 246 LEU 246 297 297 LEU LEU B . n A 1 247 GLU 247 298 298 GLU GLU B . n A 1 248 VAL 248 299 299 VAL VAL B . n A 1 249 ALA 249 300 300 ALA ALA B . n A 1 250 CYS 250 301 301 CYS CYS B . n A 1 251 ASN 251 302 302 ASN ASN B . n A 1 252 MET 252 303 303 MET MET B . n A 1 253 GLU 253 304 304 GLU GLU B . n A 1 254 LEU 254 305 305 LEU LEU B . n A 1 255 PRO 255 306 306 PRO PRO B . n A 1 256 HIS 256 307 307 HIS HIS B . n A 1 257 GLY 257 308 308 GLY GLY B . n A 1 258 GLY 258 309 309 GLY GLY B . n A 1 259 GLU 259 310 310 GLU GLU B . n A 1 260 GLY 260 311 311 GLY GLY B . n A 1 261 TRP 261 312 312 TRP TRP B . n A 1 262 GLN 262 313 313 GLN GLN B . n A 1 263 GLN 263 314 314 GLN GLN B . n A 1 264 LEU 264 315 315 LEU LEU B . n A 1 265 ARG 265 316 316 ARG ARG B . n A 1 266 GLN 266 317 317 GLN GLN B . n A 1 267 GLY 267 318 318 GLY GLY B . n A 1 268 TYR 268 319 319 TYR TYR B . n A 1 269 LEU 269 320 320 LEU LEU B . n A 1 270 PRO 270 321 321 PRO PRO B . n A 1 271 PRO 271 322 322 PRO PRO B . n A 1 272 GLU 272 323 323 GLU GLU B . n A 1 273 PHE 273 324 324 PHE PHE B . n A 1 274 THR 274 325 325 THR THR B . n A 1 275 ALA 275 326 326 ALA ALA B . n A 1 276 GLY 276 327 327 GLY GLY B . n A 1 277 LEU 277 328 328 LEU LEU B . n A 1 278 SER 278 329 329 SER SER B . n A 1 279 SER 279 330 330 SER SER B . n A 1 280 GLU 280 331 331 GLU GLU B . n A 1 281 LEU 281 332 332 LEU LEU B . n A 1 282 ARG 282 333 333 ARG ARG B . n A 1 283 SER 283 334 334 SER SER B . n A 1 284 VAL 284 335 335 VAL VAL B . n A 1 285 LEU 285 336 336 LEU LEU B . n A 1 286 VAL 286 337 337 VAL VAL B . n A 1 287 MET 287 338 338 MET MET B . n A 1 288 MET 288 339 339 MET MET B . n A 1 289 LEU 289 340 340 LEU LEU B . n A 1 290 GLU 290 341 341 GLU GLU B . n A 1 291 PRO 291 342 342 PRO PRO B . n A 1 292 ASP 292 343 343 ASP ASP B . n A 1 293 PRO 293 344 344 PRO PRO B . n A 1 294 LYS 294 345 345 LYS LYS B . n A 1 295 LEU 295 346 346 LEU LEU B . n A 1 296 ARG 296 347 347 ARG ARG B . n A 1 297 ALA 297 348 348 ALA ALA B . n A 1 298 THR 298 349 349 THR THR B . n A 1 299 ALA 299 350 350 ALA ALA B . n A 1 300 GLU 300 351 351 GLU GLU B . n A 1 301 ALA 301 352 352 ALA ALA B . n A 1 302 LEU 302 353 353 LEU LEU B . n A 1 303 LEU 303 354 354 LEU LEU B . n A 1 304 ALA 304 355 355 ALA ALA B . n A 1 305 LEU 305 356 356 LEU LEU B . n A 1 306 PRO 306 357 357 PRO PRO B . n A 1 307 VAL 307 358 358 VAL VAL B . n A 1 308 LEU 308 359 359 LEU LEU B . n A 1 309 ARG 309 360 360 ARG ARG B . n A 1 310 GLN 310 361 361 GLN GLN B . n A 1 311 PRO 311 362 ? ? ? B . n B 1 1 MET 1 52 ? ? ? A . n B 1 2 HIS 2 53 ? ? ? A . n B 1 3 HIS 3 54 ? ? ? A . n B 1 4 HIS 4 55 ? ? ? A . n B 1 5 HIS 5 56 ? ? ? A . n B 1 6 HIS 6 57 ? ? ? A . n B 1 7 HIS 7 58 ? ? ? A . n B 1 8 SER 8 59 ? ? ? A . n B 1 9 SER 9 60 ? ? ? A . n B 1 10 GLY 10 61 ? ? ? A . n B 1 11 VAL 11 62 ? ? ? A . n B 1 12 ASP 12 63 ? ? ? A . n B 1 13 LEU 13 64 ? ? ? A . n B 1 14 GLY 14 65 ? ? ? A . n B 1 15 THR 15 66 ? ? ? A . n B 1 16 GLU 16 67 ? ? ? A . n B 1 17 ASN 17 68 ? ? ? A . n B 1 18 LEU 18 69 ? ? ? A . n B 1 19 TYR 19 70 ? ? ? A . n B 1 20 PHE 20 71 ? ? ? A . n B 1 21 GLN 21 72 ? ? ? A . n B 1 22 SER 22 73 ? ? ? A . n B 1 23 MET 23 74 ? ? ? A . n B 1 24 HIS 24 75 ? ? ? A . n B 1 25 GLN 25 76 ? ? ? A . n B 1 26 LEU 26 77 77 LEU LEU A . n B 1 27 GLN 27 78 78 GLN GLN A . n B 1 28 PRO 28 79 79 PRO PRO A . n B 1 29 ARG 29 80 80 ARG ARG A . n B 1 30 ARG 30 81 81 ARG ARG A . n B 1 31 VAL 31 82 82 VAL VAL A . n B 1 32 SER 32 83 83 SER SER A . n B 1 33 PHE 33 84 84 PHE PHE A . n B 1 34 ARG 34 85 85 ARG ARG A . n B 1 35 GLY 35 86 86 GLY GLY A . n B 1 36 GLU 36 87 87 GLU GLU A . n B 1 37 ALA 37 88 88 ALA ALA A . n B 1 38 SER 38 89 89 SER SER A . n B 1 39 GLU 39 90 90 GLU GLU A . n B 1 40 THR 40 91 ? ? ? A . n B 1 41 LEU 41 92 ? ? ? A . n B 1 42 GLN 42 93 ? ? ? A . n B 1 43 SER 43 94 ? ? ? A . n B 1 44 PRO 44 95 95 PRO PRO A . n B 1 45 GLY 45 96 96 GLY GLY A . n B 1 46 TYR 46 97 97 TYR TYR A . n B 1 47 ASP 47 98 98 ASP ASP A . n B 1 48 PRO 48 99 99 PRO PRO A . n B 1 49 SER 49 100 100 SER SER A . n B 1 50 ARG 50 101 101 ARG ARG A . n B 1 51 PRO 51 102 102 PRO PRO A . n B 1 52 GLU 52 103 103 GLU GLU A . n B 1 53 SER 53 104 104 SER SER A . n B 1 54 PHE 54 105 105 PHE PHE A . n B 1 55 PHE 55 106 106 PHE PHE A . n B 1 56 GLN 56 107 107 GLN GLN A . n B 1 57 GLN 57 108 108 GLN GLN A . n B 1 58 SER 58 109 109 SER SER A . n B 1 59 PHE 59 110 110 PHE PHE A . n B 1 60 GLN 60 111 111 GLN GLN A . n B 1 61 ARG 61 112 112 ARG ARG A . n B 1 62 LEU 62 113 113 LEU LEU A . n B 1 63 SER 63 114 114 SER SER A . n B 1 64 ARG 64 115 115 ARG ARG A . n B 1 65 LEU 65 116 116 LEU LEU A . n B 1 66 GLY 66 117 117 GLY GLY A . n B 1 67 HIS 67 118 118 HIS HIS A . n B 1 68 GLY 68 119 119 GLY GLY A . n B 1 69 SER 69 120 120 SER SER A . n B 1 70 TYR 70 121 121 TYR TYR A . n B 1 71 GLY 71 122 122 GLY GLY A . n B 1 72 GLU 72 123 123 GLU GLU A . n B 1 73 VAL 73 124 124 VAL VAL A . n B 1 74 PHE 74 125 125 PHE PHE A . n B 1 75 LYS 75 126 126 LYS LYS A . n B 1 76 VAL 76 127 127 VAL VAL A . n B 1 77 ARG 77 128 128 ARG ARG A . n B 1 78 SER 78 129 129 SER SER A . n B 1 79 LYS 79 130 130 LYS LYS A . n B 1 80 GLU 80 131 131 GLU GLU A . n B 1 81 ASP 81 132 132 ASP ASP A . n B 1 82 GLY 82 133 133 GLY GLY A . n B 1 83 ARG 83 134 134 ARG ARG A . n B 1 84 LEU 84 135 135 LEU LEU A . n B 1 85 TYR 85 136 136 TYR TYR A . n B 1 86 ALA 86 137 137 ALA ALA A . n B 1 87 VAL 87 138 138 VAL VAL A . n B 1 88 LYS 88 139 139 LYS LYS A . n B 1 89 ARG 89 140 140 ARG ARG A . n B 1 90 SER 90 141 141 SER SER A . n B 1 91 MET 91 142 142 MET MET A . n B 1 92 SER 92 143 143 SER SER A . n B 1 93 PRO 93 144 144 PRO PRO A . n B 1 94 PHE 94 145 145 PHE PHE A . n B 1 95 ARG 95 146 146 ARG ARG A . n B 1 96 GLY 96 147 147 GLY GLY A . n B 1 97 PRO 97 148 148 PRO PRO A . n B 1 98 LYS 98 149 149 LYS LYS A . n B 1 99 ASP 99 150 150 ASP ASP A . n B 1 100 ARG 100 151 151 ARG ARG A . n B 1 101 ALA 101 152 152 ALA ALA A . n B 1 102 ARG 102 153 153 ARG ARG A . n B 1 103 LYS 103 154 154 LYS LYS A . n B 1 104 LEU 104 155 155 LEU LEU A . n B 1 105 ALA 105 156 156 ALA ALA A . n B 1 106 GLU 106 157 157 GLU GLU A . n B 1 107 VAL 107 158 158 VAL VAL A . n B 1 108 GLY 108 159 159 GLY GLY A . n B 1 109 SER 109 160 160 SER SER A . n B 1 110 HIS 110 161 161 HIS HIS A . n B 1 111 GLU 111 162 162 GLU GLU A . n B 1 112 LYS 112 163 163 LYS LYS A . n B 1 113 VAL 113 164 164 VAL VAL A . n B 1 114 GLY 114 165 165 GLY GLY A . n B 1 115 GLN 115 166 166 GLN GLN A . n B 1 116 HIS 116 167 167 HIS HIS A . n B 1 117 PRO 117 168 168 PRO PRO A . n B 1 118 CYS 118 169 169 CYS CYS A . n B 1 119 CYS 119 170 170 CYS CYS A . n B 1 120 VAL 120 171 171 VAL VAL A . n B 1 121 ARG 121 172 172 ARG ARG A . n B 1 122 LEU 122 173 173 LEU LEU A . n B 1 123 GLU 123 174 174 GLU GLU A . n B 1 124 GLN 124 175 175 GLN GLN A . n B 1 125 ALA 125 176 176 ALA ALA A . n B 1 126 TRP 126 177 177 TRP TRP A . n B 1 127 GLU 127 178 178 GLU GLU A . n B 1 128 GLU 128 179 179 GLU GLU A . n B 1 129 GLY 129 180 180 GLY GLY A . n B 1 130 GLY 130 181 181 GLY GLY A . n B 1 131 ILE 131 182 182 ILE ILE A . n B 1 132 LEU 132 183 183 LEU LEU A . n B 1 133 TYR 133 184 184 TYR TYR A . n B 1 134 LEU 134 185 185 LEU LEU A . n B 1 135 GLN 135 186 186 GLN GLN A . n B 1 136 THR 136 187 187 THR THR A . n B 1 137 GLU 137 188 188 GLU GLU A . n B 1 138 LEU 138 189 189 LEU LEU A . n B 1 139 CYS 139 190 190 CYS CYS A . n B 1 140 GLY 140 191 191 GLY GLY A . n B 1 141 PRO 141 192 192 PRO PRO A . n B 1 142 SER 142 193 193 SER SER A . n B 1 143 LEU 143 194 194 LEU LEU A . n B 1 144 GLN 144 195 195 GLN GLN A . n B 1 145 GLN 145 196 196 GLN GLN A . n B 1 146 HIS 146 197 197 HIS HIS A . n B 1 147 CYS 147 198 198 CYS CYS A . n B 1 148 GLU 148 199 199 GLU GLU A . n B 1 149 ALA 149 200 200 ALA ALA A . n B 1 150 TRP 150 201 201 TRP TRP A . n B 1 151 GLY 151 202 202 GLY GLY A . n B 1 152 ALA 152 203 203 ALA ALA A . n B 1 153 SER 153 204 204 SER SER A . n B 1 154 LEU 154 205 205 LEU LEU A . n B 1 155 PRO 155 206 206 PRO PRO A . n B 1 156 GLU 156 207 207 GLU GLU A . n B 1 157 ALA 157 208 208 ALA ALA A . n B 1 158 GLN 158 209 209 GLN GLN A . n B 1 159 VAL 159 210 210 VAL VAL A . n B 1 160 TRP 160 211 211 TRP TRP A . n B 1 161 GLY 161 212 212 GLY GLY A . n B 1 162 TYR 162 213 213 TYR TYR A . n B 1 163 LEU 163 214 214 LEU LEU A . n B 1 164 ARG 164 215 215 ARG ARG A . n B 1 165 ASP 165 216 216 ASP ASP A . n B 1 166 THR 166 217 217 THR THR A . n B 1 167 LEU 167 218 218 LEU LEU A . n B 1 168 LEU 168 219 219 LEU LEU A . n B 1 169 ALA 169 220 220 ALA ALA A . n B 1 170 LEU 170 221 221 LEU LEU A . n B 1 171 ALA 171 222 222 ALA ALA A . n B 1 172 HIS 172 223 223 HIS HIS A . n B 1 173 LEU 173 224 224 LEU LEU A . n B 1 174 HIS 174 225 225 HIS HIS A . n B 1 175 SER 175 226 226 SER SER A . n B 1 176 GLN 176 227 227 GLN GLN A . n B 1 177 GLY 177 228 228 GLY GLY A . n B 1 178 LEU 178 229 229 LEU LEU A . n B 1 179 VAL 179 230 230 VAL VAL A . n B 1 180 HIS 180 231 231 HIS HIS A . n B 1 181 LEU 181 232 232 LEU LEU A . n B 1 182 ASP 182 233 233 ASP ASP A . n B 1 183 VAL 183 234 234 VAL VAL A . n B 1 184 LYS 184 235 235 LYS LYS A . n B 1 185 PRO 185 236 236 PRO PRO A . n B 1 186 ALA 186 237 237 ALA ALA A . n B 1 187 ASN 187 238 238 ASN ASN A . n B 1 188 ILE 188 239 239 ILE ILE A . n B 1 189 PHE 189 240 240 PHE PHE A . n B 1 190 LEU 190 241 241 LEU LEU A . n B 1 191 GLY 191 242 242 GLY GLY A . n B 1 192 PRO 192 243 243 PRO PRO A . n B 1 193 ARG 193 244 244 ARG ARG A . n B 1 194 GLY 194 245 245 GLY GLY A . n B 1 195 ARG 195 246 246 ARG ARG A . n B 1 196 CYS 196 247 247 CYS CYS A . n B 1 197 LYS 197 248 248 LYS LYS A . n B 1 198 LEU 198 249 249 LEU LEU A . n B 1 199 GLY 199 250 250 GLY GLY A . n B 1 200 ASP 200 251 251 ASP ASP A . n B 1 201 PHE 201 252 252 PHE PHE A . n B 1 202 GLY 202 253 253 GLY GLY A . n B 1 203 LEU 203 254 254 LEU LEU A . n B 1 204 LEU 204 255 255 LEU LEU A . n B 1 205 VAL 205 256 256 VAL VAL A . n B 1 206 GLU 206 257 257 GLU GLU A . n B 1 207 LEU 207 258 258 LEU LEU A . n B 1 208 GLY 208 259 259 GLY GLY A . n B 1 209 THR 209 260 260 THR THR A . n B 1 210 ALA 210 261 261 ALA ALA A . n B 1 211 GLY 211 262 ? ? ? A . n B 1 212 ALA 212 263 ? ? ? A . n B 1 213 GLY 213 264 ? ? ? A . n B 1 214 GLU 214 265 265 GLU GLU A . n B 1 215 VAL 215 266 266 VAL VAL A . n B 1 216 GLN 216 267 267 GLN GLN A . n B 1 217 GLU 217 268 268 GLU GLU A . n B 1 218 GLY 218 269 269 GLY GLY A . n B 1 219 ASP 219 270 270 ASP ASP A . n B 1 220 PRO 220 271 271 PRO PRO A . n B 1 221 ARG 221 272 272 ARG ARG A . n B 1 222 TYR 222 273 273 TYR TYR A . n B 1 223 MET 223 274 274 MET MET A . n B 1 224 ALA 224 275 275 ALA ALA A . n B 1 225 PRO 225 276 276 PRO PRO A . n B 1 226 GLU 226 277 277 GLU GLU A . n B 1 227 LEU 227 278 278 LEU LEU A . n B 1 228 LEU 228 279 279 LEU LEU A . n B 1 229 GLN 229 280 280 GLN GLN A . n B 1 230 GLY 230 281 281 GLY GLY A . n B 1 231 SER 231 282 282 SER SER A . n B 1 232 TYR 232 283 283 TYR TYR A . n B 1 233 GLY 233 284 284 GLY GLY A . n B 1 234 THR 234 285 285 THR THR A . n B 1 235 ALA 235 286 286 ALA ALA A . n B 1 236 ALA 236 287 287 ALA ALA A . n B 1 237 ASP 237 288 288 ASP ASP A . n B 1 238 VAL 238 289 289 VAL VAL A . n B 1 239 PHE 239 290 290 PHE PHE A . n B 1 240 SER 240 291 291 SER SER A . n B 1 241 LEU 241 292 292 LEU LEU A . n B 1 242 GLY 242 293 293 GLY GLY A . n B 1 243 LEU 243 294 294 LEU LEU A . n B 1 244 THR 244 295 295 THR THR A . n B 1 245 ILE 245 296 296 ILE ILE A . n B 1 246 LEU 246 297 297 LEU LEU A . n B 1 247 GLU 247 298 298 GLU GLU A . n B 1 248 VAL 248 299 299 VAL VAL A . n B 1 249 ALA 249 300 300 ALA ALA A . n B 1 250 CYS 250 301 301 CYS CYS A . n B 1 251 ASN 251 302 302 ASN ASN A . n B 1 252 MET 252 303 303 MET MET A . n B 1 253 GLU 253 304 304 GLU GLU A . n B 1 254 LEU 254 305 305 LEU LEU A . n B 1 255 PRO 255 306 306 PRO PRO A . n B 1 256 HIS 256 307 307 HIS HIS A . n B 1 257 GLY 257 308 308 GLY GLY A . n B 1 258 GLY 258 309 309 GLY GLY A . n B 1 259 GLU 259 310 310 GLU GLU A . n B 1 260 GLY 260 311 311 GLY GLY A . n B 1 261 TRP 261 312 312 TRP TRP A . n B 1 262 GLN 262 313 313 GLN GLN A . n B 1 263 GLN 263 314 314 GLN GLN A . n B 1 264 LEU 264 315 315 LEU LEU A . n B 1 265 ARG 265 316 316 ARG ARG A . n B 1 266 GLN 266 317 317 GLN GLN A . n B 1 267 GLY 267 318 318 GLY GLY A . n B 1 268 TYR 268 319 319 TYR TYR A . n B 1 269 LEU 269 320 320 LEU LEU A . n B 1 270 PRO 270 321 321 PRO PRO A . n B 1 271 PRO 271 322 322 PRO PRO A . n B 1 272 GLU 272 323 323 GLU GLU A . n B 1 273 PHE 273 324 324 PHE PHE A . n B 1 274 THR 274 325 325 THR THR A . n B 1 275 ALA 275 326 326 ALA ALA A . n B 1 276 GLY 276 327 327 GLY GLY A . n B 1 277 LEU 277 328 328 LEU LEU A . n B 1 278 SER 278 329 329 SER SER A . n B 1 279 SER 279 330 330 SER SER A . n B 1 280 GLU 280 331 331 GLU GLU A . n B 1 281 LEU 281 332 332 LEU LEU A . n B 1 282 ARG 282 333 333 ARG ARG A . n B 1 283 SER 283 334 334 SER SER A . n B 1 284 VAL 284 335 335 VAL VAL A . n B 1 285 LEU 285 336 336 LEU LEU A . n B 1 286 VAL 286 337 337 VAL VAL A . n B 1 287 MET 287 338 338 MET MET A . n B 1 288 MET 288 339 339 MET MET A . n B 1 289 LEU 289 340 340 LEU LEU A . n B 1 290 GLU 290 341 341 GLU GLU A . n B 1 291 PRO 291 342 342 PRO PRO A . n B 1 292 ASP 292 343 343 ASP ASP A . n B 1 293 PRO 293 344 344 PRO PRO A . n B 1 294 LYS 294 345 345 LYS LYS A . n B 1 295 LEU 295 346 346 LEU LEU A . n B 1 296 ARG 296 347 347 ARG ARG A . n B 1 297 ALA 297 348 348 ALA ALA A . n B 1 298 THR 298 349 349 THR THR A . n B 1 299 ALA 299 350 350 ALA ALA A . n B 1 300 GLU 300 351 351 GLU GLU A . n B 1 301 ALA 301 352 352 ALA ALA A . n B 1 302 LEU 302 353 353 LEU LEU A . n B 1 303 LEU 303 354 354 LEU LEU A . n B 1 304 ALA 304 355 355 ALA ALA A . n B 1 305 LEU 305 356 356 LEU LEU A . n B 1 306 PRO 306 357 357 PRO PRO A . n B 1 307 VAL 307 358 358 VAL VAL A . n B 1 308 LEU 308 359 359 LEU LEU A . n B 1 309 ARG 309 360 360 ARG ARG A . n B 1 310 GLN 310 361 361 GLN GLN A . n B 1 311 PRO 311 362 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email sicheri@lunenfeld.ca _pdbx_contact_author.name_first Frank _pdbx_contact_author.name_last Sicheri _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9824-2117 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 SO4 1 401 401 SO4 SO4 B . D 3 QGI 1 402 501 QGI DRG B . E 4 GOL 1 403 601 GOL GOL B . F 5 EDO 1 404 701 EDO EDO B . G 5 EDO 1 405 801 EDO EDO B . H 5 EDO 1 406 901 EDO EDO B . I 5 EDO 1 407 1001 EDO EDO B . J 4 GOL 1 408 1101 GOL GOL B . K 4 GOL 1 409 1201 GOL GOL B . L 5 EDO 1 410 1401 EDO EDO B . M 5 EDO 1 1301 1301 EDO EDO A . N 2 SO4 1 1302 401 SO4 SO4 A . O 3 QGI 1 1303 501 QGI DRG A . P 5 EDO 1 1304 601 EDO EDO A . Q 5 EDO 1 1305 701 EDO EDO A . R 5 EDO 1 1306 801 EDO EDO A . S 5 EDO 1 1307 901 EDO EDO A . T 5 EDO 1 1308 1001 EDO EDO A . U 5 EDO 1 1309 1101 EDO EDO A . V 6 HOH 1 501 30 HOH HOH B . V 6 HOH 2 502 85 HOH HOH B . V 6 HOH 3 503 82 HOH HOH B . V 6 HOH 4 504 69 HOH HOH B . V 6 HOH 5 505 93 HOH HOH B . V 6 HOH 6 506 78 HOH HOH B . V 6 HOH 7 507 71 HOH HOH B . V 6 HOH 8 508 4 HOH HOH B . V 6 HOH 9 509 88 HOH HOH B . V 6 HOH 10 510 90 HOH HOH B . V 6 HOH 11 511 13 HOH HOH B . V 6 HOH 12 512 65 HOH HOH B . V 6 HOH 13 513 77 HOH HOH B . V 6 HOH 14 514 21 HOH HOH B . V 6 HOH 15 515 25 HOH HOH B . V 6 HOH 16 516 83 HOH HOH B . V 6 HOH 17 517 76 HOH HOH B . V 6 HOH 18 518 79 HOH HOH B . V 6 HOH 19 519 10 HOH HOH B . V 6 HOH 20 520 2 HOH HOH B . V 6 HOH 21 521 80 HOH HOH B . V 6 HOH 22 522 75 HOH HOH B . V 6 HOH 23 523 81 HOH HOH B . V 6 HOH 24 524 12 HOH HOH B . V 6 HOH 25 525 29 HOH HOH B . V 6 HOH 26 526 17 HOH HOH B . V 6 HOH 27 527 95 HOH HOH B . V 6 HOH 28 528 6 HOH HOH B . V 6 HOH 29 529 74 HOH HOH B . V 6 HOH 30 530 92 HOH HOH B . V 6 HOH 31 531 86 HOH HOH B . V 6 HOH 32 532 7 HOH HOH B . V 6 HOH 33 533 9 HOH HOH B . V 6 HOH 34 534 38 HOH HOH B . V 6 HOH 35 535 24 HOH HOH B . V 6 HOH 36 536 16 HOH HOH B . V 6 HOH 37 537 68 HOH HOH B . V 6 HOH 38 538 66 HOH HOH B . V 6 HOH 39 539 64 HOH HOH B . V 6 HOH 40 540 67 HOH HOH B . V 6 HOH 41 541 23 HOH HOH B . V 6 HOH 42 542 73 HOH HOH B . V 6 HOH 43 543 89 HOH HOH B . V 6 HOH 44 544 91 HOH HOH B . V 6 HOH 45 545 70 HOH HOH B . V 6 HOH 46 546 63 HOH HOH B . V 6 HOH 47 547 62 HOH HOH B . W 6 HOH 1 1401 46 HOH HOH A . W 6 HOH 2 1402 39 HOH HOH A . W 6 HOH 3 1403 32 HOH HOH A . W 6 HOH 4 1404 37 HOH HOH A . W 6 HOH 5 1405 20 HOH HOH A . W 6 HOH 6 1406 42 HOH HOH A . W 6 HOH 7 1407 55 HOH HOH A . W 6 HOH 8 1408 56 HOH HOH A . W 6 HOH 9 1409 22 HOH HOH A . W 6 HOH 10 1410 1 HOH HOH A . W 6 HOH 11 1411 28 HOH HOH A . W 6 HOH 12 1412 41 HOH HOH A . W 6 HOH 13 1413 58 HOH HOH A . W 6 HOH 14 1414 14 HOH HOH A . W 6 HOH 15 1415 49 HOH HOH A . W 6 HOH 16 1416 87 HOH HOH A . W 6 HOH 17 1417 96 HOH HOH A . W 6 HOH 18 1418 47 HOH HOH A . W 6 HOH 19 1419 60 HOH HOH A . W 6 HOH 20 1420 52 HOH HOH A . W 6 HOH 21 1421 19 HOH HOH A . W 6 HOH 22 1422 8 HOH HOH A . W 6 HOH 23 1423 26 HOH HOH A . W 6 HOH 24 1424 40 HOH HOH A . W 6 HOH 25 1425 48 HOH HOH A . W 6 HOH 26 1426 53 HOH HOH A . W 6 HOH 27 1427 45 HOH HOH A . W 6 HOH 28 1428 57 HOH HOH A . W 6 HOH 29 1429 11 HOH HOH A . W 6 HOH 30 1430 35 HOH HOH A . W 6 HOH 31 1431 61 HOH HOH A . W 6 HOH 32 1432 3 HOH HOH A . W 6 HOH 33 1433 5 HOH HOH A . W 6 HOH 34 1434 54 HOH HOH A . W 6 HOH 35 1435 15 HOH HOH A . W 6 HOH 36 1436 31 HOH HOH A . W 6 HOH 37 1437 36 HOH HOH A . W 6 HOH 38 1438 27 HOH HOH A . W 6 HOH 39 1439 18 HOH HOH A . W 6 HOH 40 1440 50 HOH HOH A . W 6 HOH 41 1441 51 HOH HOH A . W 6 HOH 42 1442 84 HOH HOH A . W 6 HOH 43 1443 33 HOH HOH A . W 6 HOH 44 1444 34 HOH HOH A . W 6 HOH 45 1445 94 HOH HOH A . W 6 HOH 46 1446 59 HOH HOH A . W 6 HOH 47 1447 44 HOH HOH A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA monomeric 1 2 author_and_software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,D,E,F,G,H,I,J,K,L,V 2 1 B,M,N,O,P,Q,R,S,T,U,W # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-07-27 2 'Structure model' 1 1 2022-08-10 3 'Structure model' 1 2 2022-08-24 4 'Structure model' 1 3 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' pdbx_initial_refinement_model 8 4 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_ISSN' 3 2 'Structure model' '_citation.pdbx_database_id_DOI' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation.year' 7 2 'Structure model' '_citation_author.identifier_ORCID' 8 2 'Structure model' '_citation_author.name' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 3 'Structure model' '_citation_author.identifier_ORCID' 13 4 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 14 4 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 15 4 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 16 4 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 17 4 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 18 4 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 19 4 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 20 4 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -11.8070 -17.6179 -0.5879 0.6417 ? 0.0526 ? -0.3592 ? 1.1179 ? -0.2167 ? 1.3509 ? 0.2350 ? -0.2256 ? -0.3854 ? 1.0866 ? 1.5815 ? 2.3109 ? -0.3363 ? 0.0900 ? 0.0072 ? 0.2929 ? -0.6760 ? 0.4095 ? -0.1311 ? -1.0479 ? -1.2998 ? 2 'X-RAY DIFFRACTION' ? refined -0.1450 -6.1564 2.9604 0.9726 ? 0.1392 ? -0.5469 ? 0.6276 ? -0.1526 ? 1.4742 ? 0.2538 ? -0.1002 ? 0.4578 ? 0.1290 ? -0.2614 ? 0.9228 ? -0.6758 ? 0.0686 ? 0.4508 ? -1.1865 ? -0.3220 ? 1.5373 ? -1.0533 ? -0.3259 ? -0.7504 ? 3 'X-RAY DIFFRACTION' ? refined -0.1763 -18.5872 3.7125 0.6007 ? 0.0149 ? -0.1349 ? 0.6699 ? -0.0898 ? 0.8096 ? 1.7381 ? 1.4620 ? 0.7072 ? 1.2298 ? 0.3574 ? 2.5600 ? -0.3227 ? -0.1735 ? 0.2653 ? -0.2814 ? -0.3315 ? 0.5777 ? -0.3048 ? -0.2220 ? -0.8913 ? 4 'X-RAY DIFFRACTION' ? refined 6.9456 -14.7653 18.6006 0.6608 ? -0.0409 ? 0.0735 ? 0.6523 ? -0.0968 ? 0.6761 ? 0.2660 ? -0.0804 ? 0.6780 ? 2.8518 ? 0.8827 ? 1.6439 ? -0.0975 ? -0.2340 ? 0.1522 ? 0.7452 ? -0.3428 ? 0.7893 ? 0.1623 ? -0.2863 ? -0.0106 ? 5 'X-RAY DIFFRACTION' ? refined 8.4124 -30.3730 11.1608 1.0653 ? -0.0904 ? 0.0201 ? 0.6477 ? -0.0787 ? 0.9212 ? 2.0997 ? 0.0482 ? 1.4928 ? 0.9865 ? -1.2116 ? 2.8066 ? -0.0068 ? 0.4936 ? -0.5980 ? 0.0662 ? -0.1503 ? 0.0926 ? 1.1396 ? -0.4084 ? 0.2559 ? 6 'X-RAY DIFFRACTION' ? refined 20.0090 -24.5844 18.6883 0.9181 ? 0.0233 ? -0.0218 ? 0.6977 ? 0.0203 ? 0.5687 ? 0.4612 ? -0.2885 ? 0.0620 ? 0.2785 ? -0.1308 ? 0.0819 ? -0.2191 ? 0.1976 ? 0.0739 ? 0.6005 ? 0.1082 ? -0.2824 ? 0.3915 ? 0.2085 ? 0.0000 ? 7 'X-RAY DIFFRACTION' ? refined 29.7322 -19.3420 22.0883 0.8801 ? 0.0480 ? -0.1502 ? 0.7658 ? -0.0278 ? 0.7755 ? 0.4940 ? 0.0171 ? -0.2901 ? 0.4136 ? -0.0040 ? 0.1671 ? 0.1204 ? -0.1533 ? 0.0156 ? 0.4164 ? 0.0698 ? -1.1637 ? 0.0251 ? 0.6083 ? -0.0025 ? 8 'X-RAY DIFFRACTION' ? refined 17.9739 -24.9911 32.1132 1.2579 ? -0.0374 ? 0.0396 ? 0.7493 ? -0.0032 ? 0.5549 ? 0.9901 ? 1.0259 ? 0.1362 ? 1.4487 ? 0.6321 ? 0.8166 ? 0.0685 ? -0.4277 ? -0.3519 ? 1.3792 ? -0.0821 ? -0.6358 ? 0.4506 ? 0.4469 ? -0.0073 ? 9 'X-RAY DIFFRACTION' ? refined 35.9248 12.4968 -4.6320 1.4463 ? 0.4657 ? 0.9323 ? 1.0492 ? 0.3351 ? 1.4724 ? 2.1062 ? 0.7223 ? 2.0454 ? 0.2531 ? 0.7182 ? 2.0016 ? -0.7916 ? 0.5631 ? -0.4137 ? -0.7930 ? -0.7827 ? -0.5960 ? 1.2453 ? 0.9003 ? -3.3351 ? 10 'X-RAY DIFFRACTION' ? refined 24.3135 4.8271 1.8471 1.2017 ? 0.2284 ? 0.5005 ? 0.4402 ? 0.1054 ? 1.0471 ? 2.2632 ? -0.9408 ? 0.6091 ? 0.4561 ? -0.3986 ? 6.0761 ? -0.7288 ? 0.2362 ? -0.1031 ? -1.6116 ? -0.5892 ? -1.3124 ? 1.2962 ? -0.3188 ? -4.6676 ? 11 'X-RAY DIFFRACTION' ? refined 23.1045 22.0236 -1.1939 0.7273 ? 0.0106 ? 0.1219 ? 0.7398 ? 0.0252 ? 0.7118 ? 0.3448 ? 0.5960 ? 0.5233 ? 3.8641 ? -1.5211 ? 2.7879 ? -0.4905 ? -0.3502 ? -0.4401 ? -1.3904 ? 0.1698 ? -0.2085 ? 1.0274 ? -0.3005 ? -0.2807 ? 12 'X-RAY DIFFRACTION' ? refined 28.1028 14.1983 6.2143 0.8216 ? 0.1804 ? 0.3065 ? 0.8615 ? 0.2334 ? 0.9922 ? 1.2309 ? 0.7884 ? -2.0729 ? 1.2094 ? -0.6001 ? 4.1411 ? -0.4500 ? -0.5432 ? -0.6425 ? -0.8792 ? -0.5057 ? -1.6517 ? 0.0755 ? 1.4307 ? 0.0959 ? 13 'X-RAY DIFFRACTION' ? refined 15.0516 15.3805 16.7832 0.6117 ? 0.0318 ? -0.0232 ? 0.6414 ? 0.0396 ? 0.5573 ? 1.3012 ? -0.7968 ? 0.1782 ? 2.7023 ? 0.4070 ? 0.9469 ? 0.1478 ? 0.0345 ? -0.1205 ? 0.0478 ? -0.1617 ? -0.0686 ? 0.0900 ? -0.0831 ? 0.0001 ? 14 'X-RAY DIFFRACTION' ? refined 5.0439 28.2370 12.2747 0.8592 ? 0.1077 ? -0.0463 ? 0.7407 ? 0.0149 ? 0.6150 ? 1.7554 ? 0.3581 ? -0.1570 ? 0.1523 ? 0.2621 ? 1.3080 ? -0.2953 ? 0.1219 ? 0.3763 ? 0.0132 ? 0.4722 ? 0.2435 ? -1.0815 ? -0.4704 ? 0.1588 ? 15 'X-RAY DIFFRACTION' ? refined 0.8115 19.9407 18.2396 0.6210 ? 0.0745 ? 0.0612 ? 0.7971 ? 0.0677 ? 0.6160 ? 0.4297 ? -0.4204 ? -0.2536 ? 0.4636 ? 0.3448 ? 0.3797 ? 0.2405 ? 0.2226 ? -0.1545 ? 0.0828 ? -0.0826 ? 0.3610 ? 0.2427 ? -0.2553 ? -0.0004 ? 16 'X-RAY DIFFRACTION' ? refined 0.2983 16.6472 29.3990 1.0968 ? -0.0466 ? 0.2442 ? 0.9664 ? 0.1650 ? 0.7550 ? 0.7756 ? -1.4784 ? 0.2282 ? 4.3032 ? -1.8336 ? 1.3716 ? -0.1878 ? -0.2458 ? -0.3661 ? 1.4451 ? 0.6090 ? 0.8670 ? 0.0783 ? -0.6870 ? 0.1978 ? 17 'X-RAY DIFFRACTION' ? refined 11.2230 25.4327 29.0817 1.0197 ? -0.0020 ? -0.0216 ? 0.8049 ? 0.0409 ? 0.5196 ? 1.0166 ? -0.3940 ? 0.3884 ? 1.6756 ? -1.1433 ? 1.0248 ? -0.0994 ? -0.5878 ? 0.4911 ? 1.5732 ? -0.2732 ? 0.3027 ? -0.4653 ? -0.0360 ? -0.0564 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? B 77 ? ? ? B 104 ? ? ;chain 'B' and (resid 77 through 104 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? B 105 ? ? ? B 129 ? ? ;chain 'B' and (resid 105 through 129 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? B 130 ? ? ? B 164 ? ? ;chain 'B' and (resid 130 through 164 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? B 165 ? ? ? B 249 ? ? ;chain 'B' and (resid 165 through 249 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? B 250 ? ? ? B 269 ? ? ;chain 'B' and (resid 250 through 269 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? B 270 ? ? ? B 301 ? ? ;chain 'B' and (resid 270 through 301 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? B 302 ? ? ? B 329 ? ? ;chain 'B' and (resid 302 through 329 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? B 330 ? ? ? B 361 ? ? ;chain 'B' and (resid 330 through 361 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? A 77 ? ? ? A 109 ? ? ;chain 'A' and (resid 77 through 109 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? A 110 ? ? ? A 140 ? ? ;chain 'A' and (resid 110 through 140 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? A 141 ? ? ? A 164 ? ? ;chain 'A' and (resid 141 through 164 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? A 165 ? ? ? A 188 ? ? ;chain 'A' and (resid 165 through 188 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? A 189 ? ? ? A 270 ? ? ;chain 'A' and (resid 189 through 270 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? A 271 ? ? ? A 284 ? ? ;chain 'A' and (resid 271 through 284 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? A 285 ? ? ? A 321 ? ? ;chain 'A' and (resid 285 through 321 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? A 322 ? ? ? A 339 ? ? ;chain 'A' and (resid 322 through 339 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? A 340 ? ? ? A 361 ? ? ;chain 'A' and (resid 340 through 361 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _pdbx_entry_details.entry_id 8D6E _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLN 209 ? ? O A HOH 1401 ? ? 1.97 2 1 O B ARG 128 ? ? O B HOH 501 ? ? 2.07 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER B 89 ? ? -159.04 39.38 2 1 ASP B 233 ? ? -145.23 45.83 3 1 ASP B 251 ? ? 58.57 80.76 4 1 SER A 89 ? ? -158.70 37.24 5 1 ASP A 233 ? ? -145.25 43.57 6 1 ASP A 251 ? ? 57.02 82.01 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 B LEU 77 ? CG ? A LEU 26 CG 2 1 Y 1 B LEU 77 ? CD1 ? A LEU 26 CD1 3 1 Y 1 B LEU 77 ? CD2 ? A LEU 26 CD2 4 1 Y 1 B GLN 78 ? OE1 ? A GLN 27 OE1 5 1 Y 1 B GLN 78 ? NE2 ? A GLN 27 NE2 6 1 Y 1 B SER 100 ? OG ? A SER 49 OG 7 1 Y 1 B ARG 101 ? CG ? A ARG 50 CG 8 1 Y 1 B ARG 101 ? CD ? A ARG 50 CD 9 1 Y 1 B ARG 101 ? NE ? A ARG 50 NE 10 1 Y 1 B ARG 101 ? CZ ? A ARG 50 CZ 11 1 Y 1 B ARG 101 ? NH1 ? A ARG 50 NH1 12 1 Y 1 B ARG 101 ? NH2 ? A ARG 50 NH2 13 1 Y 1 B GLU 103 ? CG ? A GLU 52 CG 14 1 Y 1 B GLU 103 ? CD ? A GLU 52 CD 15 1 Y 1 B GLU 103 ? OE1 ? A GLU 52 OE1 16 1 Y 1 B GLU 103 ? OE2 ? A GLU 52 OE2 17 1 Y 1 B LYS 126 ? CD ? A LYS 75 CD 18 1 Y 1 B LYS 126 ? CE ? A LYS 75 CE 19 1 Y 1 B LYS 126 ? NZ ? A LYS 75 NZ 20 1 Y 1 B GLU 131 ? CG ? A GLU 80 CG 21 1 Y 1 B GLU 131 ? CD ? A GLU 80 CD 22 1 Y 1 B GLU 131 ? OE1 ? A GLU 80 OE1 23 1 Y 1 B GLU 131 ? OE2 ? A GLU 80 OE2 24 1 Y 1 B ARG 134 ? CZ ? A ARG 83 CZ 25 1 Y 1 B ARG 134 ? NH1 ? A ARG 83 NH1 26 1 Y 1 B ARG 134 ? NH2 ? A ARG 83 NH2 27 1 Y 1 B ARG 146 ? CG ? A ARG 95 CG 28 1 Y 1 B ARG 146 ? CD ? A ARG 95 CD 29 1 Y 1 B ARG 146 ? NE ? A ARG 95 NE 30 1 Y 1 B ARG 146 ? CZ ? A ARG 95 CZ 31 1 Y 1 B ARG 146 ? NH1 ? A ARG 95 NH1 32 1 Y 1 B ARG 146 ? NH2 ? A ARG 95 NH2 33 1 Y 1 B GLN 166 ? CD ? A GLN 115 CD 34 1 Y 1 B GLN 166 ? OE1 ? A GLN 115 OE1 35 1 Y 1 B GLN 166 ? NE2 ? A GLN 115 NE2 36 1 Y 1 B GLU 179 ? CG ? A GLU 128 CG 37 1 Y 1 B GLU 179 ? CD ? A GLU 128 CD 38 1 Y 1 B GLU 179 ? OE1 ? A GLU 128 OE1 39 1 Y 1 B GLU 179 ? OE2 ? A GLU 128 OE2 40 1 Y 1 B ARG 244 ? CD ? A ARG 193 CD 41 1 Y 1 B ARG 244 ? NE ? A ARG 193 NE 42 1 Y 1 B ARG 244 ? CZ ? A ARG 193 CZ 43 1 Y 1 B ARG 244 ? NH1 ? A ARG 193 NH1 44 1 Y 1 B ARG 244 ? NH2 ? A ARG 193 NH2 45 1 Y 1 B GLU 265 ? CG ? A GLU 214 CG 46 1 Y 1 B GLU 265 ? CD ? A GLU 214 CD 47 1 Y 1 B GLU 265 ? OE1 ? A GLU 214 OE1 48 1 Y 1 B GLU 265 ? OE2 ? A GLU 214 OE2 49 1 Y 1 B GLU 304 ? OE1 ? A GLU 253 OE1 50 1 Y 1 B GLU 304 ? OE2 ? A GLU 253 OE2 51 1 Y 1 B GLU 310 ? CG ? A GLU 259 CG 52 1 Y 1 B GLU 310 ? CD ? A GLU 259 CD 53 1 Y 1 B GLU 310 ? OE1 ? A GLU 259 OE1 54 1 Y 1 B GLU 310 ? OE2 ? A GLU 259 OE2 55 1 Y 1 B TYR 319 ? CD1 ? A TYR 268 CD1 56 1 Y 1 B TYR 319 ? CD2 ? A TYR 268 CD2 57 1 Y 1 B TYR 319 ? CE1 ? A TYR 268 CE1 58 1 Y 1 B TYR 319 ? CE2 ? A TYR 268 CE2 59 1 Y 1 B TYR 319 ? CZ ? A TYR 268 CZ 60 1 Y 1 B TYR 319 ? OH ? A TYR 268 OH 61 1 Y 1 B GLU 323 ? CG ? A GLU 272 CG 62 1 Y 1 B GLU 323 ? CD ? A GLU 272 CD 63 1 Y 1 B GLU 323 ? OE1 ? A GLU 272 OE1 64 1 Y 1 B GLU 323 ? OE2 ? A GLU 272 OE2 65 1 Y 1 B GLU 351 ? CG ? A GLU 300 CG 66 1 Y 1 B GLU 351 ? CD ? A GLU 300 CD 67 1 Y 1 B GLU 351 ? OE1 ? A GLU 300 OE1 68 1 Y 1 B GLU 351 ? OE2 ? A GLU 300 OE2 69 1 Y 1 B ARG 360 ? CZ ? A ARG 309 CZ 70 1 Y 1 B ARG 360 ? NH1 ? A ARG 309 NH1 71 1 Y 1 B ARG 360 ? NH2 ? A ARG 309 NH2 72 1 Y 1 B GLN 361 ? CG ? A GLN 310 CG 73 1 Y 1 B GLN 361 ? CD ? A GLN 310 CD 74 1 Y 1 B GLN 361 ? OE1 ? A GLN 310 OE1 75 1 Y 1 B GLN 361 ? NE2 ? A GLN 310 NE2 76 1 Y 1 A LEU 77 ? CG ? B LEU 26 CG 77 1 Y 1 A LEU 77 ? CD1 ? B LEU 26 CD1 78 1 Y 1 A LEU 77 ? CD2 ? B LEU 26 CD2 79 1 Y 1 A GLN 78 ? CG ? B GLN 27 CG 80 1 Y 1 A GLN 78 ? CD ? B GLN 27 CD 81 1 Y 1 A GLN 78 ? OE1 ? B GLN 27 OE1 82 1 Y 1 A GLN 78 ? NE2 ? B GLN 27 NE2 83 1 Y 1 A ARG 80 ? CG ? B ARG 29 CG 84 1 Y 1 A ARG 80 ? CD ? B ARG 29 CD 85 1 Y 1 A ARG 80 ? NE ? B ARG 29 NE 86 1 Y 1 A ARG 80 ? CZ ? B ARG 29 CZ 87 1 Y 1 A ARG 80 ? NH1 ? B ARG 29 NH1 88 1 Y 1 A ARG 80 ? NH2 ? B ARG 29 NH2 89 1 Y 1 A ARG 81 ? NE ? B ARG 30 NE 90 1 Y 1 A ARG 81 ? CZ ? B ARG 30 CZ 91 1 Y 1 A ARG 81 ? NH1 ? B ARG 30 NH1 92 1 Y 1 A ARG 81 ? NH2 ? B ARG 30 NH2 93 1 Y 1 A ARG 85 ? CG ? B ARG 34 CG 94 1 Y 1 A ARG 85 ? CD ? B ARG 34 CD 95 1 Y 1 A ARG 85 ? NE ? B ARG 34 NE 96 1 Y 1 A ARG 85 ? CZ ? B ARG 34 CZ 97 1 Y 1 A ARG 85 ? NH1 ? B ARG 34 NH1 98 1 Y 1 A ARG 85 ? NH2 ? B ARG 34 NH2 99 1 Y 1 A SER 100 ? OG ? B SER 49 OG 100 1 Y 1 A ARG 101 ? CG ? B ARG 50 CG 101 1 Y 1 A ARG 101 ? CD ? B ARG 50 CD 102 1 Y 1 A ARG 101 ? NE ? B ARG 50 NE 103 1 Y 1 A ARG 101 ? CZ ? B ARG 50 CZ 104 1 Y 1 A ARG 101 ? NH1 ? B ARG 50 NH1 105 1 Y 1 A ARG 101 ? NH2 ? B ARG 50 NH2 106 1 Y 1 A GLU 103 ? CG ? B GLU 52 CG 107 1 Y 1 A GLU 103 ? CD ? B GLU 52 CD 108 1 Y 1 A GLU 103 ? OE1 ? B GLU 52 OE1 109 1 Y 1 A GLU 103 ? OE2 ? B GLU 52 OE2 110 1 Y 1 A GLN 111 ? CG ? B GLN 60 CG 111 1 Y 1 A GLN 111 ? CD ? B GLN 60 CD 112 1 Y 1 A GLN 111 ? OE1 ? B GLN 60 OE1 113 1 Y 1 A GLN 111 ? NE2 ? B GLN 60 NE2 114 1 Y 1 A LYS 126 ? CD ? B LYS 75 CD 115 1 Y 1 A LYS 126 ? CE ? B LYS 75 CE 116 1 Y 1 A LYS 126 ? NZ ? B LYS 75 NZ 117 1 Y 1 A ARG 128 ? CG ? B ARG 77 CG 118 1 Y 1 A ARG 128 ? CD ? B ARG 77 CD 119 1 Y 1 A ARG 128 ? NE ? B ARG 77 NE 120 1 Y 1 A ARG 128 ? CZ ? B ARG 77 CZ 121 1 Y 1 A ARG 128 ? NH1 ? B ARG 77 NH1 122 1 Y 1 A ARG 128 ? NH2 ? B ARG 77 NH2 123 1 Y 1 A GLU 131 ? CG ? B GLU 80 CG 124 1 Y 1 A GLU 131 ? CD ? B GLU 80 CD 125 1 Y 1 A GLU 131 ? OE1 ? B GLU 80 OE1 126 1 Y 1 A GLU 131 ? OE2 ? B GLU 80 OE2 127 1 Y 1 A ASP 132 ? CG ? B ASP 81 CG 128 1 Y 1 A ASP 132 ? OD1 ? B ASP 81 OD1 129 1 Y 1 A ASP 132 ? OD2 ? B ASP 81 OD2 130 1 Y 1 A ARG 134 ? CD ? B ARG 83 CD 131 1 Y 1 A ARG 134 ? NE ? B ARG 83 NE 132 1 Y 1 A ARG 134 ? CZ ? B ARG 83 CZ 133 1 Y 1 A ARG 134 ? NH1 ? B ARG 83 NH1 134 1 Y 1 A ARG 134 ? NH2 ? B ARG 83 NH2 135 1 Y 1 A ARG 146 ? CG ? B ARG 95 CG 136 1 Y 1 A ARG 146 ? CD ? B ARG 95 CD 137 1 Y 1 A ARG 146 ? NE ? B ARG 95 NE 138 1 Y 1 A ARG 146 ? CZ ? B ARG 95 CZ 139 1 Y 1 A ARG 146 ? NH1 ? B ARG 95 NH1 140 1 Y 1 A ARG 146 ? NH2 ? B ARG 95 NH2 141 1 Y 1 A LYS 149 ? CD ? B LYS 98 CD 142 1 Y 1 A LYS 149 ? CE ? B LYS 98 CE 143 1 Y 1 A LYS 149 ? NZ ? B LYS 98 NZ 144 1 Y 1 A LYS 154 ? NZ ? B LYS 103 NZ 145 1 Y 1 A GLU 179 ? CG ? B GLU 128 CG 146 1 Y 1 A GLU 179 ? CD ? B GLU 128 CD 147 1 Y 1 A GLU 179 ? OE1 ? B GLU 128 OE1 148 1 Y 1 A GLU 179 ? OE2 ? B GLU 128 OE2 149 1 Y 1 A GLU 257 ? CD ? B GLU 206 CD 150 1 Y 1 A GLU 257 ? OE1 ? B GLU 206 OE1 151 1 Y 1 A GLU 257 ? OE2 ? B GLU 206 OE2 152 1 Y 1 A GLU 304 ? CG ? B GLU 253 CG 153 1 Y 1 A GLU 304 ? CD ? B GLU 253 CD 154 1 Y 1 A GLU 304 ? OE1 ? B GLU 253 OE1 155 1 Y 1 A GLU 304 ? OE2 ? B GLU 253 OE2 156 1 Y 1 A GLU 310 ? CG ? B GLU 259 CG 157 1 Y 1 A GLU 310 ? CD ? B GLU 259 CD 158 1 Y 1 A GLU 310 ? OE1 ? B GLU 259 OE1 159 1 Y 1 A GLU 310 ? OE2 ? B GLU 259 OE2 160 1 Y 1 A TYR 319 ? CD1 ? B TYR 268 CD1 161 1 Y 1 A TYR 319 ? CD2 ? B TYR 268 CD2 162 1 Y 1 A TYR 319 ? CE1 ? B TYR 268 CE1 163 1 Y 1 A TYR 319 ? CE2 ? B TYR 268 CE2 164 1 Y 1 A TYR 319 ? CZ ? B TYR 268 CZ 165 1 Y 1 A TYR 319 ? OH ? B TYR 268 OH 166 1 Y 1 A GLN 361 ? CG ? B GLN 310 CG 167 1 Y 1 A GLN 361 ? CD ? B GLN 310 CD 168 1 Y 1 A GLN 361 ? OE1 ? B GLN 310 OE1 169 1 Y 1 A GLN 361 ? NE2 ? B GLN 310 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B MET 52 ? A MET 1 2 1 Y 1 B HIS 53 ? A HIS 2 3 1 Y 1 B HIS 54 ? A HIS 3 4 1 Y 1 B HIS 55 ? A HIS 4 5 1 Y 1 B HIS 56 ? A HIS 5 6 1 Y 1 B HIS 57 ? A HIS 6 7 1 Y 1 B HIS 58 ? A HIS 7 8 1 Y 1 B SER 59 ? A SER 8 9 1 Y 1 B SER 60 ? A SER 9 10 1 Y 1 B GLY 61 ? A GLY 10 11 1 Y 1 B VAL 62 ? A VAL 11 12 1 Y 1 B ASP 63 ? A ASP 12 13 1 Y 1 B LEU 64 ? A LEU 13 14 1 Y 1 B GLY 65 ? A GLY 14 15 1 Y 1 B THR 66 ? A THR 15 16 1 Y 1 B GLU 67 ? A GLU 16 17 1 Y 1 B ASN 68 ? A ASN 17 18 1 Y 1 B LEU 69 ? A LEU 18 19 1 Y 1 B TYR 70 ? A TYR 19 20 1 Y 1 B PHE 71 ? A PHE 20 21 1 Y 1 B GLN 72 ? A GLN 21 22 1 Y 1 B SER 73 ? A SER 22 23 1 Y 1 B MET 74 ? A MET 23 24 1 Y 1 B HIS 75 ? A HIS 24 25 1 Y 1 B GLN 76 ? A GLN 25 26 1 Y 1 B THR 91 ? A THR 40 27 1 Y 1 B LEU 92 ? A LEU 41 28 1 Y 1 B GLN 93 ? A GLN 42 29 1 Y 1 B SER 94 ? A SER 43 30 1 Y 1 B PRO 362 ? A PRO 311 31 1 Y 1 A MET 52 ? B MET 1 32 1 Y 1 A HIS 53 ? B HIS 2 33 1 Y 1 A HIS 54 ? B HIS 3 34 1 Y 1 A HIS 55 ? B HIS 4 35 1 Y 1 A HIS 56 ? B HIS 5 36 1 Y 1 A HIS 57 ? B HIS 6 37 1 Y 1 A HIS 58 ? B HIS 7 38 1 Y 1 A SER 59 ? B SER 8 39 1 Y 1 A SER 60 ? B SER 9 40 1 Y 1 A GLY 61 ? B GLY 10 41 1 Y 1 A VAL 62 ? B VAL 11 42 1 Y 1 A ASP 63 ? B ASP 12 43 1 Y 1 A LEU 64 ? B LEU 13 44 1 Y 1 A GLY 65 ? B GLY 14 45 1 Y 1 A THR 66 ? B THR 15 46 1 Y 1 A GLU 67 ? B GLU 16 47 1 Y 1 A ASN 68 ? B ASN 17 48 1 Y 1 A LEU 69 ? B LEU 18 49 1 Y 1 A TYR 70 ? B TYR 19 50 1 Y 1 A PHE 71 ? B PHE 20 51 1 Y 1 A GLN 72 ? B GLN 21 52 1 Y 1 A SER 73 ? B SER 22 53 1 Y 1 A MET 74 ? B MET 23 54 1 Y 1 A HIS 75 ? B HIS 24 55 1 Y 1 A GLN 76 ? B GLN 25 56 1 Y 1 A THR 91 ? B THR 40 57 1 Y 1 A LEU 92 ? B LEU 41 58 1 Y 1 A GLN 93 ? B GLN 42 59 1 Y 1 A SER 94 ? B SER 43 60 1 Y 1 A GLY 262 ? B GLY 211 61 1 Y 1 A ALA 263 ? B ALA 212 62 1 Y 1 A GLY 264 ? B GLY 213 63 1 Y 1 A PRO 362 ? B PRO 311 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 GOL C1 C N N 147 GOL O1 O N N 148 GOL C2 C N N 149 GOL O2 O N N 150 GOL C3 C N N 151 GOL O3 O N N 152 GOL H11 H N N 153 GOL H12 H N N 154 GOL HO1 H N N 155 GOL H2 H N N 156 GOL HO2 H N N 157 GOL H31 H N N 158 GOL H32 H N N 159 GOL HO3 H N N 160 HIS N N N N 161 HIS CA C N S 162 HIS C C N N 163 HIS O O N N 164 HIS CB C N N 165 HIS CG C Y N 166 HIS ND1 N Y N 167 HIS CD2 C Y N 168 HIS CE1 C Y N 169 HIS NE2 N Y N 170 HIS OXT O N N 171 HIS H H N N 172 HIS H2 H N N 173 HIS HA H N N 174 HIS HB2 H N N 175 HIS HB3 H N N 176 HIS HD1 H N N 177 HIS HD2 H N N 178 HIS HE1 H N N 179 HIS HE2 H N N 180 HIS HXT H N N 181 HOH O O N N 182 HOH H1 H N N 183 HOH H2 H N N 184 ILE N N N N 185 ILE CA C N S 186 ILE C C N N 187 ILE O O N N 188 ILE CB C N S 189 ILE CG1 C N N 190 ILE CG2 C N N 191 ILE CD1 C N N 192 ILE OXT O N N 193 ILE H H N N 194 ILE H2 H N N 195 ILE HA H N N 196 ILE HB H N N 197 ILE HG12 H N N 198 ILE HG13 H N N 199 ILE HG21 H N N 200 ILE HG22 H N N 201 ILE HG23 H N N 202 ILE HD11 H N N 203 ILE HD12 H N N 204 ILE HD13 H N N 205 ILE HXT H N N 206 LEU N N N N 207 LEU CA C N S 208 LEU C C N N 209 LEU O O N N 210 LEU CB C N N 211 LEU CG C N N 212 LEU CD1 C N N 213 LEU CD2 C N N 214 LEU OXT O N N 215 LEU H H N N 216 LEU H2 H N N 217 LEU HA H N N 218 LEU HB2 H N N 219 LEU HB3 H N N 220 LEU HG H N N 221 LEU HD11 H N N 222 LEU HD12 H N N 223 LEU HD13 H N N 224 LEU HD21 H N N 225 LEU HD22 H N N 226 LEU HD23 H N N 227 LEU HXT H N N 228 LYS N N N N 229 LYS CA C N S 230 LYS C C N N 231 LYS O O N N 232 LYS CB C N N 233 LYS CG C N N 234 LYS CD C N N 235 LYS CE C N N 236 LYS NZ N N N 237 LYS OXT O N N 238 LYS H H N N 239 LYS H2 H N N 240 LYS HA H N N 241 LYS HB2 H N N 242 LYS HB3 H N N 243 LYS HG2 H N N 244 LYS HG3 H N N 245 LYS HD2 H N N 246 LYS HD3 H N N 247 LYS HE2 H N N 248 LYS HE3 H N N 249 LYS HZ1 H N N 250 LYS HZ2 H N N 251 LYS HZ3 H N N 252 LYS HXT H N N 253 MET N N N N 254 MET CA C N S 255 MET C C N N 256 MET O O N N 257 MET CB C N N 258 MET CG C N N 259 MET SD S N N 260 MET CE C N N 261 MET OXT O N N 262 MET H H N N 263 MET H2 H N N 264 MET HA H N N 265 MET HB2 H N N 266 MET HB3 H N N 267 MET HG2 H N N 268 MET HG3 H N N 269 MET HE1 H N N 270 MET HE2 H N N 271 MET HE3 H N N 272 MET HXT H N N 273 PHE N N N N 274 PHE CA C N S 275 PHE C C N N 276 PHE O O N N 277 PHE CB C N N 278 PHE CG C Y N 279 PHE CD1 C Y N 280 PHE CD2 C Y N 281 PHE CE1 C Y N 282 PHE CE2 C Y N 283 PHE CZ C Y N 284 PHE OXT O N N 285 PHE H H N N 286 PHE H2 H N N 287 PHE HA H N N 288 PHE HB2 H N N 289 PHE HB3 H N N 290 PHE HD1 H N N 291 PHE HD2 H N N 292 PHE HE1 H N N 293 PHE HE2 H N N 294 PHE HZ H N N 295 PHE HXT H N N 296 PRO N N N N 297 PRO CA C N S 298 PRO C C N N 299 PRO O O N N 300 PRO CB C N N 301 PRO CG C N N 302 PRO CD C N N 303 PRO OXT O N N 304 PRO H H N N 305 PRO HA H N N 306 PRO HB2 H N N 307 PRO HB3 H N N 308 PRO HG2 H N N 309 PRO HG3 H N N 310 PRO HD2 H N N 311 PRO HD3 H N N 312 PRO HXT H N N 313 QGI C10 C Y N 314 QGI C12 C Y N 315 QGI C13 C N N 316 QGI C01 C N N 317 QGI C02 C Y N 318 QGI C03 C Y N 319 QGI C04 C Y N 320 QGI C05 C Y N 321 QGI C07 C Y N 322 QGI C08 C N N 323 QGI C16 C Y N 324 QGI C17 C Y N 325 QGI C18 C N N 326 QGI C19 C Y N 327 QGI C21 C Y N 328 QGI C22 C Y N 329 QGI C23 C Y N 330 QGI C24 C N N 331 QGI N06 N Y N 332 QGI N09 N Y N 333 QGI N11 N N N 334 QGI N14 N N N 335 QGI O15 O N N 336 QGI O20 O N N 337 QGI H1 H N N 338 QGI H2 H N N 339 QGI H3 H N N 340 QGI H4 H N N 341 QGI H5 H N N 342 QGI H6 H N N 343 QGI H7 H N N 344 QGI H8 H N N 345 QGI H9 H N N 346 QGI H10 H N N 347 QGI H11 H N N 348 QGI H12 H N N 349 QGI H13 H N N 350 QGI H14 H N N 351 QGI H15 H N N 352 QGI H16 H N N 353 QGI H17 H N N 354 QGI H18 H N N 355 QGI H19 H N N 356 QGI H20 H N N 357 SER N N N N 358 SER CA C N S 359 SER C C N N 360 SER O O N N 361 SER CB C N N 362 SER OG O N N 363 SER OXT O N N 364 SER H H N N 365 SER H2 H N N 366 SER HA H N N 367 SER HB2 H N N 368 SER HB3 H N N 369 SER HG H N N 370 SER HXT H N N 371 SO4 S S N N 372 SO4 O1 O N N 373 SO4 O2 O N N 374 SO4 O3 O N N 375 SO4 O4 O N N 376 THR N N N N 377 THR CA C N S 378 THR C C N N 379 THR O O N N 380 THR CB C N R 381 THR OG1 O N N 382 THR CG2 C N N 383 THR OXT O N N 384 THR H H N N 385 THR H2 H N N 386 THR HA H N N 387 THR HB H N N 388 THR HG1 H N N 389 THR HG21 H N N 390 THR HG22 H N N 391 THR HG23 H N N 392 THR HXT H N N 393 TRP N N N N 394 TRP CA C N S 395 TRP C C N N 396 TRP O O N N 397 TRP CB C N N 398 TRP CG C Y N 399 TRP CD1 C Y N 400 TRP CD2 C Y N 401 TRP NE1 N Y N 402 TRP CE2 C Y N 403 TRP CE3 C Y N 404 TRP CZ2 C Y N 405 TRP CZ3 C Y N 406 TRP CH2 C Y N 407 TRP OXT O N N 408 TRP H H N N 409 TRP H2 H N N 410 TRP HA H N N 411 TRP HB2 H N N 412 TRP HB3 H N N 413 TRP HD1 H N N 414 TRP HE1 H N N 415 TRP HE3 H N N 416 TRP HZ2 H N N 417 TRP HZ3 H N N 418 TRP HH2 H N N 419 TRP HXT H N N 420 TYR N N N N 421 TYR CA C N S 422 TYR C C N N 423 TYR O O N N 424 TYR CB C N N 425 TYR CG C Y N 426 TYR CD1 C Y N 427 TYR CD2 C Y N 428 TYR CE1 C Y N 429 TYR CE2 C Y N 430 TYR CZ C Y N 431 TYR OH O N N 432 TYR OXT O N N 433 TYR H H N N 434 TYR H2 H N N 435 TYR HA H N N 436 TYR HB2 H N N 437 TYR HB3 H N N 438 TYR HD1 H N N 439 TYR HD2 H N N 440 TYR HE1 H N N 441 TYR HE2 H N N 442 TYR HH H N N 443 TYR HXT H N N 444 VAL N N N N 445 VAL CA C N S 446 VAL C C N N 447 VAL O O N N 448 VAL CB C N N 449 VAL CG1 C N N 450 VAL CG2 C N N 451 VAL OXT O N N 452 VAL H H N N 453 VAL H2 H N N 454 VAL HA H N N 455 VAL HB H N N 456 VAL HG11 H N N 457 VAL HG12 H N N 458 VAL HG13 H N N 459 VAL HG21 H N N 460 VAL HG22 H N N 461 VAL HG23 H N N 462 VAL HXT H N N 463 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 GOL C1 O1 sing N N 138 GOL C1 C2 sing N N 139 GOL C1 H11 sing N N 140 GOL C1 H12 sing N N 141 GOL O1 HO1 sing N N 142 GOL C2 O2 sing N N 143 GOL C2 C3 sing N N 144 GOL C2 H2 sing N N 145 GOL O2 HO2 sing N N 146 GOL C3 O3 sing N N 147 GOL C3 H31 sing N N 148 GOL C3 H32 sing N N 149 GOL O3 HO3 sing N N 150 HIS N CA sing N N 151 HIS N H sing N N 152 HIS N H2 sing N N 153 HIS CA C sing N N 154 HIS CA CB sing N N 155 HIS CA HA sing N N 156 HIS C O doub N N 157 HIS C OXT sing N N 158 HIS CB CG sing N N 159 HIS CB HB2 sing N N 160 HIS CB HB3 sing N N 161 HIS CG ND1 sing Y N 162 HIS CG CD2 doub Y N 163 HIS ND1 CE1 doub Y N 164 HIS ND1 HD1 sing N N 165 HIS CD2 NE2 sing Y N 166 HIS CD2 HD2 sing N N 167 HIS CE1 NE2 sing Y N 168 HIS CE1 HE1 sing N N 169 HIS NE2 HE2 sing N N 170 HIS OXT HXT sing N N 171 HOH O H1 sing N N 172 HOH O H2 sing N N 173 ILE N CA sing N N 174 ILE N H sing N N 175 ILE N H2 sing N N 176 ILE CA C sing N N 177 ILE CA CB sing N N 178 ILE CA HA sing N N 179 ILE C O doub N N 180 ILE C OXT sing N N 181 ILE CB CG1 sing N N 182 ILE CB CG2 sing N N 183 ILE CB HB sing N N 184 ILE CG1 CD1 sing N N 185 ILE CG1 HG12 sing N N 186 ILE CG1 HG13 sing N N 187 ILE CG2 HG21 sing N N 188 ILE CG2 HG22 sing N N 189 ILE CG2 HG23 sing N N 190 ILE CD1 HD11 sing N N 191 ILE CD1 HD12 sing N N 192 ILE CD1 HD13 sing N N 193 ILE OXT HXT sing N N 194 LEU N CA sing N N 195 LEU N H sing N N 196 LEU N H2 sing N N 197 LEU CA C sing N N 198 LEU CA CB sing N N 199 LEU CA HA sing N N 200 LEU C O doub N N 201 LEU C OXT sing N N 202 LEU CB CG sing N N 203 LEU CB HB2 sing N N 204 LEU CB HB3 sing N N 205 LEU CG CD1 sing N N 206 LEU CG CD2 sing N N 207 LEU CG HG sing N N 208 LEU CD1 HD11 sing N N 209 LEU CD1 HD12 sing N N 210 LEU CD1 HD13 sing N N 211 LEU CD2 HD21 sing N N 212 LEU CD2 HD22 sing N N 213 LEU CD2 HD23 sing N N 214 LEU OXT HXT sing N N 215 LYS N CA sing N N 216 LYS N H sing N N 217 LYS N H2 sing N N 218 LYS CA C sing N N 219 LYS CA CB sing N N 220 LYS CA HA sing N N 221 LYS C O doub N N 222 LYS C OXT sing N N 223 LYS CB CG sing N N 224 LYS CB HB2 sing N N 225 LYS CB HB3 sing N N 226 LYS CG CD sing N N 227 LYS CG HG2 sing N N 228 LYS CG HG3 sing N N 229 LYS CD CE sing N N 230 LYS CD HD2 sing N N 231 LYS CD HD3 sing N N 232 LYS CE NZ sing N N 233 LYS CE HE2 sing N N 234 LYS CE HE3 sing N N 235 LYS NZ HZ1 sing N N 236 LYS NZ HZ2 sing N N 237 LYS NZ HZ3 sing N N 238 LYS OXT HXT sing N N 239 MET N CA sing N N 240 MET N H sing N N 241 MET N H2 sing N N 242 MET CA C sing N N 243 MET CA CB sing N N 244 MET CA HA sing N N 245 MET C O doub N N 246 MET C OXT sing N N 247 MET CB CG sing N N 248 MET CB HB2 sing N N 249 MET CB HB3 sing N N 250 MET CG SD sing N N 251 MET CG HG2 sing N N 252 MET CG HG3 sing N N 253 MET SD CE sing N N 254 MET CE HE1 sing N N 255 MET CE HE2 sing N N 256 MET CE HE3 sing N N 257 MET OXT HXT sing N N 258 PHE N CA sing N N 259 PHE N H sing N N 260 PHE N H2 sing N N 261 PHE CA C sing N N 262 PHE CA CB sing N N 263 PHE CA HA sing N N 264 PHE C O doub N N 265 PHE C OXT sing N N 266 PHE CB CG sing N N 267 PHE CB HB2 sing N N 268 PHE CB HB3 sing N N 269 PHE CG CD1 doub Y N 270 PHE CG CD2 sing Y N 271 PHE CD1 CE1 sing Y N 272 PHE CD1 HD1 sing N N 273 PHE CD2 CE2 doub Y N 274 PHE CD2 HD2 sing N N 275 PHE CE1 CZ doub Y N 276 PHE CE1 HE1 sing N N 277 PHE CE2 CZ sing Y N 278 PHE CE2 HE2 sing N N 279 PHE CZ HZ sing N N 280 PHE OXT HXT sing N N 281 PRO N CA sing N N 282 PRO N CD sing N N 283 PRO N H sing N N 284 PRO CA C sing N N 285 PRO CA CB sing N N 286 PRO CA HA sing N N 287 PRO C O doub N N 288 PRO C OXT sing N N 289 PRO CB CG sing N N 290 PRO CB HB2 sing N N 291 PRO CB HB3 sing N N 292 PRO CG CD sing N N 293 PRO CG HG2 sing N N 294 PRO CG HG3 sing N N 295 PRO CD HD2 sing N N 296 PRO CD HD3 sing N N 297 PRO OXT HXT sing N N 298 QGI C08 C07 sing N N 299 QGI C24 C23 sing N N 300 QGI C22 C23 doub Y N 301 QGI C22 C21 sing Y N 302 QGI C07 N06 doub Y N 303 QGI C07 C02 sing Y N 304 QGI C01 C02 sing N N 305 QGI C23 C16 sing Y N 306 QGI N06 C05 sing Y N 307 QGI C02 C03 doub Y N 308 QGI C21 C19 doub Y N 309 QGI C05 N09 sing Y N 310 QGI C05 C04 doub Y N 311 QGI C03 C04 sing Y N 312 QGI C16 N09 sing N N 313 QGI C16 C17 doub Y N 314 QGI N09 C10 sing Y N 315 QGI C04 C12 sing Y N 316 QGI C19 C17 sing Y N 317 QGI C19 O20 sing N N 318 QGI C17 C18 sing N N 319 QGI C10 C12 doub Y N 320 QGI C10 N11 sing N N 321 QGI C12 C13 sing N N 322 QGI C13 N14 sing N N 323 QGI C13 O15 doub N N 324 QGI C01 H1 sing N N 325 QGI C01 H2 sing N N 326 QGI C01 H3 sing N N 327 QGI C03 H4 sing N N 328 QGI C08 H5 sing N N 329 QGI C08 H6 sing N N 330 QGI C08 H7 sing N N 331 QGI C18 H8 sing N N 332 QGI C18 H9 sing N N 333 QGI C18 H10 sing N N 334 QGI C21 H11 sing N N 335 QGI C22 H12 sing N N 336 QGI C24 H13 sing N N 337 QGI C24 H14 sing N N 338 QGI C24 H15 sing N N 339 QGI N11 H16 sing N N 340 QGI N11 H17 sing N N 341 QGI N14 H18 sing N N 342 QGI N14 H19 sing N N 343 QGI O20 H20 sing N N 344 SER N CA sing N N 345 SER N H sing N N 346 SER N H2 sing N N 347 SER CA C sing N N 348 SER CA CB sing N N 349 SER CA HA sing N N 350 SER C O doub N N 351 SER C OXT sing N N 352 SER CB OG sing N N 353 SER CB HB2 sing N N 354 SER CB HB3 sing N N 355 SER OG HG sing N N 356 SER OXT HXT sing N N 357 SO4 S O1 doub N N 358 SO4 S O2 doub N N 359 SO4 S O3 sing N N 360 SO4 S O4 sing N N 361 THR N CA sing N N 362 THR N H sing N N 363 THR N H2 sing N N 364 THR CA C sing N N 365 THR CA CB sing N N 366 THR CA HA sing N N 367 THR C O doub N N 368 THR C OXT sing N N 369 THR CB OG1 sing N N 370 THR CB CG2 sing N N 371 THR CB HB sing N N 372 THR OG1 HG1 sing N N 373 THR CG2 HG21 sing N N 374 THR CG2 HG22 sing N N 375 THR CG2 HG23 sing N N 376 THR OXT HXT sing N N 377 TRP N CA sing N N 378 TRP N H sing N N 379 TRP N H2 sing N N 380 TRP CA C sing N N 381 TRP CA CB sing N N 382 TRP CA HA sing N N 383 TRP C O doub N N 384 TRP C OXT sing N N 385 TRP CB CG sing N N 386 TRP CB HB2 sing N N 387 TRP CB HB3 sing N N 388 TRP CG CD1 doub Y N 389 TRP CG CD2 sing Y N 390 TRP CD1 NE1 sing Y N 391 TRP CD1 HD1 sing N N 392 TRP CD2 CE2 doub Y N 393 TRP CD2 CE3 sing Y N 394 TRP NE1 CE2 sing Y N 395 TRP NE1 HE1 sing N N 396 TRP CE2 CZ2 sing Y N 397 TRP CE3 CZ3 doub Y N 398 TRP CE3 HE3 sing N N 399 TRP CZ2 CH2 doub Y N 400 TRP CZ2 HZ2 sing N N 401 TRP CZ3 CH2 sing Y N 402 TRP CZ3 HZ3 sing N N 403 TRP CH2 HH2 sing N N 404 TRP OXT HXT sing N N 405 TYR N CA sing N N 406 TYR N H sing N N 407 TYR N H2 sing N N 408 TYR CA C sing N N 409 TYR CA CB sing N N 410 TYR CA HA sing N N 411 TYR C O doub N N 412 TYR C OXT sing N N 413 TYR CB CG sing N N 414 TYR CB HB2 sing N N 415 TYR CB HB3 sing N N 416 TYR CG CD1 doub Y N 417 TYR CG CD2 sing Y N 418 TYR CD1 CE1 sing Y N 419 TYR CD1 HD1 sing N N 420 TYR CD2 CE2 doub Y N 421 TYR CD2 HD2 sing N N 422 TYR CE1 CZ doub Y N 423 TYR CE1 HE1 sing N N 424 TYR CE2 CZ sing Y N 425 TYR CE2 HE2 sing N N 426 TYR CZ OH sing N N 427 TYR OH HH sing N N 428 TYR OXT HXT sing N N 429 VAL N CA sing N N 430 VAL N H sing N N 431 VAL N H2 sing N N 432 VAL CA C sing N N 433 VAL CA CB sing N N 434 VAL CA HA sing N N 435 VAL C O doub N N 436 VAL C OXT sing N N 437 VAL CB CG1 sing N N 438 VAL CB CG2 sing N N 439 VAL CB HB sing N N 440 VAL CG1 HG11 sing N N 441 VAL CG1 HG12 sing N N 442 VAL CG1 HG13 sing N N 443 VAL CG2 HG21 sing N N 444 VAL CG2 HG22 sing N N 445 VAL CG2 HG23 sing N N 446 VAL OXT HXT sing N N 447 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ontario Research Fund' Canada RE08-065 1 'Other private' ? ? 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id QGI _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id QGI _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 '(1P)-2-amino-1-(3-hydroxy-2,6-dimethylphenyl)-5,6-dimethyl-1H-pyrrolo[2,3-b]pyridine-3-carboxamide' QGI 4 GLYCEROL GOL 5 1,2-ETHANEDIOL EDO 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3P1A _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #