data_8HDL # _entry.id 8HDL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.376 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8HDL pdb_00008hdl 10.2210/pdb8hdl/pdb WWPDB D_1300033425 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8HDL _pdbx_database_status.recvd_initial_deposition_date 2022-11-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Zhao, H.F.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Int J Mol Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1422-0067 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 24 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Exploring AlphaFold2's Performance on Predicting Amino Acid Side-Chain Conformations and Its Utility in Crystal Structure Determination of B318L Protein. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/ijms24032740 _citation.pdbx_database_id_PubMed 36769074 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhao, H.' 1 ? primary 'Zhang, H.' 2 ? primary 'She, Z.' 3 ? primary 'Gao, Z.' 4 ? primary 'Wang, Q.' 5 ? primary 'Geng, Z.' 6 ? primary 'Dong, Y.' 7 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 8HDL _cell.details ? _cell.formula_units_Z ? _cell.length_a 56.130 _cell.length_a_esd ? _cell.length_b 56.130 _cell.length_b_esd ? _cell.length_c 376.690 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8HDL _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Trans-prenyltransferase _entity.formula_weight 32329.084 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.5.1.-,2.5.1.1,2.5.1.29,2.5.1.10 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;(2E,6E)-farnesyl diphosphate synthase,Dimethylallyltranstransferase,Farnesyl diphosphate synthase,Farnesyltranstransferase,Geranyltranstransferase,Polyprenyl-diphosphate synthase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;APRSVALFHGIHPLNPKNYKTFSKEFETILNNAIEDGDFKGQLTEPCSYALRGGKYIRPIILMEIVRACQLQHSFGAPIY PAEAALAVEYFHVASLIIDDMPSFDNDVKRRNKDTVWARFGVAKAQMSALALTMQGFQNICRQIDWIKEHCPRFPDPNQL GALLCTFVSHSLNSAGSGQLVDTPEKTIPFFKIAFIMGWVLGTGTIEDIGMIERAAHCFGHAFQLADDIKDHDTDTGWNY AKIHGKQKTFDDVAQSLQECKKILHGKKIFTSIWNEIFQKVINVALGT ; _entity_poly.pdbx_seq_one_letter_code_can ;APRSVALFHGIHPLNPKNYKTFSKEFETILNNAIEDGDFKGQLTEPCSYALRGGKYIRPIILMEIVRACQLQHSFGAPIY PAEAALAVEYFHVASLIIDDMPSFDNDVKRRNKDTVWARFGVAKAQMSALALTMQGFQNICRQIDWIKEHCPRFPDPNQL GALLCTFVSHSLNSAGSGQLVDTPEKTIPFFKIAFIMGWVLGTGTIEDIGMIERAAHCFGHAFQLADDIKDHDTDTGWNY AKIHGKQKTFDDVAQSLQECKKILHGKKIFTSIWNEIFQKVINVALGT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PRO n 1 3 ARG n 1 4 SER n 1 5 VAL n 1 6 ALA n 1 7 LEU n 1 8 PHE n 1 9 HIS n 1 10 GLY n 1 11 ILE n 1 12 HIS n 1 13 PRO n 1 14 LEU n 1 15 ASN n 1 16 PRO n 1 17 LYS n 1 18 ASN n 1 19 TYR n 1 20 LYS n 1 21 THR n 1 22 PHE n 1 23 SER n 1 24 LYS n 1 25 GLU n 1 26 PHE n 1 27 GLU n 1 28 THR n 1 29 ILE n 1 30 LEU n 1 31 ASN n 1 32 ASN n 1 33 ALA n 1 34 ILE n 1 35 GLU n 1 36 ASP n 1 37 GLY n 1 38 ASP n 1 39 PHE n 1 40 LYS n 1 41 GLY n 1 42 GLN n 1 43 LEU n 1 44 THR n 1 45 GLU n 1 46 PRO n 1 47 CYS n 1 48 SER n 1 49 TYR n 1 50 ALA n 1 51 LEU n 1 52 ARG n 1 53 GLY n 1 54 GLY n 1 55 LYS n 1 56 TYR n 1 57 ILE n 1 58 ARG n 1 59 PRO n 1 60 ILE n 1 