data_8DSW # _entry.id 8DSW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8DSW pdb_00008dsw 10.2210/pdb8dsw/pdb WWPDB D_1000267290 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8DSW _pdbx_database_status.recvd_initial_deposition_date 2022-07-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Park, E.' 1 ? 'Eck, M.J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural basis for oncogenic activation of the epidermal growth factor receptor by the InsFQEA exon 20 insertion' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Park, E.' 1 ? primary 'Eck, M.J.' 2 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8DSW _cell.details ? _cell.formula_units_Z ? _cell.length_a 148.555 _cell.length_a_esd ? _cell.length_b 148.555 _cell.length_b_esd ? _cell.length_c 148.555 _cell.length_c_esd ? _cell.volume 3278399.094 _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8DSW _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall 'I 2 2 3' _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epidermal growth factor receptor' 38111.922 1 2.7.10.1 ? ? ? 2 non-polymer syn 'TETRAETHYLENE GLYCOL' 194.226 2 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196 1 ? ? ? ? 5 water nat water 18.015 23 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proto-oncogene c-ErbB-1,Receptor tyrosine-protein kinase erbB-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSTSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAFQEAYVMA SVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKT PQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSIL EKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDM DDVVDADEYLIPQQG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSTSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAFQEAYVMA SVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKT PQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSIL EKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDM DDVVDADEYLIPQQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 THR n 1 4 SER n 1 5 GLY n 1 6 GLU n 1 7 ALA n 1 8 PRO n 1 9 ASN n 1 10 GLN n 1 11 ALA n 1 12 LEU n 1 13 LEU n 1 14 ARG n 1 15 ILE n 1 16 LEU n 1 17 LYS n 1 18 GLU n 1 19 THR n 1 20 GLU n 1 21 PHE n 1 22 LYS n 1 23 LYS n 1 24 ILE n 1 25 LYS n 1 26 VAL n 1 27 LEU n 1 28 GLY n 1 29 SER n 1 30 GLY n 1 31 ALA n 1 32 PHE n 1 33 GLY n 1 34 THR n 1 35 VAL n 1 36 TYR n 1 37 LYS n 1 38 GLY n 1 39 LEU n 1 40 TRP n 1 41 ILE n 1 42 PRO n 1 43 GLU n 1 44 GLY n 1 45 GLU n 1 46 LYS n 1 47 VAL n 1 48 LYS n 1 49 ILE n 1 50 PRO n 1 51 VAL n 1 52 ALA n 1 53 ILE n 1 54 LYS n 1 55 GLU n 1 56 LEU n 1 57 ARG n 1 58 GLU n 1 59 ALA n 1 60 THR n 1 61 SER n 1 62 PRO n 1 63 LYS n 1 64 ALA n 1 65 ASN n 1 66 LYS n 1 67 GLU n 1 68 ILE n 1 69 LEU n 1 70 ASP n 1 71 GLU n 1 72 ALA n 1 73 PHE n 1 74 GLN n 1 75 GLU n 1 76 ALA n 1 77 TYR n 1 78 VAL n 1 79 MET n 1 80 ALA n 1 81 SER n 1 82 VAL n 1 83 ASP n 1 84 ASN n 1 85 PRO n 1 86 HIS n 1 87 VAL n 1 88 CYS n 1 89 ARG n 1 90 LEU n 1 91 LEU n 1 92 GLY n 1 93 ILE n 1 94 CYS n 1 95 LEU n 1 96 THR n 1 97 SER n 1 98 THR n 1 99 VAL n 1 100 GLN n 1 101 LEU n 1 102 ILE n 1 103 THR n 1 104 GLN n 1 105 LEU n 1 106 MET n 1 107 PRO n 1 108 PHE n 1 109 GLY n 1 110 CYS n 1 111 LEU n 1 112 LEU n 1 113 ASP n 1 114 TYR n 1 115 VAL n 1 116 ARG n 1 117 GLU n 1 118 HIS n 1 119 LYS n 1 120 ASP n 1 121 ASN n 1 122 ILE n 1 123 GLY n 1 124 SER n 1 125 GLN n 1 126 TYR n 1 127 LEU n 1 128 LEU n 1 129 ASN n 1 130 TRP n 1 131 CYS n 1 132 VAL n 1 133 GLN n 1 134 ILE n 1 135 ALA n 1 136 LYS n 1 137 GLY n 1 138 MET n 1 139 ASN n 1 140 TYR n 1 141 LEU n 1 142 GLU n 1 143 ASP n 1 144 ARG n 1 145 ARG n 1 146 LEU n 1 147 VAL n 1 148 HIS n 1 149 ARG n 1 150 ASP n 1 151 LEU n 1 152 ALA n 1 153 ALA n 1 154 ARG n 1 155 ASN n 1 156 VAL n 1 157 LEU n 1 158 VAL n 1 159 LYS n 1 160 THR n 1 161 PRO n 1 162 GLN n 1 163 HIS n 1 164 VAL n 1 165 LYS n 1 166 ILE n 1 167 THR n 1 168 ASP n 1 169 PHE n 1 170 GLY n 1 171 LEU n 1 172 ALA n 1 173 LYS n 1 174 LEU n 1 175 LEU n 1 176 GLY n 1 177 ALA n 1 178 GLU n 1 179 GLU n 1 180 LYS n 1 181 GLU n 1 182 TYR n 1 183 HIS n 1 184 ALA n 1 185 GLU n 1 186 GLY n 1 187 GLY n 1 188 LYS n 1 189 VAL n 1 190 PRO n 1 191 ILE n 1 192 LYS n 1 193 TRP n 1 194 MET n 1 195 ALA n 1 196 LEU n 1 197 GLU n 1 198 SER n 1 199 ILE n 1 200 LEU n 1 201 HIS n 1 202 ARG n 1 203 ILE n 1 204 TYR n 1 205 THR n 1 206 HIS n 1 207 GLN n 1 208 SER n 1 209 ASP n 1 210 VAL n 1 211 TRP n 1 212 SER n 1 213 TYR n 1 214 GLY n 1 215 VAL n 1 216 THR n 1 217 VAL n 1 218 TRP n 1 219 GLU n 1 220 LEU n 1 221 MET n 1 222 THR n 1 223 PHE n 1 224 GLY n 1 225 SER n 1 226 LYS n 1 227 PRO n 1 228 TYR n 1 229 ASP n 1 230 GLY n 1 231 ILE n 1 232 PRO n 1 233 ALA n 1 234 SER n 1 235 GLU n 1 236 ILE n 1 237 SER n 1 238 SER n 1 239 ILE n 1 240 LEU n 1 241 GLU n 1 242 LYS n 1 243 GLY n 1 244 GLU n 1 245 ARG n 1 246 LEU n 1 247 PRO n 1 248 GLN n 1 249 PRO n 1 250 PRO n 1 251 ILE n 1 252 CYS n 1 253 THR n 1 254 ILE n 1 255 ASP n 1 256 VAL n 1 257 TYR n 1 258 MET n 1 259 ILE n 1 260 MET n 1 261 VAL n 1 262 LYS n 1 263 CYS n 1 264 TRP n 1 265 MET n 1 266 ILE n 1 267 ASP n 1 268 ALA n 1 269 ASP n 1 270 SER n 1 271 ARG n 1 272 PRO n 1 273 LYS n 1 274 PHE n 1 275 ARG n 1 276 GLU n 1 277 LEU n 1 278 ILE n 1 279 ILE n 1 280 GLU n 1 281 PHE n 1 282 SER n 1 283 LYS n 1 284 MET n 1 285 ALA n 1 286 ARG n 1 287 ASP n 1 288 PRO n 1 289 GLN n 1 290 ARG n 1 291 TYR n 1 292 LEU n 1 293 VAL n 1 294 ILE n 1 295 GLN n 1 296 GLY n 1 297 ASP n 1 298 GLU n 1 299 ARG n 1 300 MET n 1 301 HIS n 1 302 LEU n 1 303 PRO n 1 304 SER n 1 305 PRO n 1 306 THR n 1 307 ASP n 1 308 SER n 1 309 ASN n 1 310 PHE n 1 311 TYR n 1 312 ARG n 1 313 ALA n 1 314 LEU n 1 315 MET n 1 316 ASP n 1 317 GLU n 1 318 GLU n 1 319 ASP n 1 320 MET n 1 321 ASP n 1 322 ASP n 1 323 VAL n 1 324 VAL n 1 325 ASP n 1 326 ALA n 1 327 ASP n 1 328 GLU n 1 329 TYR n 1 330 LEU n 1 331 ILE n 1 332 PRO n 1 333 GLN n 1 334 GLN n 1 335 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 335 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EGFR, ERBB, ERBB1, HER1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EGFR_HUMAN _struct_ref.pdbx_db_accession P00533 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVC RLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITD FGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADE YLIPQQG ; _struct_ref.pdbx_align_begin 696 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8DSW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 335 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00533 _struct_ref_seq.db_align_beg 696 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1022 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 696 _struct_ref_seq.pdbx_auth_seq_align_end 1026 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8DSW GLY A 1 ? UNP P00533 ? ? 'expression tag' 692 1 1 8DSW SER A 2 ? UNP P00533 ? ? 'expression tag' 693 2 1 8DSW THR A 3 ? UNP P00533 ? ? 'expression tag' 694 3 1 8DSW SER A 4 ? UNP P00533 ? ? 'expression tag' 695 4 1 8DSW PHE A 73 ? UNP P00533 ? ? insertion 764 5 1 8DSW GLN A 74 ? UNP P00533 ? ? insertion 765 6 1 8DSW GLU A 75 ? UNP P00533 ? ? insertion 766 7 1 8DSW ALA A 76 ? UNP P00533 ? ? insertion 767 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ANP non-polymer . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PG4 non-polymer . 'TETRAETHYLENE GLYCOL' ? 'C8 H18 O5' 194.226 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8DSW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.62 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2M potassium fluoride 20 % PEG 3350 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-04-11 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.987 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.987 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 53.75 _reflns.entry_id 8DSW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.39 _reflns.d_resolution_low 46.98 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20688 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.99 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.39 _reflns_shell.d_res_low 2.45 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1966 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.635 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.245 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 62.45 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8DSW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.39 _refine.ls_d_res_low 46.98 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20575 _refine.ls_number_reflns_R_free 2011 _refine.ls_number_reflns_R_work 18564 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.00 _refine.ls_percent_reflns_R_free 9.77 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1973 _refine.ls_R_factor_R_free 0.2463 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1920 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2ITX _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.8293 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2824 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.39 _refine_hist.d_res_low 46.98 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 2544 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2462 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 58 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0083 ? 2567 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9927 ? 3467 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0548 ? 390 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0072 ? 429 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.1747 ? 354 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.39 2.45 . . 136 1246 90.86 . . . . 0.2824 . . . . . . . . . . . 0.3359 'X-RAY DIFFRACTION' 2.45 2.52 . . 138 1322 94.87 . . . . 0.2454 . . . . . . . . . . . 0.2955 'X-RAY DIFFRACTION' 2.52 2.59 . . 145 1360 97.03 . . . . 0.2482 . . . . . . . . . . . 0.3183 'X-RAY DIFFRACTION' 2.59 2.68 . . 150 1342 97.96 . . . . 0.2386 . . . . . . . . . . . 0.3130 'X-RAY DIFFRACTION' 2.68 2.77 . . 140 1264 93.04 . . . . 0.2409 . . . . . . . . . . . 0.2846 'X-RAY DIFFRACTION' 2.77 2.88 . . 131 1221 88.31 . . . . 0.2432 . . . . . . . . . . . 0.2912 'X-RAY DIFFRACTION' 2.88 3.01 . . 152 1385 99.10 . . . . 0.2000 . . . . . . . . . . . 0.2612 'X-RAY DIFFRACTION' 3.02 3.17 . . 148 1375 99.02 . . . . 0.2204 . . . . . . . . . . . 0.2774 'X-RAY DIFFRACTION' 3.17 3.37 . . 147 1389 99.29 . . . . 0.1975 . . . . . . . . . . . 0.2471 'X-RAY DIFFRACTION' 3.37 3.63 . . 141 1315 94.00 . . . . 0.1938 . . . . . . . . . . . 0.2426 'X-RAY DIFFRACTION' 3.63 4.00 . . 140 1308 93.54 . . . . 0.1733 . . . . . . . . . . . 0.2159 'X-RAY DIFFRACTION' 4.00 4.58 . . 158 1381 99.16 . . . . 0.1607 . . . . . . . . . . . 0.2205 'X-RAY DIFFRACTION' 4.58 5.76 . . 138 1288 91.29 . . . . 0.1701 . . . . . . . . . . . 0.2567 'X-RAY DIFFRACTION' 5.77 46.98 . . 147 1368 92.94 . . . . 0.1830 . . . . . . . . . . . 0.2138 # _struct.entry_id 8DSW _struct.title 'Crystal structure of EGFR kinase domain, Exon20 Insertion FQEA mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8DSW _struct_keywords.text 'EGFR Kinase domain, Exon 20 insertion mutant., ONCOPROTEIN' _struct_keywords.pdbx_keywords ONCOPROTEIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 17 ? THR A 19 ? LYS A 708 THR A 710 5 ? 3 HELX_P HELX_P2 AA2 SER A 61 ? VAL A 82 ? SER A 752 VAL A 773 1 ? 22 HELX_P HELX_P3 AA3 CYS A 110 ? HIS A 118 ? CYS A 801 HIS A 809 1 ? 9 HELX_P HELX_P4 AA4 LYS A 119 ? ILE A 122 ? LYS A 810 ILE A 813 5 ? 4 HELX_P HELX_P5 AA5 GLY A 123 ? ARG A 144 ? GLY A 814 ARG A 835 1 ? 22 HELX_P HELX_P6 AA6 ALA A 152 ? ARG A 154 ? ALA A 843 ARG A 845 5 ? 3 HELX_P HELX_P7 AA7 PRO A 190 ? MET A 194 ? PRO A 881 MET A 885 5 ? 5 HELX_P HELX_P8 AA8 ALA A 195 ? ARG A 202 ? ALA A 886 ARG A 893 1 ? 8 HELX_P HELX_P9 AA9 THR A 205 ? THR A 222 ? THR A 896 THR A 913 1 ? 18 HELX_P HELX_P10 AB1 PRO A 232 ? LYS A 242 ? PRO A 923 LYS A 933 1 ? 11 HELX_P HELX_P11 AB2 THR A 253 ? CYS A 263 ? THR A 944 CYS A 954 1 ? 11 HELX_P HELX_P12 AB3 ASP A 267 ? ARG A 271 ? ASP A 958 ARG A 962 5 ? 5 HELX_P HELX_P13 AB4 LYS A 273 ? ARG A 286 ? LYS A 964 ARG A 977 1 ? 14 HELX_P HELX_P14 AB5 ASP A 287 ? TYR A 291 ? ASP A 978 TYR A 982 5 ? 5 HELX_P HELX_P15 AB6 GLY A 296 ? MET A 300 ? GLY A 987 MET A 991 5 ? 5 HELX_P HELX_P16 AB7 ASP A 325 ? LEU A 330 ? ASP A 1016 LEU A 1021 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 71 OE2 ? ? ? 1_555 D MG . MG ? ? A GLU 762 A MG 1103 1_555 ? ? ? ? ? ? ? 1.806 ? ? metalc2 metalc ? ? A ASP 168 OD1 ? ? ? 1_555 D MG . MG ? ? A ASP 859 A MG 1103 1_555 ? ? ? ? ? ? ? 2.027 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 21 ? GLY A 28 ? PHE A 712 GLY A 719 AA1 2 THR A 34 ? TRP A 40 ? THR A 725 TRP A 731 AA1 3 ILE A 49 ? GLU A 55 ? ILE A 740 GLU A 746 AA1 4 GLN A 100 ? GLN A 104 ? GLN A 791 GLN A 795 AA1 5 LEU A 90 ? CYS A 94 ? LEU A 781 CYS A 785 AA2 1 LEU A 146 ? VAL A 147 ? LEU A 837 VAL A 838 AA2 2 LYS A 173 ? LEU A 174 ? LYS A 864 LEU A 865 AA3 1 VAL A 156 ? THR A 160 ? VAL A 847 THR A 851 AA3 2 HIS A 163 ? ILE A 166 ? HIS A 854 ILE A 857 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 27 ? N LEU A 718 O VAL A 35 ? O VAL A 726 AA1 2 3 N THR A 34 ? N THR A 725 O GLU A 55 ? O GLU A 746 AA1 3 4 N LYS A 54 ? N LYS A 745 O LEU A 101 ? O LEU A 792 AA1 4 5 O ILE A 102 ? O ILE A 793 N GLY A 92 ? N GLY A 783 AA2 1 2 N VAL A 147 ? N VAL A 838 O LYS A 173 ? O LYS A 864 AA3 1 2 N LEU A 157 ? N LEU A 848 O LYS A 165 ? O LYS A 856 # _atom_sites.entry_id 8DSW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.006732 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006732 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006732 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MG MN N O P S # loop_ _database_PDB_caveat.text ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 692 ? ? ? A . n A 1 2 SER 2 693 ? ? ? A . n A 1 3 THR 3 694 694 THR THR A . n A 1 4 SER 4 695 695 SER SER A . n A 1 5 GLY 5 696 696 GLY GLY A . n A 1 6 GLU 6 697 697 GLU GLU A . n A 1 7 ALA 7 698 698 ALA ALA A . n A 1 8 PRO 8 699 699 PRO PRO A . n A 1 9 ASN 9 700 700 ASN ASN A . n A 1 10 GLN 10 701 701 GLN GLN A . n A 1 11 ALA 11 702 702 ALA ALA A . n A 1 12 LEU 12 703 703 LEU LEU A . n A 1 13 LEU 13 704 704 LEU LEU A . n A 1 14 ARG 14 705 705 ARG ARG A . n A 1 15 ILE 15 706 706 ILE ILE A . n A 1 16 LEU 16 707 707 LEU LEU A . n A 1 17 LYS 17 708 708 LYS LYS A . n A 1 18 GLU 18 709 709 GLU GLU A . n A 1 19 THR 19 710 710 THR THR A . n A 1 20 GLU 20 711 711 GLU GLU A . n A 1 21 PHE 21 712 712 PHE PHE A . n A 1 22 LYS 22 713 713 LYS LYS A . n A 1 23 LYS 23 714 714 LYS LYS A . n A 1 24 ILE 24 715 715 ILE ILE A . n A 1 25 LYS 25 716 716 LYS LYS A . n A 1 26 VAL 26 717 717 VAL VAL A . n A 1 27 LEU 27 718 718 LEU LEU A . n A 1 28 GLY 28 719 719 GLY GLY A . n A 1 29 SER 29 720 720 SER SER A . n A 1 30 GLY 30 721 ? ? ? A . n A 1 31 ALA 31 722 ? ? ? A . n A 1 32 PHE 32 723 ? ? ? A . n A 1 33 GLY 33 724 724 GLY GLY A . n A 1 34 THR 34 725 725 THR THR A . n A 1 35 VAL 35 726 726 VAL VAL A . n A 1 36 TYR 36 727 727 TYR TYR A . n A 1 37 LYS 37 728 728 LYS LYS A . n A 1 38 GLY 38 729 729 GLY GLY A . n A 1 39 LEU 39 730 730 LEU LEU A . n A 1 40 TRP 40 731 731 TRP TRP A . n A 1 41 ILE 41 732 732 ILE ILE A . n A 1 42 PRO 42 733 733 PRO PRO A . n A 1 43 GLU 43 734 734 GLU GLU A . n A 1 44 GLY 44 735 735 GLY GLY A . n A 1 45 GLU 45 736 736 GLU GLU A . n A 1 46 LYS 46 737 737 LYS LYS A . n A 1 47 VAL 47 738 738 VAL VAL A . n A 1 48 LYS 48 739 739 LYS LYS A . n A 1 49 ILE 49 740 740 ILE ILE A . n A 1 50 PRO 50 741 741 PRO PRO A . n A 1 51 VAL 51 742 742 VAL VAL A . n A 1 52 ALA 52 743 743 ALA ALA A . n A 1 53 ILE 53 744 744 ILE ILE A . n A 1 54 LYS 54 745 745 LYS LYS A . n A 1 55 GLU 55 746 746 GLU GLU A . n A 1 56 LEU 56 747 747 LEU LEU A . n A 1 57 ARG 57 748 748 ARG ARG A . n A 1 58 GLU 58 749 749 GLU GLU A . n A 1 59 ALA 59 750 750 ALA ALA A . n A 1 60 THR 60 751 751 THR THR A . n A 1 61 SER 61 752 752 SER SER A . n A 1 62 PRO 62 753 753 PRO PRO A . n A 1 63 LYS 63 754 754 LYS LYS A . n A 1 64 ALA 64 755 755 ALA ALA A . n A 1 65 ASN 65 756 756 ASN ASN A . n A 1 66 LYS 66 757 757 LYS LYS A . n A 1 67 GLU 67 758 758 GLU GLU A . n A 1 68 ILE 68 759 759 ILE ILE A . n A 1 69 LEU 69 760 760 LEU LEU A . n A 1 70 ASP 70 761 761 ASP ASP A . n A 1 71 GLU 71 762 762 GLU GLU A . n A 1 72 ALA 72 763 763 ALA ALA A . n A 1 73 PHE 73 764 764 PHE PHE A . n A 1 74 GLN 74 765 765 GLN GLN A . n A 1 75 GLU 75 766 766 GLU GLU A . n A 1 76 ALA 76 767 767 ALA ALA A . n A 1 77 TYR 77 768 768 TYR TYR A . n A 1 78 VAL 78 769 769 VAL VAL A . n A 1 79 MET 79 770 770 MET MET A . n A 1 80 ALA 80 771 771 ALA ALA A . n A 1 81 SER 81 772 772 SER SER A . n A 1 82 VAL 82 773 773 VAL VAL A . n A 1 83 ASP 83 774 774 ASP ASP A . n A 1 84 ASN 84 775 775 ASN ASN A . n A 1 85 PRO 85 776 776 PRO PRO A . n A 1 86 HIS 86 777 777 HIS HIS A . n A 1 87 VAL 87 778 778 VAL VAL A . n A 1 88 CYS 88 779 779 CYS CYS A . n A 1 89 ARG 89 780 780 ARG ARG A . n A 1 90 LEU 90 781 781 LEU LEU A . n A 1 91 LEU 91 782 782 LEU LEU A . n A 1 92 GLY 92 783 783 GLY GLY A . n A 1 93 ILE 93 784 784 ILE ILE A . n A 1 94 CYS 94 785 785 CYS CYS A . n A 1 95 LEU 95 786 786 LEU LEU A . n A 1 96 THR 96 787 787 THR THR A . n A 1 97 SER 97 788 788 SER SER A . n A 1 98 THR 98 789 789 THR THR A . n A 1 99 VAL 99 790 790 VAL VAL A . n A 1 100 GLN 100 791 791 GLN GLN A . n A 1 101 LEU 101 792 792 LEU LEU A . n A 1 102 ILE 102 793 793 ILE ILE A . n A 1 103 THR 103 794 794 THR THR A . n A 1 104 GLN 104 795 795 GLN GLN A . n A 1 105 LEU 105 796 796 LEU LEU A . n A 1 106 MET 106 797 797 MET MET A . n A 1 107 PRO 107 798 798 PRO PRO A . n A 1 108 PHE 108 799 799 PHE PHE A . n A 1 109 GLY 109 800 800 GLY GLY A . n A 1 110 CYS 110 801 801 CYS CYS A . n A 1 111 LEU 111 802 802 LEU LEU A . n A 1 112 LEU 112 803 803 LEU LEU A . n A 1 113 ASP 113 804 804 ASP ASP A . n A 1 114 TYR 114 805 805 TYR TYR A . n A 1 115 VAL 115 806 806 VAL VAL A . n A 1 116 ARG 116 807 807 ARG ARG A . n A 1 117 GLU 117 808 808 GLU GLU A . n A 1 118 HIS 118 809 809 HIS HIS A . n A 1 119 LYS 119 810 810 LYS LYS A . n A 1 120 ASP 120 811 811 ASP ASP A . n A 1 121 ASN 121 812 812 ASN ASN A . n A 1 122 ILE 122 813 813 ILE ILE A . n A 1 123 GLY 123 814 814 GLY GLY A . n A 1 124 SER 124 815 815 SER SER A . n A 1 125 GLN 125 816 816 GLN GLN A . n A 1 126 TYR 126 817 817 TYR TYR A . n A 1 127 LEU 127 818 818 LEU LEU A . n A 1 128 LEU 128 819 819 LEU LEU A . n A 1 129 ASN 129 820 820 ASN ASN A . n A 1 130 TRP 130 821 821 TRP TRP A . n A 1 131 CYS 131 822 822 CYS CYS A . n A 1 132 VAL 132 823 823 VAL VAL A . n A 1 133 GLN 133 824 824 GLN GLN A . n A 1 134 ILE 134 825 825 ILE ILE A . n A 1 135 ALA 135 826 826 ALA ALA A . n A 1 136 LYS 136 827 827 LYS LYS A . n A 1 137 GLY 137 828 828 GLY GLY A . n A 1 138 MET 138 829 829 MET MET A . n A 1 139 ASN 139 830 830 ASN ASN A . n A 1 140 TYR 140 831 831 TYR TYR A . n A 1 141 LEU 141 832 832 LEU LEU A . n A 1 142 GLU 142 833 833 GLU GLU A . n A 1 143 ASP 143 834 834 ASP ASP A . n A 1 144 ARG 144 835 835 ARG ARG A . n A 1 145 ARG 145 836 836 ARG ARG A . n A 1 146 LEU 146 837 837 LEU LEU A . n A 1 147 VAL 147 838 838 VAL VAL A . n A 1 148 HIS 148 839 839 HIS HIS A . n A 1 149 ARG 149 840 840 ARG ARG A . n A 1 150 ASP 150 841 841 ASP ASP A . n A 1 151 LEU 151 842 842 LEU LEU A . n A 1 152 ALA 152 843 843 ALA ALA A . n A 1 153 ALA 153 844 844 ALA ALA A . n A 1 154 ARG 154 845 845 ARG ARG A . n A 1 155 ASN 155 846 846 ASN ASN A . n A 1 156 VAL 156 847 847 VAL VAL A . n A 1 157 LEU 157 848 848 LEU LEU A . n A 1 158 VAL 158 849 849 VAL VAL A . n A 1 159 LYS 159 850 850 LYS LYS A . n A 1 160 THR 160 851 851 THR THR A . n A 1 161 PRO 161 852 852 PRO PRO A . n A 1 162 GLN 162 853 853 GLN GLN A . n A 1 163 HIS 163 854 854 HIS HIS A . n A 1 164 VAL 164 855 855 VAL VAL A . n A 1 165 LYS 165 856 856 LYS LYS A . n A 1 166 ILE 166 857 857 ILE ILE A . n A 1 167 THR 167 858 858 THR THR A . n A 1 168 ASP 168 859 859 ASP ASP A . n A 1 169 PHE 169 860 860 PHE PHE A . n A 1 170 GLY 170 861 861 GLY GLY A . n A 1 171 LEU 171 862 862 LEU LEU A . n A 1 172 ALA 172 863 863 ALA ALA A . n A 1 173 LYS 173 864 864 LYS LYS A . n A 1 174 LEU 174 865 865 LEU LEU A . n A 1 175 LEU 175 866 866 LEU LEU A . n A 1 176 GLY 176 867 867 GLY GLY A . n A 1 177 ALA 177 868 868 ALA ALA A . n A 1 178 GLU 178 869 869 GLU GLU A . n A 1 179 GLU 179 870 870 GLU GLU A . n A 1 180 LYS 180 871 ? ? ? A . n A 1 181 GLU 181 872 ? ? ? A . n A 1 182 TYR 182 873 ? ? ? A . n A 1 183 HIS 183 874 ? ? ? A . n A 1 184 ALA 184 875 ? ? ? A . n A 1 185 GLU 185 876 ? ? ? A . n A 1 186 GLY 186 877 ? ? ? A . n A 1 187 GLY 187 878 ? ? ? A . n A 1 188 LYS 188 879 ? ? ? A . n A 1 189 VAL 189 880 880 VAL VAL A . n A 1 190 PRO 190 881 881 PRO PRO A . n A 1 191 ILE 191 882 882 ILE ILE A . n A 1 192 LYS 192 883 883 LYS LYS A . n A 1 193 TRP 193 884 884 TRP TRP A . n A 1 194 MET 194 885 885 MET MET A . n A 1 195 ALA 195 886 886 ALA ALA A . n A 1 196 LEU 196 887 887 LEU LEU A . n A 1 197 GLU 197 888 888 GLU GLU A . n A 1 198 SER 198 889 889 SER SER A . n A 1 199 ILE 199 890 890 ILE ILE A . n A 1 200 LEU 200 891 891 LEU LEU A . n A 1 201 HIS 201 892 892 HIS HIS A . n A 1 202 ARG 202 893 893 ARG ARG A . n A 1 203 ILE 203 894 894 ILE ILE A . n A 1 204 TYR 204 895 895 TYR TYR A . n A 1 205 THR 205 896 896 THR THR A . n A 1 206 HIS 206 897 897 HIS HIS A . n A 1 207 GLN 207 898 898 GLN GLN A . n A 1 208 SER 208 899 899 SER SER A . n A 1 209 ASP 209 900 900 ASP ASP A . n A 1 210 VAL 210 901 901 VAL VAL A . n A 1 211 TRP 211 902 902 TRP TRP A . n A 1 212 SER 212 903 903 SER SER A . n A 1 213 TYR 213 904 904 TYR TYR A . n A 1 214 GLY 214 905 905 GLY GLY A . n A 1 215 VAL 215 906 906 VAL VAL A . n A 1 216 THR 216 907 907 THR THR A . n A 1 217 VAL 217 908 908 VAL VAL A . n A 1 218 TRP 218 909 909 TRP TRP A . n A 1 219 GLU 219 910 910 GLU GLU A . n A 1 220 LEU 220 911 911 LEU LEU A . n A 1 221 MET 221 912 912 MET MET A . n A 1 222 THR 222 913 913 THR THR A . n A 1 223 PHE 223 914 914 PHE PHE A . n A 1 224 GLY 224 915 915 GLY GLY A . n A 1 225 SER 225 916 916 SER SER A . n A 1 226 LYS 226 917 917 LYS LYS A . n A 1 227 PRO 227 918 918 PRO PRO A . n A 1 228 TYR 228 919 919 TYR TYR A . n A 1 229 ASP 229 920 920 ASP ASP A . n A 1 230 GLY 230 921 921 GLY GLY A . n A 1 231 ILE 231 922 922 ILE ILE A . n A 1 232 PRO 232 923 923 PRO PRO A . n A 1 233 ALA 233 924 924 ALA ALA A . n A 1 234 SER 234 925 925 SER SER A . n A 1 235 GLU 235 926 926 GLU GLU A . n A 1 236 ILE 236 927 927 ILE ILE A . n A 1 237 SER 237 928 928 SER SER A . n A 1 238 SER 238 929 929 SER SER A . n A 1 239 ILE 239 930 930 ILE ILE A . n A 1 240 LEU 240 931 931 LEU LEU A . n A 1 241 GLU 241 932 932 GLU GLU A . n A 1 242 LYS 242 933 933 LYS LYS A . n A 1 243 GLY 243 934 934 GLY GLY A . n A 1 244 GLU 244 935 935 GLU GLU A . n A 1 245 ARG 245 936 936 ARG ARG A . n A 1 246 LEU 246 937 937 LEU LEU A . n A 1 247 PRO 247 938 938 PRO PRO A . n A 1 248 GLN 248 939 939 GLN GLN A . n A 1 249 PRO 249 940 940 PRO PRO A . n A 1 250 PRO 250 941 941 PRO PRO A . n A 1 251 ILE 251 942 942 ILE ILE A . n A 1 252 CYS 252 943 943 CYS CYS A . n A 1 253 THR 253 944 944 THR THR A . n A 1 254 ILE 254 945 945 ILE ILE A . n A 1 255 ASP 255 946 946 ASP ASP A . n A 1 256 VAL 256 947 947 VAL VAL A . n A 1 257 TYR 257 948 948 TYR TYR A . n A 1 258 MET 258 949 949 MET MET A . n A 1 259 ILE 259 950 950 ILE ILE A . n A 1 260 MET 260 951 951 MET MET A . n A 1 261 VAL 261 952 952 VAL VAL A . n A 1 262 LYS 262 953 953 LYS LYS A . n A 1 263 CYS 263 954 954 CYS CYS A . n A 1 264 TRP 264 955 955 TRP TRP A . n A 1 265 MET 265 956 956 MET MET A . n A 1 266 ILE 266 957 957 ILE ILE A . n A 1 267 ASP 267 958 958 ASP ASP A . n A 1 268 ALA 268 959 959 ALA ALA A . n A 1 269 ASP 269 960 960 ASP ASP A . n A 1 270 SER 270 961 961 SER SER A . n A 1 271 ARG 271 962 962 ARG ARG A . n A 1 272 PRO 272 963 963 PRO PRO A . n A 1 273 LYS 273 964 964 LYS LYS A . n A 1 274 PHE 274 965 965 PHE PHE A . n A 1 275 ARG 275 966 966 ARG ARG A . n A 1 276 GLU 276 967 967 GLU GLU A . n A 1 277 LEU 277 968 968 LEU LEU A . n A 1 278 ILE 278 969 969 ILE ILE A . n A 1 279 ILE 279 970 970 ILE ILE A . n A 1 280 GLU 280 971 971 GLU GLU A . n A 1 281 PHE 281 972 972 PHE PHE A . n A 1 282 SER 282 973 973 SER SER A . n A 1 283 LYS 283 974 974 LYS LYS A . n A 1 284 MET 284 975 975 MET MET A . n A 1 285 ALA 285 976 976 ALA ALA A . n A 1 286 ARG 286 977 977 ARG ARG A . n A 1 287 ASP 287 978 978 ASP ASP A . n A 1 288 PRO 288 979 979 PRO PRO A . n A 1 289 GLN 289 980 980 GLN GLN A . n A 1 290 ARG 290 981 981 ARG ARG A . n A 1 291 TYR 291 982 982 TYR TYR A . n A 1 292 LEU 292 983 983 LEU LEU A . n A 1 293 VAL 293 984 984 VAL VAL A . n A 1 294 ILE 294 985 985 ILE ILE A . n A 1 295 GLN 295 986 986 GLN GLN A . n A 1 296 GLY 296 987 987 GLY GLY A . n A 1 297 ASP 297 988 988 ASP ASP A . n A 1 298 GLU 298 989 989 GLU GLU A . n A 1 299 ARG 299 990 990 ARG ARG A . n A 1 300 MET 300 991 991 MET MET A . n A 1 301 HIS 301 992 992 HIS HIS A . n A 1 302 LEU 302 993 993 LEU LEU A . n A 1 303 PRO 303 994 ? ? ? A . n A 1 304 SER 304 995 ? ? ? A . n A 1 305 PRO 305 996 ? ? ? A . n A 1 306 THR 306 997 ? ? ? A . n A 1 307 ASP 307 998 ? ? ? A . n A 1 308 SER 308 999 ? ? ? A . n A 1 309 ASN 309 1000 ? ? ? A . n A 1 310 PHE 310 1001 ? ? ? A . n A 1 311 TYR 311 1002 ? ? ? A . n A 1 312 ARG 312 1003 1003 ARG ARG A . n A 1 313 ALA 313 1004 1004 ALA ALA A . n A 1 314 LEU 314 1005 1005 LEU LEU A . n A 1 315 MET 315 1006 1006 MET MET A . n A 1 316 ASP 316 1007 1007 ASP ASP A . n A 1 317 GLU 317 1008 1008 GLU GLU A . n A 1 318 GLU 318 1009 1009 GLU GLU A . n A 1 319 ASP 319 1010 1010 ASP ASP A . n A 1 320 MET 320 1011 1011 MET MET A . n A 1 321 ASP 321 1012 1012 ASP ASP A . n A 1 322 ASP 322 1013 1013 ASP ASP A . n A 1 323 VAL 323 1014 1014 VAL VAL A . n A 1 324 VAL 324 1015 1015 VAL VAL A . n A 1 325 ASP 325 1016 1016 ASP ASP A . n A 1 326 ALA 326 1017 1017 ALA ALA A . n A 1 327 ASP 327 1018 1018 ASP ASP A . n A 1 328 GLU 328 1019 1019 GLU GLU A . n A 1 329 TYR 329 1020 1020 TYR TYR A . n A 1 330 LEU 330 1021 1021 LEU LEU A . n A 1 331 ILE 331 1022 ? ? ? A . n A 1 332 PRO 332 1023 ? ? ? A . n A 1 333 GLN 333 1024 ? ? ? A . n A 1 334 GLN 334 1025 ? ? ? A . n A 1 335 GLY 335 1026 ? ? ? A . n # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' P50CA165962 1 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' R50CA221830 2 # _pdbx_contact_author.id 2 _pdbx_contact_author.email Michael_Eck@dfci.harvard.edu _pdbx_contact_author.name_first Michael _pdbx_contact_author.name_last Eck _pdbx_contact_author.name_mi J _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4247-9403 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ANP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ANP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'TETRAETHYLENE GLYCOL' PG4 3 'MAGNESIUM ION' MG 4 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ANP 5 water HOH # _pdbx_entry_details.entry_id 8DSW _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ANP PG P N N 14 ANP O1G O N N 15 ANP O2G O N N 16 ANP O3G O N N 17 ANP PB P N N 18 ANP O1B O N N 19 ANP O2B O N N 20 ANP N3B N N N 21 ANP PA P N N 22 ANP O1A O N N 23 ANP O2A O N N 24 ANP O3A O N N 25 ANP "O5'" O N N 26 ANP "C5'" C N N 27 ANP "C4'" C N R 28 ANP "O4'" O N N 29 ANP "C3'" C N S 30 ANP "O3'" O N N 31 ANP "C2'" C N R 32 ANP "O2'" O N N 33 ANP "C1'" C N R 34 ANP N9 N Y N 35 ANP C8 C Y N 36 ANP N7 N Y N 37 ANP C5 C Y N 38 ANP C6 C Y N 39 ANP N6 N N N 40 ANP N1 N Y N 41 ANP C2 C Y N 42 ANP N3 N Y N 43 ANP C4 C Y N 44 ANP HOG2 H N N 45 ANP HOG3 H N N 46 ANP HOB2 H N N 47 ANP HNB1 H N N 48 ANP HOA2 H N N 49 ANP "H5'1" H N N 50 ANP "H5'2" H N N 51 ANP "H4'" H N N 52 ANP "H3'" H N N 53 ANP "HO3'" H N N 54 ANP "H2'" H N N 55 ANP "HO2'" H N N 56 ANP "H1'" H N N 57 ANP H8 H N N 58 ANP HN61 H N N 59 ANP HN62 H N N 60 ANP H2 H N N 61 ARG N N N N 62 ARG CA C N S 63 ARG C C N N 64 ARG O O N N 65 ARG CB C N N 66 ARG CG C N N 67 ARG CD C N N 68 ARG NE N N N 69 ARG CZ C N N 70 ARG NH1 N N N 71 ARG NH2 N N N 72 ARG OXT O N N 73 ARG H H N N 74 ARG H2 H N N 75 ARG HA H N N 76 ARG HB2 H N N 77 ARG HB3 H N N 78 ARG HG2 H N N 79 ARG HG3 H N N 80 ARG HD2 H N N 81 ARG HD3 H N N 82 ARG HE H N N 83 ARG HH11 H N N 84 ARG HH12 H N N 85 ARG HH21 H N N 86 ARG HH22 H N N 87 ARG HXT H N N 88 ASN N N N N 89 ASN CA C N S 90 ASN C C N N 91 ASN O O N N 92 ASN CB C N N 93 ASN CG C N N 94 ASN OD1 O N N 95 ASN ND2 N N N 96 ASN OXT O N N 97 ASN H H N N 98 ASN H2 H N N 99 ASN HA H N N 100 ASN HB2 H N N 101 ASN HB3 H N N 102 ASN HD21 H N N 103 ASN HD22 H N N 104 ASN HXT H N N 105 ASP N N N N 106 ASP CA C N S 107 ASP C C N N 108 ASP O O N N 109 ASP CB C N N 110 ASP CG C N N 111 ASP OD1 O N N 112 ASP OD2 O N N 113 ASP OXT O N N 114 ASP H H N N 115 ASP H2 H N N 116 ASP HA H N N 117 ASP HB2 H N N 118 ASP HB3 H N N 119 ASP HD2 H N N 120 ASP HXT H N N 121 CYS N N N N 122 CYS CA C N R 123 CYS C C N N 124 CYS O O N N 125 CYS CB C N N 126 CYS SG S N N 127 CYS OXT O N N 128 CYS H H N N 129 CYS H2 H N N 130 CYS HA H N N 131 CYS HB2 H N N 132 CYS HB3 H N N 133 CYS HG H N N 134 CYS HXT H N N 135 GLN N N N N 136 GLN CA C N S 137 GLN C C N N 138 GLN O O N N 139 GLN CB C N N 140 GLN CG C N N 141 GLN CD C N N 142 GLN OE1 O N N 143 GLN NE2 N N N 144 GLN OXT O N N 145 GLN H H N N 146 GLN H2 H N N 147 GLN HA H N N 148 GLN HB2 H N N 149 GLN HB3 H N N 150 GLN HG2 H N N 151 GLN HG3 H N N 152 GLN HE21 H N N 153 GLN HE22 H N N 154 GLN HXT H N N 155 GLU N N N N 156 GLU CA C N S 157 GLU C C N N 158 GLU O O N N 159 GLU CB C N N 160 GLU CG C N N 161 GLU CD C N N 162 GLU OE1 O N N 163 GLU OE2 O N N 164 GLU OXT O N N 165 GLU H H N N 166 GLU H2 H N N 167 GLU HA H N N 168 GLU HB2 H N N 169 GLU HB3 H N N 170 GLU HG2 H N N 171 GLU HG3 H N N 172 GLU HE2 H N N 173 GLU HXT H N N 174 GLY N N N N 175 GLY CA C N N 176 GLY C C N N 177 GLY O O N N 178 GLY OXT O N N 179 GLY H H N N 180 GLY H2 H N N 181 GLY HA2 H N N 182 GLY HA3 H N N 183 GLY HXT H N N 184 HIS N N N N 185 HIS CA C N S 186 HIS C C N N 187 HIS O O N N 188 HIS CB C N N 189 HIS CG C Y N 190 HIS ND1 N Y N 191 HIS CD2 C Y N 192 HIS CE1 C Y N 193 HIS NE2 N Y N 194 HIS OXT O N N 195 HIS H H N N 196 HIS H2 H N N 197 HIS HA H N N 198 HIS HB2 H N N 199 HIS HB3 H N N 200 HIS HD1 H N N 201 HIS HD2 H N N 202 HIS HE1 H N N 203 HIS HE2 H N N 204 HIS HXT H N N 205 HOH O O N N 206 HOH H1 H N N 207 HOH H2 H N N 208 ILE N N N N 209 ILE CA C N S 210 ILE C C N N 211 ILE O O N N 212 ILE CB C N S 213 ILE CG1 C N N 214 ILE CG2 C N N 215 ILE CD1 C N N 216 ILE OXT O N N 217 ILE H H N N 218 ILE H2 H N N 219 ILE HA H N N 220 ILE HB H N N 221 ILE HG12 H N N 222 ILE HG13 H N N 223 ILE HG21 H N N 224 ILE HG22 H N N 225 ILE HG23 H N N 226 ILE HD11 H N N 227 ILE HD12 H N N 228 ILE HD13 H N N 229 ILE HXT H N N 230 LEU N N N N 231 LEU CA C N S 232 LEU C C N N 233 LEU O O N N 234 LEU CB C N N 235 LEU CG C N N 236 LEU CD1 C N N 237 LEU CD2 C N N 238 LEU OXT O N N 239 LEU H H N N 240 LEU H2 H N N 241 LEU HA H N N 242 LEU HB2 H N N 243 LEU HB3 H N N 244 LEU HG H N N 245 LEU HD11 H N N 246 LEU HD12 H N N 247 LEU HD13 H N N 248 LEU HD21 H N N 249 LEU HD22 H N N 250 LEU HD23 H N N 251 LEU HXT H N N 252 LYS N N N N 253 LYS CA C N S 254 LYS C C N N 255 LYS O O N N 256 LYS CB C N N 257 LYS CG C N N 258 LYS CD C N N 259 LYS CE C N N 260 LYS NZ N N N 261 LYS OXT O N N 262 LYS H H N N 263 LYS H2 H N N 264 LYS HA H N N 265 LYS HB2 H N N 266 LYS HB3 H N N 267 LYS HG2 H N N 268 LYS HG3 H N N 269 LYS HD2 H N N 270 LYS HD3 H N N 271 LYS HE2 H N N 272 LYS HE3 H N N 273 LYS HZ1 H N N 274 LYS HZ2 H N N 275 LYS HZ3 H N N 276 LYS HXT H N N 277 MET N N N N 278 MET CA C N S 279 MET C C N N 280 MET O O N N 281 MET CB C N N 282 MET CG C N N 283 MET SD S N N 284 MET CE C N N 285 MET OXT O N N 286 MET H H N N 287 MET H2 H N N 288 MET HA H N N 289 MET HB2 H N N 290 MET HB3 H N N 291 MET HG2 H N N 292 MET HG3 H N N 293 MET HE1 H N N 294 MET HE2 H N N 295 MET HE3 H N N 296 MET HXT H N N 297 MG MG MG N N 298 PG4 O1 O N N 299 PG4 C1 C N N 300 PG4 C2 C N N 301 PG4 O2 O N N 302 PG4 C3 C N N 303 PG4 C4 C N N 304 PG4 O3 O N N 305 PG4 C5 C N N 306 PG4 C6 C N N 307 PG4 O4 O N N 308 PG4 C7 C N N 309 PG4 C8 C N N 310 PG4 O5 O N N 311 PG4 HO1 H N N 312 PG4 H11 H N N 313 PG4 H12 H N N 314 PG4 H21 H N N 315 PG4 H22 H N N 316 PG4 H31 H N N 317 PG4 H32 H N N 318 PG4 H41 H N N 319 PG4 H42 H N N 320 PG4 H51 H N N 321 PG4 H52 H N N 322 PG4 H61 H N N 323 PG4 H62 H N N 324 PG4 H71 H N N 325 PG4 H72 H N N 326 PG4 H81 H N N 327 PG4 H82 H N N 328 PG4 HO5 H N N 329 PHE N N N N 330 PHE CA C N S 331 PHE C C N N 332 PHE O O N N 333 PHE CB C N N 334 PHE CG C Y N 335 PHE CD1 C Y N 336 PHE CD2 C Y N 337 PHE CE1 C Y N 338 PHE CE2 C Y N 339 PHE CZ C Y N 340 PHE OXT O N N 341 PHE H H N N 342 PHE H2 H N N 343 PHE HA H N N 344 PHE HB2 H N N 345 PHE HB3 H N N 346 PHE HD1 H N N 347 PHE HD2 H N N 348 PHE HE1 H N N 349 PHE HE2 H N N 350 PHE HZ H N N 351 PHE HXT H N N 352 PRO N N N N 353 PRO CA C N S 354 PRO C C N N 355 PRO O O N N 356 PRO CB C N N 357 PRO CG C N N 358 PRO CD C N N 359 PRO OXT O N N 360 PRO H H N N 361 PRO HA H N N 362 PRO HB2 H N N 363 PRO HB3 H N N 364 PRO HG2 H N N 365 PRO HG3 H N N 366 PRO HD2 H N N 367 PRO HD3 H N N 368 PRO HXT H N N 369 SER N N N N 370 SER CA C N S 371 SER C C N N 372 SER O O N N 373 SER CB C N N 374 SER OG O N N 375 SER OXT O N N 376 SER H H N N 377 SER H2 H N N 378 SER HA H N N 379 SER HB2 H N N 380 SER HB3 H N N 381 SER HG H N N 382 SER HXT H N N 383 THR N N N N 384 THR CA C N S 385 THR C C N N 386 THR O O N N 387 THR CB C N R 388 THR OG1 O N N 389 THR CG2 C N N 390 THR OXT O N N 391 THR H H N N 392 THR H2 H N N 393 THR HA H N N 394 THR HB H N N 395 THR HG1 H N N 396 THR HG21 H N N 397 THR HG22 H N N 398 THR HG23 H N N 399 THR HXT H N N 400 TRP N N N N 401 TRP CA C N S 402 TRP C C N N 403 TRP O O N N 404 TRP CB C N N 405 TRP CG C Y N 406 TRP CD1 C Y N 407 TRP CD2 C Y N 408 TRP NE1 N Y N 409 TRP CE2 C Y N 410 TRP CE3 C Y N 411 TRP CZ2 C Y N 412 TRP CZ3 C Y N 413 TRP CH2 C Y N 414 TRP OXT O N N 415 TRP H H N N 416 TRP H2 H N N 417 TRP HA H N N 418 TRP HB2 H N N 419 TRP HB3 H N N 420 TRP HD1 H N N 421 TRP HE1 H N N 422 TRP HE3 H N N 423 TRP HZ2 H N N 424 TRP HZ3 H N N 425 TRP HH2 H N N 426 TRP HXT H N N 427 TYR N N N N 428 TYR CA C N S 429 TYR C C N N 430 TYR O O N N 431 TYR CB C N N 432 TYR CG C Y N 433 TYR CD1 C Y N 434 TYR CD2 C Y N 435 TYR CE1 C Y N 436 TYR CE2 C Y N 437 TYR CZ C Y N 438 TYR OH O N N 439 TYR OXT O N N 440 TYR H H N N 441 TYR H2 H N N 442 TYR HA H N N 443 TYR HB2 H N N 444 TYR HB3 H N N 445 TYR HD1 H N N 446 TYR HD2 H N N 447 TYR HE1 H N N 448 TYR HE2 H N N 449 TYR HH H N N 450 TYR HXT H N N 451 VAL N N N N 452 VAL CA C N S 453 VAL C C N N 454 VAL O O N N 455 VAL CB C N N 456 VAL CG1 C N N 457 VAL CG2 C N N 458 VAL OXT O N N 459 VAL H H N N 460 VAL H2 H N N 461 VAL HA H N N 462 VAL HB H N N 463 VAL HG11 H N N 464 VAL HG12 H N N 465 VAL HG13 H N N 466 VAL HG21 H N N 467 VAL HG22 H N N 468 VAL HG23 H N N 469 VAL HXT H N N 470 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ANP PG O1G doub N N 13 ANP PG O2G sing N N 14 ANP PG O3G sing N N 15 ANP PG N3B sing N N 16 ANP O2G HOG2 sing N N 17 ANP O3G HOG3 sing N N 18 ANP PB O1B doub N N 19 ANP PB O2B sing N N 20 ANP PB N3B sing N N 21 ANP PB O3A sing N N 22 ANP O2B HOB2 sing N N 23 ANP N3B HNB1 sing N N 24 ANP PA O1A doub N N 25 ANP PA O2A sing N N 26 ANP PA O3A sing N N 27 ANP PA "O5'" sing N N 28 ANP O2A HOA2 sing N N 29 ANP "O5'" "C5'" sing N N 30 ANP "C5'" "C4'" sing N N 31 ANP "C5'" "H5'1" sing N N 32 ANP "C5'" "H5'2" sing N N 33 ANP "C4'" "O4'" sing N N 34 ANP "C4'" "C3'" sing N N 35 ANP "C4'" "H4'" sing N N 36 ANP "O4'" "C1'" sing N N 37 ANP "C3'" "O3'" sing N N 38 ANP "C3'" "C2'" sing N N 39 ANP "C3'" "H3'" sing N N 40 ANP "O3'" "HO3'" sing N N 41 ANP "C2'" "O2'" sing N N 42 ANP "C2'" "C1'" sing N N 43 ANP "C2'" "H2'" sing N N 44 ANP "O2'" "HO2'" sing N N 45 ANP "C1'" N9 sing N N 46 ANP "C1'" "H1'" sing N N 47 ANP N9 C8 sing Y N 48 ANP N9 C4 sing Y N 49 ANP C8 N7 doub Y N 50 ANP C8 H8 sing N N 51 ANP N7 C5 sing Y N 52 ANP C5 C6 sing Y N 53 ANP C5 C4 doub Y N 54 ANP C6 N6 sing N N 55 ANP C6 N1 doub Y N 56 ANP N6 HN61 sing N N 57 ANP N6 HN62 sing N N 58 ANP N1 C2 sing Y N 59 ANP C2 N3 doub Y N 60 ANP C2 H2 sing N N 61 ANP N3 C4 sing Y N 62 ARG N CA sing N N 63 ARG N H sing N N 64 ARG N H2 sing N N 65 ARG CA C sing N N 66 ARG CA CB sing N N 67 ARG CA HA sing N N 68 ARG C O doub N N 69 ARG C OXT sing N N 70 ARG CB CG sing N N 71 ARG CB HB2 sing N N 72 ARG CB HB3 sing N N 73 ARG CG CD sing N N 74 ARG CG HG2 sing N N 75 ARG CG HG3 sing N N 76 ARG CD NE sing N N 77 ARG CD HD2 sing N N 78 ARG CD HD3 sing N N 79 ARG NE CZ sing N N 80 ARG NE HE sing N N 81 ARG CZ NH1 sing N N 82 ARG CZ NH2 doub N N 83 ARG NH1 HH11 sing N N 84 ARG NH1 HH12 sing N N 85 ARG NH2 HH21 sing N N 86 ARG NH2 HH22 sing N N 87 ARG OXT HXT sing N N 88 ASN N CA sing N N 89 ASN N H sing N N 90 ASN N H2 sing N N 91 ASN CA C sing N N 92 ASN CA CB sing N N 93 ASN CA HA sing N N 94 ASN C O doub N N 95 ASN C OXT sing N N 96 ASN CB CG sing N N 97 ASN CB HB2 sing N N 98 ASN CB HB3 sing N N 99 ASN CG OD1 doub N N 100 ASN CG ND2 sing N N 101 ASN ND2 HD21 sing N N 102 ASN ND2 HD22 sing N N 103 ASN OXT HXT sing N N 104 ASP N CA sing N N 105 ASP N H sing N N 106 ASP N H2 sing N N 107 ASP CA C sing N N 108 ASP CA CB sing N N 109 ASP CA HA sing N N 110 ASP C O doub N N 111 ASP C OXT sing N N 112 ASP CB CG sing N N 113 ASP CB HB2 sing N N 114 ASP CB HB3 sing N N 115 ASP CG OD1 doub N N 116 ASP CG OD2 sing N N 117 ASP OD2 HD2 sing N N 118 ASP OXT HXT sing N N 119 CYS N CA sing N N 120 CYS N H sing N N 121 CYS N H2 sing N N 122 CYS CA C sing N N 123 CYS CA CB sing N N 124 CYS CA HA sing N N 125 CYS C O doub N N 126 CYS C OXT sing N N 127 CYS CB SG sing N N 128 CYS CB HB2 sing N N 129 CYS CB HB3 sing N N 130 CYS SG HG sing N N 131 CYS OXT HXT sing N N 132 GLN N CA sing N N 133 GLN N H sing N N 134 GLN N H2 sing N N 135 GLN CA C sing N N 136 GLN CA CB sing N N 137 GLN CA HA sing N N 138 GLN C O doub N N 139 GLN C OXT sing N N 140 GLN CB CG sing N N 141 GLN CB HB2 sing N N 142 GLN CB HB3 sing N N 143 GLN CG CD sing N N 144 GLN CG HG2 sing N N 145 GLN CG HG3 sing N N 146 GLN CD OE1 doub N N 147 GLN CD NE2 sing N N 148 GLN NE2 HE21 sing N N 149 GLN NE2 HE22 sing N N 150 GLN OXT HXT sing N N 151 GLU N CA sing N N 152 GLU N H sing N N 153 GLU N H2 sing N N 154 GLU CA C sing N N 155 GLU CA CB sing N N 156 GLU CA HA sing N N 157 GLU C O doub N N 158 GLU C OXT sing N N 159 GLU CB CG sing N N 160 GLU CB HB2 sing N N 161 GLU CB HB3 sing N N 162 GLU CG CD sing N N 163 GLU CG HG2 sing N N 164 GLU CG HG3 sing N N 165 GLU CD OE1 doub N N 166 GLU CD OE2 sing N N 167 GLU OE2 HE2 sing N N 168 GLU OXT HXT sing N N 169 GLY N CA sing N N 170 GLY N H sing N N 171 GLY N H2 sing N N 172 GLY CA C sing N N 173 GLY CA HA2 sing N N 174 GLY CA HA3 sing N N 175 GLY C O doub N N 176 GLY C OXT sing N N 177 GLY OXT HXT sing N N 178 HIS N CA sing N N 179 HIS N H sing N N 180 HIS N H2 sing N N 181 HIS CA C sing N N 182 HIS CA CB sing N N 183 HIS CA HA sing N N 184 HIS C O doub N N 185 HIS C OXT sing N N 186 HIS CB CG sing N N 187 HIS CB HB2 sing N N 188 HIS CB HB3 sing N N 189 HIS CG ND1 sing Y N 190 HIS CG CD2 doub Y N 191 HIS ND1 CE1 doub Y N 192 HIS ND1 HD1 sing N N 193 HIS CD2 NE2 sing Y N 194 HIS CD2 HD2 sing N N 195 HIS CE1 NE2 sing Y N 196 HIS CE1 HE1 sing N N 197 HIS NE2 HE2 sing N N 198 HIS OXT HXT sing N N 199 HOH O H1 sing N N 200 HOH O H2 sing N N 201 ILE N CA sing N N 202 ILE N H sing N N 203 ILE N H2 sing N N 204 ILE CA C sing N N 205 ILE CA CB sing N N 206 ILE CA HA sing N N 207 ILE C O doub N N 208 ILE C OXT sing N N 209 ILE CB CG1 sing N N 210 ILE CB CG2 sing N N 211 ILE CB HB sing N N 212 ILE CG1 CD1 sing N N 213 ILE CG1 HG12 sing N N 214 ILE CG1 HG13 sing N N 215 ILE CG2 HG21 sing N N 216 ILE CG2 HG22 sing N N 217 ILE CG2 HG23 sing N N 218 ILE CD1 HD11 sing N N 219 ILE CD1 HD12 sing N N 220 ILE CD1 HD13 sing N N 221 ILE OXT HXT sing N N 222 LEU N CA sing N N 223 LEU N H sing N N 224 LEU N H2 sing N N 225 LEU CA C sing N N 226 LEU CA CB sing N N 227 LEU CA HA sing N N 228 LEU C O doub N N 229 LEU C OXT sing N N 230 LEU CB CG sing N N 231 LEU CB HB2 sing N N 232 LEU CB HB3 sing N N 233 LEU CG CD1 sing N N 234 LEU CG CD2 sing N N 235 LEU CG HG sing N N 236 LEU CD1 HD11 sing N N 237 LEU CD1 HD12 sing N N 238 LEU CD1 HD13 sing N N 239 LEU CD2 HD21 sing N N 240 LEU CD2 HD22 sing N N 241 LEU CD2 HD23 sing N N 242 LEU OXT HXT sing N N 243 LYS N CA sing N N 244 LYS N H sing N N 245 LYS N H2 sing N N 246 LYS CA C sing N N 247 LYS CA CB sing N N 248 LYS CA HA sing N N 249 LYS C O doub N N 250 LYS C OXT sing N N 251 LYS CB CG sing N N 252 LYS CB HB2 sing N N 253 LYS CB HB3 sing N N 254 LYS CG CD sing N N 255 LYS CG HG2 sing N N 256 LYS CG HG3 sing N N 257 LYS CD CE sing N N 258 LYS CD HD2 sing N N 259 LYS CD HD3 sing N N 260 LYS CE NZ sing N N 261 LYS CE HE2 sing N N 262 LYS CE HE3 sing N N 263 LYS NZ HZ1 sing N N 264 LYS NZ HZ2 sing N N 265 LYS NZ HZ3 sing N N 266 LYS OXT HXT sing N N 267 MET N CA sing N N 268 MET N H sing N N 269 MET N H2 sing N N 270 MET CA C sing N N 271 MET CA CB sing N N 272 MET CA HA sing N N 273 MET C O doub N N 274 MET C OXT sing N N 275 MET CB CG sing N N 276 MET CB HB2 sing N N 277 MET CB HB3 sing N N 278 MET CG SD sing N N 279 MET CG HG2 sing N N 280 MET CG HG3 sing N N 281 MET SD CE sing N N 282 MET CE HE1 sing N N 283 MET CE HE2 sing N N 284 MET CE HE3 sing N N 285 MET OXT HXT sing N N 286 PG4 O1 C1 sing N N 287 PG4 O1 HO1 sing N N 288 PG4 C1 C2 sing N N 289 PG4 C1 H11 sing N N 290 PG4 C1 H12 sing N N 291 PG4 C2 O2 sing N N 292 PG4 C2 H21 sing N N 293 PG4 C2 H22 sing N N 294 PG4 O2 C3 sing N N 295 PG4 C3 C4 sing N N 296 PG4 C3 H31 sing N N 297 PG4 C3 H32 sing N N 298 PG4 C4 O3 sing N N 299 PG4 C4 H41 sing N N 300 PG4 C4 H42 sing N N 301 PG4 O3 C5 sing N N 302 PG4 C5 C6 sing N N 303 PG4 C5 H51 sing N N 304 PG4 C5 H52 sing N N 305 PG4 C6 O4 sing N N 306 PG4 C6 H61 sing N N 307 PG4 C6 H62 sing N N 308 PG4 O4 C7 sing N N 309 PG4 C7 C8 sing N N 310 PG4 C7 H71 sing N N 311 PG4 C7 H72 sing N N 312 PG4 C8 O5 sing N N 313 PG4 C8 H81 sing N N 314 PG4 C8 H82 sing N N 315 PG4 O5 HO5 sing N N 316 PHE N CA sing N N 317 PHE N H sing N N 318 PHE N H2 sing N N 319 PHE CA C sing N N 320 PHE CA CB sing N N 321 PHE CA HA sing N N 322 PHE C O doub N N 323 PHE C OXT sing N N 324 PHE CB CG sing N N 325 PHE CB HB2 sing N N 326 PHE CB HB3 sing N N 327 PHE CG CD1 doub Y N 328 PHE CG CD2 sing Y N 329 PHE CD1 CE1 sing Y N 330 PHE CD1 HD1 sing N N 331 PHE CD2 CE2 doub Y N 332 PHE CD2 HD2 sing N N 333 PHE CE1 CZ doub Y N 334 PHE CE1 HE1 sing N N 335 PHE CE2 CZ sing Y N 336 PHE CE2 HE2 sing N N 337 PHE CZ HZ sing N N 338 PHE OXT HXT sing N N 339 PRO N CA sing N N 340 PRO N CD sing N N 341 PRO N H sing N N 342 PRO CA C sing N N 343 PRO CA CB sing N N 344 PRO CA HA sing N N 345 PRO C O doub N N 346 PRO C OXT sing N N 347 PRO CB CG sing N N 348 PRO CB HB2 sing N N 349 PRO CB HB3 sing N N 350 PRO CG CD sing N N 351 PRO CG HG2 sing N N 352 PRO CG HG3 sing N N 353 PRO CD HD2 sing N N 354 PRO CD HD3 sing N N 355 PRO OXT HXT sing N N 356 SER N CA sing N N 357 SER N H sing N N 358 SER N H2 sing N N 359 SER CA C sing N N 360 SER CA CB sing N N 361 SER CA HA sing N N 362 SER C O doub N N 363 SER C OXT sing N N 364 SER CB OG sing N N 365 SER CB HB2 sing N N 366 SER CB HB3 sing N N 367 SER OG HG sing N N 368 SER OXT HXT sing N N 369 THR N CA sing N N 370 THR N H sing N N 371 THR N H2 sing N N 372 THR CA C sing N N 373 THR CA CB sing N N 374 THR CA HA sing N N 375 THR C O doub N N 376 THR C OXT sing N N 377 THR CB OG1 sing N N 378 THR CB CG2 sing N N 379 THR CB HB sing N N 380 THR OG1 HG1 sing N N 381 THR CG2 HG21 sing N N 382 THR CG2 HG22 sing N N 383 THR CG2 HG23 sing N N 384 THR OXT HXT sing N N 385 TRP N CA sing N N 386 TRP N H sing N N 387 TRP N H2 sing N N 388 TRP CA C sing N N 389 TRP CA CB sing N N 390 TRP CA HA sing N N 391 TRP C O doub N N 392 TRP C OXT sing N N 393 TRP CB CG sing N N 394 TRP CB HB2 sing N N 395 TRP CB HB3 sing N N 396 TRP CG CD1 doub Y N 397 TRP CG CD2 sing Y N 398 TRP CD1 NE1 sing Y N 399 TRP CD1 HD1 sing N N 400 TRP CD2 CE2 doub Y N 401 TRP CD2 CE3 sing Y N 402 TRP NE1 CE2 sing Y N 403 TRP NE1 HE1 sing N N 404 TRP CE2 CZ2 sing Y N 405 TRP CE3 CZ3 doub Y N 406 TRP CE3 HE3 sing N N 407 TRP CZ2 CH2 doub Y N 408 TRP CZ2 HZ2 sing N N 409 TRP CZ3 CH2 sing Y N 410 TRP CZ3 HZ3 sing N N 411 TRP CH2 HH2 sing N N 412 TRP OXT HXT sing N N 413 TYR N CA sing N N 414 TYR N H sing N N 415 TYR N H2 sing N N 416 TYR CA C sing N N 417 TYR CA CB sing N N 418 TYR CA HA sing N N 419 TYR C O doub N N 420 TYR C OXT sing N N 421 TYR CB CG sing N N 422 TYR CB HB2 sing N N 423 TYR CB HB3 sing N N 424 TYR CG CD1 doub Y N 425 TYR CG CD2 sing Y N 426 TYR CD1 CE1 sing Y N 427 TYR CD1 HD1 sing N N 428 TYR CD2 CE2 doub Y N 429 TYR CD2 HD2 sing N N 430 TYR CE1 CZ doub Y N 431 TYR CE1 HE1 sing N N 432 TYR CE2 CZ sing Y N 433 TYR CE2 HE2 sing N N 434 TYR CZ OH sing N N 435 TYR OH HH sing N N 436 TYR OXT HXT sing N N 437 VAL N CA sing N N 438 VAL N H sing N N 439 VAL N H2 sing N N 440 VAL CA C sing N N 441 VAL CA CB sing N N 442 VAL CA HA sing N N 443 VAL C O doub N N 444 VAL C OXT sing N N 445 VAL CB CG1 sing N N 446 VAL CB CG2 sing N N 447 VAL CB HB sing N N 448 VAL CG1 HG11 sing N N 449 VAL CG1 HG12 sing N N 450 VAL CG1 HG13 sing N N 451 VAL CG2 HG21 sing N N 452 VAL CG2 HG22 sing N N 453 VAL CG2 HG23 sing N N 454 VAL OXT HXT sing N N 455 # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id OE2 _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id GLU _pdbx_struct_conn_angle.ptnr1_label_seq_id 71 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id GLU _pdbx_struct_conn_angle.ptnr1_auth_seq_id 762 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id MG _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id D _pdbx_struct_conn_angle.ptnr2_label_comp_id MG _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id MG _pdbx_struct_conn_angle.ptnr2_auth_seq_id 1103 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id OD1 _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id A _pdbx_struct_conn_angle.ptnr3_label_comp_id ASP _pdbx_struct_conn_angle.ptnr3_label_seq_id 168 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id ASP _pdbx_struct_conn_angle.ptnr3_auth_seq_id 859 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 153.2 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PG4 1 1101 1 PG4 PG4 A . C 2 PG4 1 1102 2 PG4 PG4 A . D 3 MG 1 1103 5 MG MG A . E 4 ANP 1 1104 1101 ANP ANP A . F 5 HOH 1 1201 7 HOH HOH A . F 5 HOH 2 1202 18 HOH HOH A . F 5 HOH 3 1203 3 HOH HOH A . F 5 HOH 4 1204 22 HOH HOH A . F 5 HOH 5 1205 2 HOH HOH A . F 5 HOH 6 1206 6 HOH HOH A . F 5 HOH 7 1207 8 HOH HOH A . F 5 HOH 8 1208 5 HOH HOH A . F 5 HOH 9 1209 20 HOH HOH A . F 5 HOH 10 1210 11 HOH HOH A . F 5 HOH 11 1211 10 HOH HOH A . F 5 HOH 12 1212 1 HOH HOH A . F 5 HOH 13 1213 15 HOH HOH A . F 5 HOH 14 1214 12 HOH HOH A . F 5 HOH 15 1215 25 HOH HOH A . F 5 HOH 16 1216 26 HOH HOH A . F 5 HOH 17 1217 13 HOH HOH A . F 5 HOH 18 1218 4 HOH HOH A . F 5 HOH 19 1219 14 HOH HOH A . F 5 HOH 20 1220 9 HOH HOH A . F 5 HOH 21 1221 16 HOH HOH A . F 5 HOH 22 1222 17 HOH HOH A . F 5 HOH 23 1223 19 HOH HOH A . # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 695 ? ? -111.67 60.16 2 1 ALA A 750 ? ? 70.25 135.85 3 1 LEU A 786 ? ? -97.88 51.69 4 1 ASN A 812 ? ? -146.96 15.27 5 1 ARG A 840 ? ? 69.43 -1.39 6 1 ASP A 841 ? ? -143.61 37.44 7 1 ASP A 859 ? ? 62.30 80.03 8 1 GLU A 869 ? ? -117.28 -169.41 9 1 ASP A 1007 ? ? -88.86 30.70 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 692 ? A GLY 1 2 1 Y 1 A SER 693 ? A SER 2 3 1 Y 1 A GLY 721 ? A GLY 30 4 1 Y 1 A ALA 722 ? A ALA 31 5 1 Y 1 A PHE 723 ? A PHE 32 6 1 Y 1 A LYS 871 ? A LYS 180 7 1 Y 1 A GLU 872 ? A GLU 181 8 1 Y 1 A TYR 873 ? A TYR 182 9 1 Y 1 A HIS 874 ? A HIS 183 10 1 Y 1 A ALA 875 ? A ALA 184 11 1 Y 1 A GLU 876 ? A GLU 185 12 1 Y 1 A GLY 877 ? A GLY 186 13 1 Y 1 A GLY 878 ? A GLY 187 14 1 Y 1 A LYS 879 ? A LYS 188 15 1 Y 1 A PRO 994 ? A PRO 303 16 1 Y 1 A SER 995 ? A SER 304 17 1 Y 1 A PRO 996 ? A PRO 305 18 1 Y 1 A THR 997 ? A THR 306 19 1 Y 1 A ASP 998 ? A ASP 307 20 1 Y 1 A SER 999 ? A SER 308 21 1 Y 1 A ASN 1000 ? A ASN 309 22 1 Y 1 A PHE 1001 ? A PHE 310 23 1 Y 1 A TYR 1002 ? A TYR 311 24 1 Y 1 A ILE 1022 ? A ILE 331 25 1 Y 1 A PRO 1023 ? A PRO 332 26 1 Y 1 A GLN 1024 ? A GLN 333 27 1 Y 1 A GLN 1025 ? A GLN 334 28 1 Y 1 A GLY 1026 ? A GLY 335 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? #