61 ILE n 1 62 LEU n 1 63 MET n 1 64 GLU n 1 65 ILE n 1 66 VAL n 1 67 ARG n 1 68 ALA n 1 69 CYS n 1 70 GLN n 1 71 LEU n 1 72 GLN n 1 73 HIS n 1 74 SER n 1 75 PHE n 1 76 GLY n 1 77 ALA n 1 78 PRO n 1 79 ILE n 1 80 TYR n 1 81 PRO n 1 82 ALA n 1 83 GLU n 1 84 ALA n 1 85 ALA n 1 86 LEU n 1 87 ALA n 1 88 VAL n 1 89 GLU n 1 90 TYR n 1 91 PHE n 1 92 HIS n 1 93 VAL n 1 94 ALA n 1 95 SER n 1 96 LEU n 1 97 ILE n 1 98 ILE n 1 99 ASP n 1 100 ASP n 1 101 MET n 1 102 PRO n 1 103 SER n 1 104 PHE n 1 105 ASP n 1 106 ASN n 1 107 ASP n 1 108 VAL n 1 109 LYS n 1 110 ARG n 1 111 ARG n 1 112 ASN n 1 113 LYS n 1 114 ASP n 1 115 THR n 1 116 VAL n 1 117 TRP n 1 118 ALA n 1 119 ARG n 1 120 PHE n 1 121 GLY n 1 122 VAL n 1 123 ALA n 1 124 LYS n 1 125 ALA n 1 126 GLN n 1 127 MET n 1 128 SER n 1 129 ALA n 1 130 LEU n 1 131 ALA n 1 132 LEU n 1 133 THR n 1 134 MET n 1 135 GLN n 1 136 GLY n 1 137 PHE n 1 138 GLN n 1 139 ASN n 1 140 ILE n 1 141 CYS n 1 142 ARG n 1 143 GLN n 1 144 ILE n 1 145 ASP n 1 146 TRP n 1 147 ILE n 1 148 LYS n 1 149 GLU n 1 150 HIS n 1 151 CYS n 1 152 PRO n 1 153 ARG n 1 154 PHE n 1 155 PRO n 1 156 ASP n 1 157 PRO n 1 158 ASN n 1 159 GLN n 1 160 LEU n 1 161 GLY n 1 162 ALA n 1 163 LEU n 1 164 LEU n 1 165 CYS n 1 166 THR n 1 167 PHE n 1 168 VAL n 1 169 SER n 1 170 HIS n 1 171 SER n 1 172 LEU n 1 173 ASN n 1 174 SER n 1 175 ALA n 1 176 GLY n 1 177 SER n 1 178 GLY n 1 179 GLN n 1 180 LEU n 1 181 VAL n 1 182 ASP n 1 183 THR n 1 184 PRO n 1 185 GLU n 1 186 LYS n 1 187 THR n 1 188 ILE n 1 189 PRO n 1 190 PHE n 1 191 PHE n 1 192 LYS n 1 193 ILE n 1 194 ALA n 1 195 PHE n 1 196 ILE n 1 197 MET n 1 198 GLY n 1 199 TRP n 1 200 VAL n 1 201 LEU n 1 202 GLY n 1 203 THR n 1 204 GLY n 1 205 THR n 1 206 ILE n 1 207 GLU n 1 208 ASP n 1 209 ILE n 1 210 GLY n 1 211 MET n 1 212 ILE n 1 213 GLU n 1 214 ARG n 1 215 ALA n 1 216 ALA n 1 217 HIS n 1 218 CYS n 1 219 PHE n 1 220 GLY n 1 221 HIS n 1 222 ALA n 1 223 PHE n 1 224 GLN n 1 225 LEU n 1 226 ALA n 1 227 ASP n 1 228 ASP n 1 229 ILE n 1 230 LYS n 1 231 ASP n 1 232 HIS n 1 233 ASP n 1 234 THR n 1 235 ASP n 1 236 THR n 1 237 GLY n 1 238 TRP n 1 239 ASN n 1 240 TYR n 1 241 ALA n 1 242 LYS n 1 243 ILE n 1 244 HIS n 1 245 GLY n 1 246 LYS n 1 247 GLN n 1 248 LYS n 1 249 THR n 1 250 PHE n 1 251 ASP n 1 252 ASP n 1 253 VAL n 1 254 ALA n 1 255 GLN n 1 256 SER n 1 257 LEU n 1 258 GLN n 1 259 GLU n 1 260 CYS n 1 261 LYS n 1 262 LYS n 1 263 ILE n 1 264 LEU n 1 265 HIS n 1 266 GLY n 1 267 LYS n 1 268 LYS n 1 269 ILE n 1 270 PHE n 1 271 THR n 1 272 SER n 1 273 ILE n 1 274 TRP n 1 275 ASN n 1 276 GLU n 1 277 ILE n 1 278 PHE n 1 279 GLN n 1 280 LYS n 1 281 VAL n 1 282 ILE n 1 283 ASN n 1 284 VAL n 1 285 ALA n 1 286 LEU n 1 287 GLY n 1 288 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 288 _entity_src_gen.gene_src_common_name 'Ba71V, ASFV' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Ba71V-074, B318L' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'African swine fever virus (strain Badajoz 1971 Vero-adapted)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10498 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TPRT_ASFB7 _struct_ref.pdbx_db_accession Q65164 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;APRSVALFHGIHPLNPKNYKTFSKEFETILNNAIEDGDFKGQLTEPCSYALRGGKYIRPIILMEIVRACQLQHSFGAPIY PAEAALAVEYFHVASLIIDDMPSFDNDVKRRNKDTVWARFGVAKAQMSALALTMQGFQNICRQIDWIKEHCPRFPDPNQL GALLCTFVSHSLNSAGSGQLVDTPEKTIPFFKIAFIMGWVLGTGTIEDIGMIERAAHCFGHAFQLADDIKDHDTDTGWNY AKIHGKQKTFDDVAQSLQECKKILHGKKIFTSIWNEIFQKVINVALGT ; _struct_ref.pdbx_align_begin 31 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8HDL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 288 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q65164 _struct_ref_seq.db_align_beg 31 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 318 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 31 _struct_ref_seq.pdbx_auth_seq_align_end 318 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8HDL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.65 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.57 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES pH 7.5, 4.3 M NaCl' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-03-07 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL10U2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL10U2 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8HDL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.198 _reflns.d_resolution_low 48.210 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6579 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 31.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.297 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.20 _reflns_shell.d_res_low 3.28 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 472 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.718 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8HDL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.198 _refine.ls_d_res_low 48.210 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6578 _refine.ls_number_reflns_R_free 658 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.76 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2497 _refine.ls_R_factor_R_free 0.2838 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2458 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model AlphaFold2 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.34 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.47 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.198 _refine_hist.d_res_low 48.210 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2058 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2058 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 2108 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.421 ? 2848 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 26.467 ? 761 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.068 ? 312 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.011 ? 364 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.1982 3.4451 . . 125 1133 100.00 . . . . 0.3216 . . . . . . . . . . . 0.3805 'X-RAY DIFFRACTION' 3.4451 3.7916 . . 126 1133 100.00 . . . . 0.2776 . . . . . . . . . . . 0.3308 'X-RAY DIFFRACTION' 3.7916 4.3400 . . 130 1159 100.00 . . . . 0.2396 . . . . . . . . . . . 0.2603 'X-RAY DIFFRACTION' 4.3400 5.4667 . . 131 1190 100.00 . . . . 0.2342 . . . . . . . . . . . 0.2765 'X-RAY DIFFRACTION' 5.4667 48.210 . . 146 1305 99.00 . . . . 0.2336 . . . . . . . . . . . 0.2688 # _struct.entry_id 8HDL _struct.title 'Crystal structure of ASFV trans geranylgeranyl diphosphate synthase B318L' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8HDL _struct_keywords.text 'ASFV, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 18 ? ASP A 36 ? ASN A 48 ASP A 66 1 ? 19 HELX_P HELX_P2 AA2 LEU A 43 ? ARG A 52 ? LEU A 73 ARG A 82 1 ? 10 HELX_P HELX_P3 AA3 TYR A 56 ? HIS A 73 ? TYR A 86 HIS A 103 1 ? 18 HELX_P HELX_P4 AA4 ALA A 82 ? MET A 101 ? ALA A 112 MET A 131 1 ? 20 HELX_P HELX_P5 AA5 THR A 115 ? GLY A 121 ? THR A 145 GLY A 151 1 ? 7 HELX_P HELX_P6 AA6 GLY A 121 ? CYS A 151 ? GLY A 151 CYS A 181 1 ? 31 HELX_P HELX_P7 AA7 ASP A 156 ? SER A 174 ? ASP A 186 SER A 204 1 ? 19 HELX_P HELX_P8 AA8 THR A 187 ? THR A 203 ? THR A 217 THR A 233 1 ? 17 HELX_P HELX_P9 AA9 ASP A 208 ? LYS A 230 ? ASP A 238 LYS A 260 1 ? 23 HELX_P HELX_P10 AB1 LYS A 246 ? LYS A 267 ? LYS A 276 LYS A 297 1 ? 22 HELX_P HELX_P11 AB2 SER A 272 ? LEU A 286 ? SER A 302 LEU A 316 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 8HDL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017816 _atom_sites.fract_transf_matrix[1][2] 0.010286 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020572 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.002655 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 31 31 ALA ALA A . n A 1 2 PRO 2 32 32 PRO PRO A . n A 1 3 ARG 3 33 33 ARG ARG A . n A 1 4 SER 4 34 34 SER SER A . n A 1 5 VAL 5 35 35 VAL VAL A . n A 1 6 ALA 6 36 36 ALA ALA A . n A 1 7 LEU 7 37 37 LEU LEU A . n A 1 8 PHE 8 38 38 PHE PHE A . n A 1 9 HIS 9 39 39 HIS HIS A . n A 1 10 GLY 10 40 40 GLY GLY A . n A 1 11 ILE 11 41 41 ILE ILE A . n A 1 12 HIS 12 42 42 HIS HIS A . n A 1 13 PRO 13 43 43 PRO PRO A . n A 1 14 LEU 14 44 44 LEU LEU A . n A 1 15 ASN 15 45 45 ASN ASN A . n A 1 16 PRO 16 46 46 PRO PRO A . n A 1 17 LYS 17 47 47 LYS LYS A . n A 1 18 ASN 18 48 48 ASN ASN A . n A 1 19 TYR 19 49 49 TYR TYR A . n A 1 20 LYS 20 50 50 LYS LYS A . n A 1 21 THR 21 51 51 THR THR A . n A 1 22 PHE 22 52 52 PHE PHE A . n A 1 23 SER 23 53 53 SER SER A . n A 1 24 LYS 24 54 54 LYS LYS A . n A 1 25 GLU 25 55 55 GLU GLU A . n A 1 26 PHE 26 56 56 PHE PHE A . n A 1 27 GLU 27 57 57 GLU GLU A . n A 1 28 THR 28 58 58 THR THR A . n A 1 29 ILE 29 59 59 ILE ILE A . n A 1 30 LEU 30 60 60 LEU LEU A . n A 1 31 ASN 31 61 61 ASN ASN A . n A 1 32 ASN 32 62 62 ASN ASN A . n A 1 33 ALA 33 63 63 ALA ALA A . n A 1 34 ILE 34 64 64 ILE ILE A . n A 1 35 GLU 35 65 65 GLU GLU A . n A 1 36 ASP 36 66 66 ASP ASP A . n A 1 37 GLY 37 67 67 GLY GLY A . n A 1 38 ASP 38 68 68 ASP ASP A . n A 1 39 PHE 39 69 69 PHE PHE A . n A 1 40 LYS 40 70 70 LYS LYS A . n A 1 41 GLY 41 71 71 GLY GLY A . n A 1 42 GLN 42 72 72 GLN GLN A . n A 1 43 LEU 43 73 73 LEU LEU A . n A 1 44 THR 44 74 74 THR THR A . n A 1 45 GLU 45 75 75 GLU GLU A . n A 1 46 PRO 46 76 76 PRO PRO A . n A 1 47 CYS 47 77 77 CYS CYS A . n A 1 48 SER 48 78 78 SER SER A . n A 1 49 TYR 49 79 79 TYR TYR A . n A 1 50 ALA 50 80 80 ALA ALA A . n A 1 51 LEU 51 81 81 LEU LEU A . n A 1 52 ARG 52 82 82 ARG ARG A . n A 1 53 GLY 53 83 83 GLY GLY A . n A 1 54 GLY 54 84 84 GLY GLY A . n A 1 55 LYS 55 85 85 LYS LYS A . n A 1 56 TYR 56 86 86 TYR TYR A . n A 1 57 ILE 57 87 87 ILE ILE A . n A 1 58 ARG 58 88 88 ARG ARG A . n A 1 59 PRO 59 89 89 PRO PRO A . n A 1 60 ILE 60 90 90 ILE ILE A . n A 1 61 ILE 61 91 91 ILE ILE A . n A 1 62 LEU 62 92 92 LEU LEU A . n A 1 63 MET 63 93 93 MET MET A . n A 1 64 GLU 64 94 94 GLU GLU A . n A 1 65 ILE 65 95 95 ILE ILE A . n A 1 66 VAL 66 96 96 VAL VAL A . n A 1 67 ARG 67 97 97 ARG ARG A . n A 1 68 ALA 68 98 98 ALA ALA A . n A 1 69 CYS 69 99 99 CYS CYS A . n A 1 70 GLN 70 100 100 GLN GLN A . n A 1 71 LEU 71 101 101 LEU LEU A . n A 1 72 GLN 72 102 102 GLN GLN A . n A 1 73 HIS 73 103 103 HIS HIS A . n A 1 74 SER 74 104 104 SER SER A . n A 1 75 PHE 75 105 105 PHE PHE A . n A 1 76 GLY 76 106 106 GLY GLY A . n A 1 77 ALA 77 107 107 ALA ALA A . n A 1 78 PRO 78 108 108 PRO PRO A . n A 1 79 ILE 79 109 109 ILE ILE A . n A 1 80 TYR 80 110 110 TYR TYR A . n A 1 81 PRO 81 111 111 PRO PRO A . n A 1 82 ALA 82 112 112 ALA ALA A . n A 1 83 GLU 83 113 113 GLU GLU A . n A 1 84 ALA 84 114 114 ALA ALA A . n A 1 85 ALA 85 115 115 ALA ALA A . n A 1 86 LEU 86 116 116 LEU LEU A . n A 1 87 ALA 87 117 117 ALA ALA A . n A 1 88 VAL 88 118 118 VAL VAL A . n A 1 89 GLU 89 119 119 GLU GLU A . n A 1 90 TYR 90 120 120 TYR TYR A . n A 1 91 PHE 91 121 121 PHE PHE A . n A 1 92 HIS 92 122 122 HIS HIS A . n A 1 93 VAL 93 123 123 VAL VAL A . n A 1 94 ALA 94 124 124 ALA ALA A . n A 1 95 SER 95 125 125 SER SER A . n A 1 96 LEU 96 126 126 LEU LEU A . n A 1 97 ILE 97 127 127 ILE ILE A . n A 1 98 ILE 98 128 128 ILE ILE A . n A 1 99 ASP 99 129 129 ASP ASP A . n A 1 100 ASP 100 130 130 ASP ASP A . n A 1 101 MET 101 131 131 MET MET A . n A 1 102 PRO 102 132 132 PRO PRO A . n A 1 103 SER 103 133 ? ? ? A . n A 1 104 PHE 104 134 ? ? ? A . n A 1 105 ASP 105 135 ? ? ? A . n A 1 106 ASN 106 136 ? ? ? A . n A 1 107 ASP 107 137 ? ? ? A . n A 1 108 VAL 108 138 ? ? ? A . n A 1 109 LYS 109 139 ? ? ? A . n A 1 110 ARG 110 140 ? ? ? A . n A 1 111 ARG 111 141 ? ? ? A . n A 1 112 ASN 112 142 ? ? ? A . n A 1 113 LYS 113 143 ? ? ? A . n A 1 114 ASP 114 144 144 ASP ASP A . n A 1 115 THR 115 145 145 THR THR A . n A 1 116 VAL 116 146 146 VAL VAL A . n A 1 117 TRP 117 147 147 TRP TRP A . n A 1 118 ALA 118 148 148 ALA ALA A . n A 1 119 ARG 119 149 149 ARG ARG A . n A 1 120 PHE 120 150 150 PHE PHE A . n A 1 121 GLY 121 151 151 GLY GLY A . n A 1 122 VAL 122 152 152 VAL VAL A . n A 1 123 ALA 123 153 153 ALA ALA A . n A 1 124 LYS 124 154 154 LYS LYS A . n A 1 125 ALA 125 155 155 ALA ALA A . n A 1 126 GLN 126 156 156 GLN GLN A . n A 1 127 MET 127 157 157 MET MET A . n A 1 128 SER 128 158 158 SER SER A . n A 1 129 ALA 129 159 159 ALA ALA A . n A 1 130 LEU 130 160 160 LEU LEU A . n A 1 131 ALA 131 161 161 ALA ALA A . n A 1 132 LEU 132 162 162 LEU LEU A . n A 1 133 THR 133 163 163 THR THR A . n A 1 134 MET 134 164 164 MET MET A . n A 1 135 GLN 135 165 165 GLN GLN A . n A 1 136 GLY 136 166 166 GLY GLY A . n A 1 137 PHE 137 167 167 PHE PHE A . n A 1 138 GLN 138 168 168 GLN GLN A . n A 1 139 ASN 139 169 169 ASN ASN A . n A 1 140 ILE 140 170 170 ILE ILE A . n A 1 141 CYS 141 171 171 CYS CYS A . n A 1 142 ARG 142 172 172 ARG ARG A . n A 1 143 GLN 143 173 173 GLN GLN A . n A 1 144 ILE 144 174 174 ILE ILE A . n A 1 145 ASP 145 175 175 ASP ASP A . n A 1 146 TRP 146 176 176 TRP TRP A . n A 1 147 ILE 147 177 177 ILE ILE A . n A 1 148 LYS 148 178 178 LYS LYS A . n A 1 149 GLU 149 179 179 GLU GLU A . n A 1 150 HIS 150 180 180 HIS HIS A . n A 1 151 CYS 151 181 181 CYS CYS A . n A 1 152 PRO 152 182 182 PRO PRO A . n A 1 153 ARG 153 183 183 ARG ARG A . n A 1 154 PHE 154 184 184 PHE PHE A . n A 1 155 PRO 155 185 185 PRO PRO A . n A 1 156 ASP 156 186 186 ASP ASP A . n A 1 157 PRO 157 187 187 PRO PRO A . n A 1 158 ASN 158 188 188 ASN ASN A . n A 1 159 GLN 159 189 189 GLN GLN A . n A 1 160 LEU 160 190 190 LEU LEU A . n A 1 161 GLY 161 191 191 GLY GLY A . n A 1 162 ALA 162 192 192 ALA ALA A . n A 1 163 LEU 163 193 193 LEU LEU A . n A 1 164 LEU 164 194 194 LEU LEU A . n A 1 165 CYS 165 195 195 CYS CYS A . n A 1 166 THR 166 196 196 THR THR A . n A 1 167 PHE 167 197 197 PHE PHE A . n A 1 168 VAL 168 198 198 VAL VAL A . n A 1 169 SER 169 199 199 SER SER A . n A 1 170 HIS 170 200 200 HIS HIS A . n A 1 171 SER 171 201 201 SER SER A . n A 1 172 LEU 172 202 202 LEU LEU A . n A 1 173 ASN 173 203 203 ASN ASN A . n A 1 174 SER 174 204 204 SER SER A . n A 1 175 ALA 175 205 205 ALA ALA A . n A 1 176 GLY 176 206 206 GLY GLY A . n A 1 177 SER 177 207 ? ? ? A . n A 1 178 GLY 178 208 ? ? ? A . n A 1 179 GLN 179 209 ? ? ? A . n A 1 180 LEU 180 210 ? ? ? A . n A 1 181 VAL 181 211 ? ? ? A . n A 1 182 ASP 182 212 ? ? ? A . n A 1 183 THR 183 213 ? ? ? A . n A 1 184 PRO 184 214 ? ? ? A . n A 1 185 GLU 185 215 215 GLU GLU A . n A 1 186 LYS 186 216 216 LYS LYS A . n A 1 187 THR 187 217 217 THR THR A . n A 1 188 ILE 188 218 218 ILE ILE A . n A 1 189 PRO 189 219 219 PRO PRO A . n A 1 190 PHE 190 220 220 PHE PHE A . n A 1 191 PHE 191 221 221 PHE PHE A . n A 1 192 LYS 192 222 222 LYS LYS A . n A 1 193 ILE 193 223 223 ILE ILE A . n A 1 194 ALA 194 224 224 ALA ALA A . n A 1 195 PHE 195 225 225 PHE PHE A . n A 1 196 ILE 196 226 226 ILE ILE A . n A 1 197 MET 197 227 227 MET MET A . n A 1 198 GLY 198 228 228 GLY GLY A . n A 1 199 TRP 199 229 229 TRP TRP A . n A 1 200 VAL 200 230 230 VAL VAL A . n A 1 201 LEU 201 231 231 LEU LEU A . n A 1 202 GLY 202 232 232 GLY GLY A . n A 1 203 THR 203 233 233 THR THR A . n A 1 204 GLY 204 234 234 GLY GLY A . n A 1 205 THR 205 235 235 THR THR A . n A 1 206 ILE 206 236 236 ILE ILE A . n A 1 207 GLU 207 237 237 GLU GLU A . n A 1 208 ASP 208 238 238 ASP ASP A . n A 1 209 ILE 209 239 239 ILE ILE A . n A 1 210 GLY 210 240 240 GLY GLY A . n A 1 211 MET 211 241 241 MET MET A . n A 1 212 ILE 212 242 242 ILE ILE A . n A 1 213 GLU 213 243 243 GLU GLU A . n A 1 214 ARG 214 244 244 ARG ARG A . n A 1 215 ALA 215 245 245 ALA ALA A . n A 1 216 ALA 216 246 246 ALA ALA A . n A 1 217 HIS 217 247 247 HIS HIS A . n A 1 218 CYS 218 248 248 CYS CYS A . n A 1 219 PHE 219 249 249 PHE PHE A . n A 1 220 GLY 220 250 250 GLY GLY A . n A 1 221 HIS 221 251 251 HIS HIS A . n A 1 222 ALA 222 252 252 ALA ALA A . n A 1 223 PHE 223 253 253 PHE PHE A . n A 1 224 GLN 224 254 254 GLN GLN A . n A 1 225 LEU 225 255 255 LEU LEU A . n A 1 226 ALA 226 256 256 ALA ALA A . n A 1 227 ASP 227 257 257 ASP ASP A . n A 1 228 ASP 228 258 258 ASP ASP A . n A 1 229 ILE 229 259 259 ILE ILE A . n A 1 230 LYS 230 260 260 LYS LYS A . n A 1 231 ASP 231 261 261 ASP ASP A . n A 1 232 HIS 232 262 ? ? ? A . n A 1 233 ASP 233 263 ? ? ? A . n A 1 234 THR 234 264 ? ? ? A . n A 1 235 ASP 235 265 ? ? ? A . n A 1 236 THR 236 266 ? ? ? A . n A 1 237 GLY 237 267 ? ? ? A . n A 1 238 TRP 238 268 ? ? ? A . n A 1 239 ASN 239 269 ? ? ? A . n A 1 240 TYR 240 270 270 TYR TYR A . n A 1 241 ALA 241 271 271 ALA ALA A . n A 1 242 LYS 242 272 272 LYS LYS A . n A 1 243 ILE 243 273 273 ILE ILE A . n A 1 244 HIS 244 274 274 HIS HIS A . n A 1 245 GLY 245 275 275 GLY GLY A . n A 1 246 LYS 246 276 276 LYS LYS A . n A 1 247 GLN 247 277 277 GLN GLN A . n A 1 248 LYS 248 278 278 LYS LYS A . n A 1 249 THR 249 279 279 THR THR A . n A 1 250 PHE 250 280 280 PHE PHE A . n A 1 251 ASP 251 281 281 ASP ASP A . n A 1 252 ASP 252 282 282 ASP ASP A . n A 1 253 VAL 253 283 283 VAL VAL A . n A 1 254 ALA 254 284 284 ALA ALA A . n A 1 255 GLN 255 285 285 GLN GLN A . n A 1 256 SER 256 286 286 SER SER A . n A 1 257 LEU 257 287 287 LEU LEU A . n A 1 258 GLN 258 288 288 GLN GLN A . n A 1 259 GLU 259 289 289 GLU GLU A . n A 1 260 CYS 260 290 290 CYS CYS A . n A 1 261 LYS 261 291 291 LYS LYS A . n A 1 262 LYS 262 292 292 LYS LYS A . n A 1 263 ILE 263 293 293 ILE ILE A . n A 1 264 LEU 264 294 294 LEU LEU A . n A 1 265 HIS 265 295 295 HIS HIS A . n A 1 266 GLY 266 296 296 GLY GLY A . n A 1 267 LYS 267 297 297 LYS LYS A . n A 1 268 LYS 268 298 298 LYS LYS A . n A 1 269 ILE 269 299 299 ILE ILE A . n A 1 270 PHE 270 300 300 PHE PHE A . n A 1 271 THR 271 301 301 THR THR A . n A 1 272 SER 272 302 302 SER SER A . n A 1 273 ILE 273 303 303 ILE ILE A . n A 1 274 TRP 274 304 304 TRP TRP A . n A 1 275 ASN 275 305 305 ASN ASN A . n A 1 276 GLU 276 306 306 GLU GLU A . n A 1 277 ILE 277 307 307 ILE ILE A . n A 1 278 PHE 278 308 308 PHE PHE A . n A 1 279 GLN 279 309 309 GLN GLN A . n A 1 280 LYS 280 310 310 LYS LYS A . n A 1 281 VAL 281 311 311 VAL VAL A . n A 1 282 ILE 282 312 312 ILE ILE A . n A 1 283 ASN 283 313 313 ASN ASN A . n A 1 284 VAL 284 314 314 VAL VAL A . n A 1 285 ALA 285 315 315 ALA ALA A . n A 1 286 LEU 286 316 316 LEU LEU A . n A 1 287 GLY 287 317 317 GLY GLY A . n A 1 288 THR 288 318 318 THR THR A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email zhaohaifan@ihep.ac.cn _pdbx_contact_author.name_first HaiFan _pdbx_contact_author.name_last Zhao _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-8926-7729 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-09-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 11.0849 _pdbx_refine_tls.origin_y 14.7343 _pdbx_refine_tls.origin_z -14.2780 _pdbx_refine_tls.T[1][1] 0.6118 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0378 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0014 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.7406 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.1615 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.7292 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.3257 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.0158 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.4477 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.5572 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.1040 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 2.2252 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0628 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.3016 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.1360 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.1575 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0296 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0399 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.1149 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.2272 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0357 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15.2 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LYS _pdbx_validate_rmsd_angle.auth_seq_id_1 272 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LYS _pdbx_validate_rmsd_angle.auth_seq_id_2 272 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LYS _pdbx_validate_rmsd_angle.auth_seq_id_3 272 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 91.41 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation -19.59 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.70 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 34 ? ? -104.70 -155.50 2 1 LEU A 37 ? ? -130.57 -60.67 3 1 ASP A 66 ? ? -67.82 3.07 4 1 ASP A 68 ? ? -125.73 -51.73 5 1 PHE A 69 ? ? -109.54 66.99 6 1 ALA A 107 ? ? 74.08 111.66 7 1 ASP A 186 ? ? 28.71 71.46 8 1 SER A 204 ? ? -89.53 36.56 9 1 THR A 235 ? ? -100.07 -70.74 10 1 HIS A 274 ? ? 59.67 -143.93 11 1 LYS A 276 ? ? 37.06 50.93 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 HIS _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 274 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLY _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 275 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 148.33 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 133 ? A SER 103 2 1 Y 1 A PHE 134 ? A PHE 104 3 1 Y 1 A ASP 135 ? A ASP 105 4 1 Y 1 A ASN 136 ? A ASN 106 5 1 Y 1 A ASP 137 ? A ASP 107 6 1 Y 1 A VAL 138 ? A VAL 108 7 1 Y 1 A LYS 139 ? A LYS 109 8 1 Y 1 A ARG 140 ? A ARG 110 9 1 Y 1 A ARG 141 ? A ARG 111 10 1 Y 1 A ASN 142 ? A ASN 112 11 1 Y 1 A LYS 143 ? A LYS 113 12 1 Y 1 A SER 207 ? A SER 177 13 1 Y 1 A GLY 208 ? A GLY 178 14 1 Y 1 A GLN 209 ? A GLN 179 15 1 Y 1 A LEU 210 ? A LEU 180 16 1 Y 1 A VAL 211 ? A VAL 181 17 1 Y 1 A ASP 212 ? A ASP 182 18 1 Y 1 A THR 213 ? A THR 183 19 1 Y 1 A PRO 214 ? A PRO 184 20 1 Y 1 A HIS 262 ? A HIS 232 21 1 Y 1 A ASP 263 ? A ASP 233 22 1 Y 1 A THR 264 ? A THR 234 23 1 Y 1 A ASP 265 ? A ASP 235 24 1 Y 1 A THR 266 ? A THR 236 25 1 Y 1 A GLY 267 ? A GLY 237 26 1 Y 1 A TRP 268 ? A TRP 238 27 1 Y 1 A ASN 269 ? A ASN 239 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #