data_8HUM # _entry.id 8HUM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.376 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8HUM pdb_00008hum 10.2210/pdb8hum/pdb WWPDB D_1300031705 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8HUM _pdbx_database_status.recvd_initial_deposition_date 2022-12-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kamata, S.' 1 0000-0002-2400-6533 'Honda, A.' 2 ? 'Machida, Y.' 3 ? 'Uchii, K.' 4 ? 'Shiiyama, Y.' 5 ? 'Masuda, R.' 6 ? 'Oyama, T.' 7 0000-0002-3411-7608 'Ishii, I.' 8 0000-0002-5367-205X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Antioxidants _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2076-3921 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Functional and Structural Insights into the Human PPAR alpha / delta / gamma Targeting Preferences of Anti-NASH Investigational Drugs, Lanifibranor, Seladelpar, and Elafibranor. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/antiox12081523 _citation.pdbx_database_id_PubMed 37627519 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kamata, S.' 1 0000-0002-2400-6533 primary 'Honda, A.' 2 ? primary 'Ishikawa, R.' 3 ? primary 'Akahane, M.' 4 ? primary 'Fujita, A.' 5 ? primary 'Kaneko, C.' 6 ? primary 'Miyawaki, S.' 7 ? primary 'Habu, Y.' 8 ? primary 'Shiiyama, Y.' 9 ? primary 'Uchii, K.' 10 ? primary 'Machida, Y.' 11 ? primary 'Oyama, T.' 12 0000-0002-3411-7608 primary 'Ishii, I.' 13 0000-0002-5367-205X # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8HUM _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.862 _cell.length_a_esd ? _cell.length_b 63.728 _cell.length_b_esd ? _cell.length_c 123.484 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8HUM _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Isoform 1 of Peroxisome proliferator-activated receptor gamma' 31862.994 1 ? ? ? ? 2 polymer syn '15-meric peptide from Nuclear receptor coactivator 1' 1848.177 1 2.3.1.48 ? ? ? 3 non-polymer syn '4-[1-(1,3-benzothiazol-6-ylsulfonyl)-5-chloro-indol-2-yl]butanoic acid' 434.916 1 ? ? ? ? 4 water nat water 18.015 4 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PPAR-gamma # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSHMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVA IRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRK PFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQK MTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY ; ;GSHMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVA IRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRK PFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQK MTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY ; A ? 2 'polypeptide(L)' no no LTERHKILHRLLQEG LTERHKILHRLLQEG B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLN n 1 6 LEU n 1 7 ASN n 1 8 PRO n 1 9 GLU n 1 10 SER n 1 11 ALA n 1 12 ASP n 1 13 LEU n 1 14 ARG n 1 15 ALA n 1 16 LEU n 1 17 ALA n 1 18 LYS n 1 19 HIS n 1 20 LEU n 1 21 TYR n 1 22 ASP n 1 23 SER n 1 24 TYR n 1 25 ILE n 1 26 LYS n 1 27 SER n 1 28 PHE n 1 29 PRO n 1 30 LEU n 1 31 THR n 1 32 LYS n 1 33 ALA n 1 34 LYS n 1 35 ALA n 1 36 ARG n 1 37 ALA n 1 38 ILE n 1 39 LEU n 1 40 THR n 1 41 GLY n 1 42 LYS n 1 43 THR n 1 44 THR n 1 45 ASP n 1 46 LYS n 1 47 SER n 1 48 PRO n 1 49 PHE n 1 50 VAL n 1 51 ILE n 1 52 TYR n 1 53 ASP n 1 54 MET n 1 55 ASN n 1 56 SER n 1 57 LEU n 1 58 MET n 1 59 MET n 1 60 GLY n 1 61 GLU n 1 62 ASP n 1 63 LYS n 1 64 ILE n 1 65 LYS n 1 66 PHE n 1 67 LYS n 1 68 HIS n 1 69 ILE n 1 70 THR n 1 71 PRO n 1 72 LEU n 1 73 GLN n 1 74 GLU n 1 75 GLN n 1 76 SER n 1 77 LYS n 1 78 GLU n 1 79 VAL n 1 80 ALA n 1 81 ILE n 1 82 ARG n 1 83 ILE n 1 84 PHE n 1 85 GLN n 1 86 GLY n 1 87 CYS n 1 88 GLN n 1 89 PHE n 1 90 ARG n 1 91 SER n 1 92 VAL n 1 93 GLU n 1 94 ALA n 1 95 VAL n 1 96 GLN n 1 97 GLU n 1 98 ILE n 1 99 THR n 1 100 GLU n 1 101 TYR n 1 102 ALA n 1 103 LYS n 1 104 SER n 1 105 ILE n 1 106 PRO n 1 107 GLY n 1 108 PHE n 1 109 VAL n 1 110 ASN n 1 111 LEU n 1 112 ASP n 1 113 LEU n 1 114 ASN n 1 115 ASP n 1 116 GLN n 1 117 VAL n 1 118 THR n 1 119 LEU n 1 120 LEU n 1 121 LYS n 1 122 TYR n 1 123 GLY n 1 124 VAL n 1 125 HIS n 1 126 GLU n 1 127 ILE n 1 128 ILE n 1 129 TYR n 1 130 THR n 1 131 MET n 1 132 LEU n 1 133 ALA n 1 134 SER n 1 135 LEU n 1 136 MET n 1 137 ASN n 1 138 LYS n 1 139 ASP n 1 140 GLY n 1 141 VAL n 1 142 LEU n 1 143 ILE n 1 144 SER n 1 145 GLU n 1 146 GLY n 1 147 GLN n 1 148 GLY n 1 149 PHE n 1 150 MET n 1 151 THR n 1 152 ARG n 1 153 GLU n 1 154 PHE n 1 155 LEU n 1 156 LYS n 1 157 SER n 1 158 LEU n 1 159 ARG n 1 160 LYS n 1 161 PRO n 1 162 PHE n 1 163 GLY n 1 164 ASP n 1 165 PHE n 1 166 MET n 1 167 GLU n 1 168 PRO n 1 169 LYS n 1 170 PHE n 1 171 GLU n 1 172 PHE n 1 173 ALA n 1 174 VAL n 1 175 LYS n 1 176 PHE n 1 177 ASN n 1 178 ALA n 1 179 LEU n 1 180 GLU n 1 181 LEU n 1 182 ASP n 1 183 ASP n 1 184 SER n 1 185 ASP n 1 186 LEU n 1 187 ALA n 1 188 ILE n 1 189 PHE n 1 190 ILE n 1 191 ALA n 1 192 VAL n 1 193 ILE n 1 194 ILE n 1 195 LEU n 1 196 SER n 1 197 GLY n 1 198 ASP n 1 199 ARG n 1 200 PRO n 1 201 GLY n 1 202 LEU n 1 203 LEU n 1 204 ASN n 1 205 VAL n 1 206 LYS n 1 207 PRO n 1 208 ILE n 1 209 GLU n 1 210 ASP n 1 211 ILE n 1 212 GLN n 1 213 ASP n 1 214 ASN n 1 215 LEU n 1 216 LEU n 1 217 GLN n 1 218 ALA n 1 219 LEU n 1 220 GLU n 1 221 LEU n 1 222 GLN n 1 223 LEU n 1 224 LYS n 1 225 LEU n 1 226 ASN n 1 227 HIS n 1 228 PRO n 1 229 GLU n 1 230 SER n 1 231 SER n 1 232 GLN n 1 233 LEU n 1 234 PHE n 1 235 ALA n 1 236 LYS n 1 237 LEU n 1 238 LEU n 1 239 GLN n 1 240 LYS n 1 241 MET n 1 242 THR n 1 243 ASP n 1 244 LEU n 1 245 ARG n 1 246 GLN n 1 247 ILE n 1 248 VAL n 1 249 THR n 1 250 GLU n 1 251 HIS n 1 252 VAL n 1 253 GLN n 1 254 LEU n 1 255 LEU n 1 256 GLN n 1 257 VAL n 1 258 ILE n 1 259 LYS n 1 260 LYS n 1 261 THR n 1 262 GLU n 1 263 THR n 1 264 ASP n 1 265 MET n 1 266 SER n 1 267 LEU n 1 268 HIS n 1 269 PRO n 1 270 LEU n 1 271 LEU n 1 272 GLN n 1 273 GLU n 1 274 ILE n 1 275 TYR n 1 276 LYS n 1 277 ASP n 1 278 LEU n 1 279 TYR n 2 1 LEU n 2 2 THR n 2 3 GLU n 2 4 ARG n 2 5 HIS n 2 6 LYS n 2 7 ILE n 2 8 LEU n 2 9 HIS n 2 10 ARG n 2 11 LEU n 2 12 LEU n 2 13 GLN n 2 14 GLU n 2 15 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 279 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PPARG _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pet28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 15 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PPARG-2_HUMAN P37231-2 ? 1 ;QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIF QGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGD FMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDL RQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY ; 203 2 UNP NCOA1_HUMAN Q15788 ? 2 LTERHKILHRLLQEG 683 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8HUM A 5 ? 279 ? P37231-2 203 ? 477 ? 203 477 2 2 8HUM B 1 ? 15 ? Q15788 683 ? 697 ? 600 614 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8HUM GLY A 1 ? UNP P37231-2 ? ? 'expression tag' 199 1 1 8HUM SER A 2 ? UNP P37231-2 ? ? 'expression tag' 200 2 1 8HUM HIS A 3 ? UNP P37231-2 ? ? 'expression tag' 201 3 1 8HUM MET A 4 ? UNP P37231-2 ? ? 'expression tag' 202 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BJB non-polymer . '4-[1-(1,3-benzothiazol-6-ylsulfonyl)-5-chloro-indol-2-yl]butanoic acid' ? 'C19 H15 Cl N2 O4 S2' 434.916 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8HUM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.91 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.73 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES (pH 7.5), 1.0 M trisodium citrate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details Mirrors _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-03-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-5A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-5A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate 48.930 _reflns.entry_id 8HUM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.290 _reflns.d_resolution_low 46.230 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18352 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.400 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.045 _reflns.pdbx_Rpim_I_all 0.018 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 117464 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.041 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.290 2.370 ? 3.9 ? ? ? ? 1797 ? ? ? ? ? ? ? ? ? ? ? 6.500 ? ? ? 0.386 0.150 ? 1 1 0.984 ? ? 99.900 ? 0.355 ? ? ? ? ? ? ? ? ? 8.870 46.230 ? ? ? ? ? ? 378 ? ? ? ? ? ? ? ? ? ? ? 5.600 ? ? ? 0.018 0.007 ? 2 1 1.000 ? ? 99.100 ? 0.016 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 118.600 _refine.B_iso_mean 60.6091 _refine.B_iso_min 39.340 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8HUM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2900 _refine.ls_d_res_low 39.2700 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18258 _refine.ls_number_reflns_R_free 1744 _refine.ls_number_reflns_R_work 32292 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.4100 _refine.ls_percent_reflns_R_free 5.1200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2081 _refine.ls_R_factor_R_free 0.2504 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2057 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.930 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1WM0 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.8000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2900 _refine_hist.d_res_low 39.2700 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 2343 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 287 _refine_hist.pdbx_B_iso_mean_ligand 67.20 _refine_hist.pdbx_B_iso_mean_solvent 48.14 _refine_hist.pdbx_number_atoms_protein 2297 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 42 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 2400 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.028 ? 3244 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.051 ? 369 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 413 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 18.608 ? 1470 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.2900 2.3574 . . 163 2678 99.0000 . . . 0.0000 0.2563 . . . . . . . . . . . 0.3039 'X-RAY DIFFRACTION' 2.3574 2.4335 . . 121 2695 99.0000 . . . 0.0000 0.2461 . . . . . . . . . . . 0.3075 'X-RAY DIFFRACTION' 2.4335 2.5204 . . 165 2707 99.0000 . . . 0.0000 0.2414 . . . . . . . . . . . 0.3129 'X-RAY DIFFRACTION' 2.5204 2.6213 . . 148 2692 100.0000 . . . 0.0000 0.2475 . . . . . . . . . . . 0.3379 'X-RAY DIFFRACTION' 2.6213 2.7406 . . 152 2668 100.0000 . . . 0.0000 0.2512 . . . . . . . . . . . 0.3028 'X-RAY DIFFRACTION' 2.7406 2.8850 . . 122 2733 100.0000 . . . 0.0000 0.2451 . . . . . . . . . . . 0.3339 'X-RAY DIFFRACTION' 2.8850 3.0657 . . 133 2686 100.0000 . . . 0.0000 0.2584 . . . . . . . . . . . 0.2925 'X-RAY DIFFRACTION' 3.0657 3.3023 . . 114 2721 99.0000 . . . 0.0000 0.2399 . . . . . . . . . . . 0.3277 'X-RAY DIFFRACTION' 3.3023 3.6344 . . 165 2677 100.0000 . . . 0.0000 0.2088 . . . . . . . . . . . 0.2581 'X-RAY DIFFRACTION' 3.6344 4.1598 . . 136 2707 100.0000 . . . 0.0000 0.1837 . . . . . . . . . . . 0.1939 'X-RAY DIFFRACTION' 4.1598 5.2390 . . 164 2657 99.0000 . . . 0.0000 0.1704 . . . . . . . . . . . 0.2172 'X-RAY DIFFRACTION' 5.2390 39.27 . . 161 2671 99.0000 . . . 0.0000 0.1848 . . . . . . . . . . . 0.2305 # _struct.entry_id 8HUM _struct.title ;X-ray structure of human PPAR gamma ligand binding domain-lanifibranor-SRC1 coactivator peptide co-crystals obtained by co-crystallization ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8HUM _struct_keywords.text 'Nuclear receptor, Protein-ligand complex, PPAR, Transcription' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 7 ? PHE A 28 ? ASN A 205 PHE A 226 1 ? 22 HELX_P HELX_P2 AA2 THR A 31 ? THR A 40 ? THR A 229 THR A 238 1 ? 10 HELX_P HELX_P3 AA3 ASP A 53 ? ILE A 64 ? ASP A 251 ILE A 262 1 ? 12 HELX_P HELX_P4 AA4 GLU A 78 ? SER A 104 ? GLU A 276 SER A 302 1 ? 27 HELX_P HELX_P5 AA5 ASP A 112 ? ALA A 133 ? ASP A 310 ALA A 331 1 ? 22 HELX_P HELX_P6 AA6 SER A 144 ? GLY A 146 ? SER A 342 GLY A 344 5 ? 3 HELX_P HELX_P7 AA7 ARG A 152 ? SER A 157 ? ARG A 350 SER A 355 1 ? 6 HELX_P HELX_P8 AA8 PRO A 161 ? PHE A 165 ? PRO A 359 PHE A 363 5 ? 5 HELX_P HELX_P9 AA9 MET A 166 ? ALA A 178 ? MET A 364 ALA A 376 1 ? 13 HELX_P HELX_P10 AB1 ASP A 182 ? LEU A 195 ? ASP A 380 LEU A 393 1 ? 14 HELX_P HELX_P11 AB2 VAL A 205 ? HIS A 227 ? VAL A 403 HIS A 425 1 ? 23 HELX_P HELX_P12 AB3 GLN A 232 ? LYS A 260 ? GLN A 430 LYS A 458 1 ? 29 HELX_P HELX_P13 AB4 HIS A 268 ? LYS A 276 ? HIS A 466 LYS A 474 1 ? 9 HELX_P HELX_P14 AB5 HIS B 5 ? GLN B 13 ? HIS B 604 GLN B 612 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 71 A . ? PRO 269 A LEU 72 A ? LEU 270 A 1 4.69 2 LYS 160 A . ? LYS 358 A PRO 161 A ? PRO 359 A 1 0.70 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 49 ? ILE A 51 ? PHE A 247 ILE A 249 AA1 2 GLY A 148 ? THR A 151 ? GLY A 346 THR A 349 AA1 3 GLY A 140 ? ILE A 143 ? GLY A 338 ILE A 341 AA1 4 MET A 136 ? ASN A 137 ? MET A 334 ASN A 335 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 51 ? N ILE A 249 O PHE A 149 ? O PHE A 347 AA1 2 3 O GLY A 148 ? O GLY A 346 N ILE A 143 ? N ILE A 341 AA1 3 4 O GLY A 140 ? O GLY A 338 N ASN A 137 ? N ASN A 335 # _atom_sites.entry_id 8HUM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020055 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015692 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008098 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 199 ? ? ? A . n A 1 2 SER 2 200 ? ? ? A . n A 1 3 HIS 3 201 201 HIS HIS A . n A 1 4 MET 4 202 202 MET MET A . n A 1 5 GLN 5 203 203 GLN GLN A . n A 1 6 LEU 6 204 204 LEU LEU A . n A 1 7 ASN 7 205 205 ASN ASN A . n A 1 8 PRO 8 206 206 PRO PRO A . n A 1 9 GLU 9 207 207 GLU GLU A . n A 1 10 SER 10 208 208 SER SER A . n A 1 11 ALA 11 209 209 ALA ALA A . n A 1 12 ASP 12 210 210 ASP ASP A . n A 1 13 LEU 13 211 211 LEU LEU A . n A 1 14 ARG 14 212 212 ARG ARG A . n A 1 15 ALA 15 213 213 ALA ALA A . n A 1 16 LEU 16 214 214 LEU LEU A . n A 1 17 ALA 17 215 215 ALA ALA A . n A 1 18 LYS 18 216 216 LYS LYS A . n A 1 19 HIS 19 217 217 HIS HIS A . n A 1 20 LEU 20 218 218 LEU LEU A . n A 1 21 TYR 21 219 219 TYR TYR A . n A 1 22 ASP 22 220 220 ASP ASP A . n A 1 23 SER 23 221 221 SER SER A . n A 1 24 TYR 24 222 222 TYR TYR A . n A 1 25 ILE 25 223 223 ILE ILE A . n A 1 26 LYS 26 224 224 LYS LYS A . n A 1 27 SER 27 225 225 SER SER A . n A 1 28 PHE 28 226 226 PHE PHE A . n A 1 29 PRO 29 227 227 PRO PRO A . n A 1 30 LEU 30 228 228 LEU LEU A . n A 1 31 THR 31 229 229 THR THR A . n A 1 32 LYS 32 230 230 LYS LYS A . n A 1 33 ALA 33 231 231 ALA ALA A . n A 1 34 LYS 34 232 232 LYS LYS A . n A 1 35 ALA 35 233 233 ALA ALA A . n A 1 36 ARG 36 234 234 ARG ARG A . n A 1 37 ALA 37 235 235 ALA ALA A . n A 1 38 ILE 38 236 236 ILE ILE A . n A 1 39 LEU 39 237 237 LEU LEU A . n A 1 40 THR 40 238 238 THR THR A . n A 1 41 GLY 41 239 239 GLY GLY A . n A 1 42 LYS 42 240 240 LYS LYS A . n A 1 43 THR 43 241 241 THR THR A . n A 1 44 THR 44 242 242 THR THR A . n A 1 45 ASP 45 243 243 ASP ASP A . n A 1 46 LYS 46 244 244 LYS LYS A . n A 1 47 SER 47 245 245 SER SER A . n A 1 48 PRO 48 246 246 PRO PRO A . n A 1 49 PHE 49 247 247 PHE PHE A . n A 1 50 VAL 50 248 248 VAL VAL A . n A 1 51 ILE 51 249 249 ILE ILE A . n A 1 52 TYR 52 250 250 TYR TYR A . n A 1 53 ASP 53 251 251 ASP ASP A . n A 1 54 MET 54 252 252 MET MET A . n A 1 55 ASN 55 253 253 ASN ASN A . n A 1 56 SER 56 254 254 SER SER A . n A 1 57 LEU 57 255 255 LEU LEU A . n A 1 58 MET 58 256 256 MET MET A . n A 1 59 MET 59 257 257 MET MET A . n A 1 60 GLY 60 258 258 GLY GLY A . n A 1 61 GLU 61 259 259 GLU GLU A . n A 1 62 ASP 62 260 260 ASP ASP A . n A 1 63 LYS 63 261 261 LYS LYS A . n A 1 64 ILE 64 262 262 ILE ILE A . n A 1 65 LYS 65 263 263 LYS LYS A . n A 1 66 PHE 66 264 264 PHE PHE A . n A 1 67 LYS 67 265 265 LYS LYS A . n A 1 68 HIS 68 266 266 HIS HIS A . n A 1 69 ILE 69 267 267 ILE ILE A . n A 1 70 THR 70 268 268 THR THR A . n A 1 71 PRO 71 269 269 PRO PRO A . n A 1 72 LEU 72 270 270 LEU LEU A . n A 1 73 GLN 73 271 271 GLN GLN A . n A 1 74 GLU 74 272 272 GLU GLU A . n A 1 75 GLN 75 273 273 GLN GLN A . n A 1 76 SER 76 274 274 SER SER A . n A 1 77 LYS 77 275 275 LYS LYS A . n A 1 78 GLU 78 276 276 GLU GLU A . n A 1 79 VAL 79 277 277 VAL VAL A . n A 1 80 ALA 80 278 278 ALA ALA A . n A 1 81 ILE 81 279 279 ILE ILE A . n A 1 82 ARG 82 280 280 ARG ARG A . n A 1 83 ILE 83 281 281 ILE ILE A . n A 1 84 PHE 84 282 282 PHE PHE A . n A 1 85 GLN 85 283 283 GLN GLN A . n A 1 86 GLY 86 284 284 GLY GLY A . n A 1 87 CYS 87 285 285 CYS CYS A . n A 1 88 GLN 88 286 286 GLN GLN A . n A 1 89 PHE 89 287 287 PHE PHE A . n A 1 90 ARG 90 288 288 ARG ARG A . n A 1 91 SER 91 289 289 SER SER A . n A 1 92 VAL 92 290 290 VAL VAL A . n A 1 93 GLU 93 291 291 GLU GLU A . n A 1 94 ALA 94 292 292 ALA ALA A . n A 1 95 VAL 95 293 293 VAL VAL A . n A 1 96 GLN 96 294 294 GLN GLN A . n A 1 97 GLU 97 295 295 GLU GLU A . n A 1 98 ILE 98 296 296 ILE ILE A . n A 1 99 THR 99 297 297 THR THR A . n A 1 100 GLU 100 298 298 GLU GLU A . n A 1 101 TYR 101 299 299 TYR TYR A . n A 1 102 ALA 102 300 300 ALA ALA A . n A 1 103 LYS 103 301 301 LYS LYS A . n A 1 104 SER 104 302 302 SER SER A . n A 1 105 ILE 105 303 303 ILE ILE A . n A 1 106 PRO 106 304 304 PRO PRO A . n A 1 107 GLY 107 305 305 GLY GLY A . n A 1 108 PHE 108 306 306 PHE PHE A . n A 1 109 VAL 109 307 307 VAL VAL A . n A 1 110 ASN 110 308 308 ASN ASN A . n A 1 111 LEU 111 309 309 LEU LEU A . n A 1 112 ASP 112 310 310 ASP ASP A . n A 1 113 LEU 113 311 311 LEU LEU A . n A 1 114 ASN 114 312 312 ASN ASN A . n A 1 115 ASP 115 313 313 ASP ASP A . n A 1 116 GLN 116 314 314 GLN GLN A . n A 1 117 VAL 117 315 315 VAL VAL A . n A 1 118 THR 118 316 316 THR THR A . n A 1 119 LEU 119 317 317 LEU LEU A . n A 1 120 LEU 120 318 318 LEU LEU A . n A 1 121 LYS 121 319 319 LYS LYS A . n A 1 122 TYR 122 320 320 TYR TYR A . n A 1 123 GLY 123 321 321 GLY GLY A . n A 1 124 VAL 124 322 322 VAL VAL A . n A 1 125 HIS 125 323 323 HIS HIS A . n A 1 126 GLU 126 324 324 GLU GLU A . n A 1 127 ILE 127 325 325 ILE ILE A . n A 1 128 ILE 128 326 326 ILE ILE A . n A 1 129 TYR 129 327 327 TYR TYR A . n A 1 130 THR 130 328 328 THR THR A . n A 1 131 MET 131 329 329 MET MET A . n A 1 132 LEU 132 330 330 LEU LEU A . n A 1 133 ALA 133 331 331 ALA ALA A . n A 1 134 SER 134 332 332 SER SER A . n A 1 135 LEU 135 333 333 LEU LEU A . n A 1 136 MET 136 334 334 MET MET A . n A 1 137 ASN 137 335 335 ASN ASN A . n A 1 138 LYS 138 336 336 LYS LYS A . n A 1 139 ASP 139 337 337 ASP ASP A . n A 1 140 GLY 140 338 338 GLY GLY A . n A 1 141 VAL 141 339 339 VAL VAL A . n A 1 142 LEU 142 340 340 LEU LEU A . n A 1 143 ILE 143 341 341 ILE ILE A . n A 1 144 SER 144 342 342 SER SER A . n A 1 145 GLU 145 343 343 GLU GLU A . n A 1 146 GLY 146 344 344 GLY GLY A . n A 1 147 GLN 147 345 345 GLN GLN A . n A 1 148 GLY 148 346 346 GLY GLY A . n A 1 149 PHE 149 347 347 PHE PHE A . n A 1 150 MET 150 348 348 MET MET A . n A 1 151 THR 151 349 349 THR THR A . n A 1 152 ARG 152 350 350 ARG ARG A . n A 1 153 GLU 153 351 351 GLU GLU A . n A 1 154 PHE 154 352 352 PHE PHE A . n A 1 155 LEU 155 353 353 LEU LEU A . n A 1 156 LYS 156 354 354 LYS LYS A . n A 1 157 SER 157 355 355 SER SER A . n A 1 158 LEU 158 356 356 LEU LEU A . n A 1 159 ARG 159 357 357 ARG ARG A . n A 1 160 LYS 160 358 358 LYS LYS A . n A 1 161 PRO 161 359 359 PRO PRO A . n A 1 162 PHE 162 360 360 PHE PHE A . n A 1 163 GLY 163 361 361 GLY GLY A . n A 1 164 ASP 164 362 362 ASP ASP A . n A 1 165 PHE 165 363 363 PHE PHE A . n A 1 166 MET 166 364 364 MET MET A . n A 1 167 GLU 167 365 365 GLU GLU A . n A 1 168 PRO 168 366 366 PRO PRO A . n A 1 169 LYS 169 367 367 LYS LYS A . n A 1 170 PHE 170 368 368 PHE PHE A . n A 1 171 GLU 171 369 369 GLU GLU A . n A 1 172 PHE 172 370 370 PHE PHE A . n A 1 173 ALA 173 371 371 ALA ALA A . n A 1 174 VAL 174 372 372 VAL VAL A . n A 1 175 LYS 175 373 373 LYS LYS A . n A 1 176 PHE 176 374 374 PHE PHE A . n A 1 177 ASN 177 375 375 ASN ASN A . n A 1 178 ALA 178 376 376 ALA ALA A . n A 1 179 LEU 179 377 377 LEU LEU A . n A 1 180 GLU 180 378 378 GLU GLU A . n A 1 181 LEU 181 379 379 LEU LEU A . n A 1 182 ASP 182 380 380 ASP ASP A . n A 1 183 ASP 183 381 381 ASP ASP A . n A 1 184 SER 184 382 382 SER SER A . n A 1 185 ASP 185 383 383 ASP ASP A . n A 1 186 LEU 186 384 384 LEU LEU A . n A 1 187 ALA 187 385 385 ALA ALA A . n A 1 188 ILE 188 386 386 ILE ILE A . n A 1 189 PHE 189 387 387 PHE PHE A . n A 1 190 ILE 190 388 388 ILE ILE A . n A 1 191 ALA 191 389 389 ALA ALA A . n A 1 192 VAL 192 390 390 VAL VAL A . n A 1 193 ILE 193 391 391 ILE ILE A . n A 1 194 ILE 194 392 392 ILE ILE A . n A 1 195 LEU 195 393 393 LEU LEU A . n A 1 196 SER 196 394 394 SER SER A . n A 1 197 GLY 197 395 395 GLY GLY A . n A 1 198 ASP 198 396 396 ASP ASP A . n A 1 199 ARG 199 397 397 ARG ARG A . n A 1 200 PRO 200 398 398 PRO PRO A . n A 1 201 GLY 201 399 399 GLY GLY A . n A 1 202 LEU 202 400 400 LEU LEU A . n A 1 203 LEU 203 401 401 LEU LEU A . n A 1 204 ASN 204 402 402 ASN ASN A . n A 1 205 VAL 205 403 403 VAL VAL A . n A 1 206 LYS 206 404 404 LYS LYS A . n A 1 207 PRO 207 405 405 PRO PRO A . n A 1 208 ILE 208 406 406 ILE ILE A . n A 1 209 GLU 209 407 407 GLU GLU A . n A 1 210 ASP 210 408 408 ASP ASP A . n A 1 211 ILE 211 409 409 ILE ILE A . n A 1 212 GLN 212 410 410 GLN GLN A . n A 1 213 ASP 213 411 411 ASP ASP A . n A 1 214 ASN 214 412 412 ASN ASN A . n A 1 215 LEU 215 413 413 LEU LEU A . n A 1 216 LEU 216 414 414 LEU LEU A . n A 1 217 GLN 217 415 415 GLN GLN A . n A 1 218 ALA 218 416 416 ALA ALA A . n A 1 219 LEU 219 417 417 LEU LEU A . n A 1 220 GLU 220 418 418 GLU GLU A . n A 1 221 LEU 221 419 419 LEU LEU A . n A 1 222 GLN 222 420 420 GLN GLN A . n A 1 223 LEU 223 421 421 LEU LEU A . n A 1 224 LYS 224 422 422 LYS LYS A . n A 1 225 LEU 225 423 423 LEU LEU A . n A 1 226 ASN 226 424 424 ASN ASN A . n A 1 227 HIS 227 425 425 HIS HIS A . n A 1 228 PRO 228 426 426 PRO PRO A . n A 1 229 GLU 229 427 427 GLU GLU A . n A 1 230 SER 230 428 428 SER SER A . n A 1 231 SER 231 429 429 SER SER A . n A 1 232 GLN 232 430 430 GLN GLN A . n A 1 233 LEU 233 431 431 LEU LEU A . n A 1 234 PHE 234 432 432 PHE PHE A . n A 1 235 ALA 235 433 433 ALA ALA A . n A 1 236 LYS 236 434 434 LYS LYS A . n A 1 237 LEU 237 435 435 LEU LEU A . n A 1 238 LEU 238 436 436 LEU LEU A . n A 1 239 GLN 239 437 437 GLN GLN A . n A 1 240 LYS 240 438 438 LYS LYS A . n A 1 241 MET 241 439 439 MET MET A . n A 1 242 THR 242 440 440 THR THR A . n A 1 243 ASP 243 441 441 ASP ASP A . n A 1 244 LEU 244 442 442 LEU LEU A . n A 1 245 ARG 245 443 443 ARG ARG A . n A 1 246 GLN 246 444 444 GLN GLN A . n A 1 247 ILE 247 445 445 ILE ILE A . n A 1 248 VAL 248 446 446 VAL VAL A . n A 1 249 THR 249 447 447 THR THR A . n A 1 250 GLU 250 448 448 GLU GLU A . n A 1 251 HIS 251 449 449 HIS HIS A . n A 1 252 VAL 252 450 450 VAL VAL A . n A 1 253 GLN 253 451 451 GLN GLN A . n A 1 254 LEU 254 452 452 LEU LEU A . n A 1 255 LEU 255 453 453 LEU LEU A . n A 1 256 GLN 256 454 454 GLN GLN A . n A 1 257 VAL 257 455 455 VAL VAL A . n A 1 258 ILE 258 456 456 ILE ILE A . n A 1 259 LYS 259 457 457 LYS LYS A . n A 1 260 LYS 260 458 458 LYS LYS A . n A 1 261 THR 261 459 459 THR THR A . n A 1 262 GLU 262 460 460 GLU GLU A . n A 1 263 THR 263 461 461 THR THR A . n A 1 264 ASP 264 462 462 ASP ASP A . n A 1 265 MET 265 463 463 MET MET A . n A 1 266 SER 266 464 464 SER SER A . n A 1 267 LEU 267 465 465 LEU LEU A . n A 1 268 HIS 268 466 466 HIS HIS A . n A 1 269 PRO 269 467 467 PRO PRO A . n A 1 270 LEU 270 468 468 LEU LEU A . n A 1 271 LEU 271 469 469 LEU LEU A . n A 1 272 GLN 272 470 470 GLN GLN A . n A 1 273 GLU 273 471 471 GLU GLU A . n A 1 274 ILE 274 472 472 ILE ILE A . n A 1 275 TYR 275 473 473 TYR TYR A . n A 1 276 LYS 276 474 474 LYS LYS A . n A 1 277 ASP 277 475 475 ASP ASP A . n A 1 278 LEU 278 476 476 LEU LEU A . n A 1 279 TYR 279 477 477 TYR TYR A . n B 2 1 LEU 1 600 ? ? ? B . n B 2 2 THR 2 601 ? ? ? B . n B 2 3 GLU 3 602 ? ? ? B . n B 2 4 ARG 4 603 603 ARG ARG B . n B 2 5 HIS 5 604 604 HIS HIS B . n B 2 6 LYS 6 605 605 LYS LYS B . n B 2 7 ILE 7 606 606 ILE ILE B . n B 2 8 LEU 8 607 607 LEU LEU B . n B 2 9 HIS 9 608 608 HIS HIS B . n B 2 10 ARG 10 609 609 ARG ARG B . n B 2 11 LEU 11 610 610 LEU LEU B . n B 2 12 LEU 12 611 611 LEU LEU B . n B 2 13 GLN 13 612 612 GLN GLN B . n B 2 14 GLU 14 613 ? ? ? B . n B 2 15 GLY 15 614 ? ? ? B . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email isao-ishii@umin.ac.jp _pdbx_contact_author.name_first Isao _pdbx_contact_author.name_last Ishii _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5367-205X # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 BJB 1 501 1 BJB BJB A . D 4 HOH 1 601 3 HOH HOH A . D 4 HOH 2 602 2 HOH HOH A . D 4 HOH 3 603 1 HOH HOH A . D 4 HOH 4 604 4 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1100 ? 1 MORE -9 ? 1 'SSA (A^2)' 13950 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-08-09 2 'Structure model' 1 1 2023-09-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' citation 4 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.page_first' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_phasing_MR.entry_id 8HUM _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 5.960 _pdbx_phasing_MR.d_res_low_rotation 46.230 _pdbx_phasing_MR.d_res_high_translation 5.960 _pdbx_phasing_MR.d_res_low_translation 46.230 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.21 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.7.16 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1-2575-000 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 5 # _pdbx_entry_details.entry_id 8HUM _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 240 ? ? -53.23 28.89 2 1 THR A 242 ? ? -90.46 -90.80 3 1 ASP A 243 ? ? 45.88 -98.39 4 1 LYS A 244 ? ? -138.72 -48.75 5 1 SER A 245 ? ? 74.25 102.91 6 1 LYS A 275 ? ? 73.32 -19.00 7 1 ASP A 310 ? ? -37.19 121.91 8 1 LEU A 393 ? ? -99.20 37.49 9 1 GLU A 427 ? ? -96.04 45.08 10 1 GLU A 427 ? ? -96.04 41.98 11 1 SER A 428 ? A -158.93 84.96 12 1 THR A 459 ? ? 178.71 -55.30 13 1 ASP A 462 ? ? 109.58 -39.88 14 1 LEU A 476 ? ? -73.22 -84.69 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 201 ? CG ? A HIS 3 CG 2 1 Y 1 A HIS 201 ? ND1 ? A HIS 3 ND1 3 1 Y 1 A HIS 201 ? CD2 ? A HIS 3 CD2 4 1 Y 1 A HIS 201 ? CE1 ? A HIS 3 CE1 5 1 Y 1 A HIS 201 ? NE2 ? A HIS 3 NE2 6 1 Y 1 A LYS 244 ? CG ? A LYS 46 CG 7 1 Y 1 A LYS 244 ? CD ? A LYS 46 CD 8 1 Y 1 A LYS 244 ? CE ? A LYS 46 CE 9 1 Y 1 A LYS 244 ? NZ ? A LYS 46 NZ 10 1 Y 1 A ILE 267 ? CG1 ? A ILE 69 CG1 11 1 Y 1 A ILE 267 ? CG2 ? A ILE 69 CG2 12 1 Y 1 A ILE 267 ? CD1 ? A ILE 69 CD1 13 1 Y 1 A LEU 270 ? CG ? A LEU 72 CG 14 1 Y 1 A LEU 270 ? CD1 ? A LEU 72 CD1 15 1 Y 1 A LEU 270 ? CD2 ? A LEU 72 CD2 16 1 Y 1 A LYS 275 ? CG ? A LYS 77 CG 17 1 Y 1 A LYS 275 ? CD ? A LYS 77 CD 18 1 Y 1 A LYS 275 ? CE ? A LYS 77 CE 19 1 Y 1 A LYS 275 ? NZ ? A LYS 77 NZ 20 1 Y 1 A LYS 358 ? CG ? A LYS 160 CG 21 1 Y 1 A LYS 358 ? CD ? A LYS 160 CD 22 1 Y 1 A LYS 358 ? CE ? A LYS 160 CE 23 1 Y 1 A LYS 358 ? NZ ? A LYS 160 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 199 ? A GLY 1 2 1 Y 1 A SER 200 ? A SER 2 3 1 Y 1 B LEU 600 ? B LEU 1 4 1 Y 1 B THR 601 ? B THR 2 5 1 Y 1 B GLU 602 ? B GLU 3 6 1 Y 1 B GLU 613 ? B GLU 14 7 1 Y 1 B GLY 614 ? B GLY 15 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BJB C2 C Y N 74 BJB C7 C Y N 75 BJB C8 C Y N 76 BJB C9 C Y N 77 BJB C4 C Y N 78 BJB C31 C N N 79 BJB C32 C N N 80 BJB C25 C Y N 81 BJB C17 C Y N 82 BJB C19 C Y N 83 BJB C18 C Y N 84 BJB C5 C Y N 85 BJB C6 C Y N 86 BJB N1 N Y N 87 BJB C3 C Y N 88 BJB CL1 CL N N 89 BJB S14 S N N 90 BJB C15 C Y N 91 BJB C16 C Y N 92 BJB C20 C Y N 93 BJB S24 S Y N 94 BJB N26 N Y N 95 BJB O29 O N N 96 BJB O30 O N N 97 BJB C35 C N N 98 BJB C38 C N N 99 BJB O41 O N N 100 BJB O42 O N N 101 BJB H1 H N N 102 BJB H2 H N N 103 BJB H3 H N N 104 BJB H4 H N N 105 BJB H5 H N N 106 BJB H6 H N N 107 BJB H7 H N N 108 BJB H8 H N N 109 BJB H9 H N N 110 BJB H10 H N N 111 BJB H11 H N N 112 BJB H12 H N N 113 BJB H13 H N N 114 BJB H14 H N N 115 BJB H15 H N N 116 CYS N N N N 117 CYS CA C N R 118 CYS C C N N 119 CYS O O N N 120 CYS CB C N N 121 CYS SG S N N 122 CYS OXT O N N 123 CYS H H N N 124 CYS H2 H N N 125 CYS HA H N N 126 CYS HB2 H N N 127 CYS HB3 H N N 128 CYS HG H N N 129 CYS HXT H N N 130 GLN N N N N 131 GLN CA C N S 132 GLN C C N N 133 GLN O O N N 134 GLN CB C N N 135 GLN CG C N N 136 GLN CD C N N 137 GLN OE1 O N N 138 GLN NE2 N N N 139 GLN OXT O N N 140 GLN H H N N 141 GLN H2 H N N 142 GLN HA H N N 143 GLN HB2 H N N 144 GLN HB3 H N N 145 GLN HG2 H N N 146 GLN HG3 H N N 147 GLN HE21 H N N 148 GLN HE22 H N N 149 GLN HXT H N N 150 GLU N N N N 151 GLU CA C N S 152 GLU C C N N 153 GLU O O N N 154 GLU CB C N N 155 GLU CG C N N 156 GLU CD C N N 157 GLU OE1 O N N 158 GLU OE2 O N N 159 GLU OXT O N N 160 GLU H H N N 161 GLU H2 H N N 162 GLU HA H N N 163 GLU HB2 H N N 164 GLU HB3 H N N 165 GLU HG2 H N N 166 GLU HG3 H N N 167 GLU HE2 H N N 168 GLU HXT H N N 169 GLY N N N N 170 GLY CA C N N 171 GLY C C N N 172 GLY O O N N 173 GLY OXT O N N 174 GLY H H N N 175 GLY H2 H N N 176 GLY HA2 H N N 177 GLY HA3 H N N 178 GLY HXT H N N 179 HIS N N N N 180 HIS CA C N S 181 HIS C C N N 182 HIS O O N N 183 HIS CB C N N 184 HIS CG C Y N 185 HIS ND1 N Y N 186 HIS CD2 C Y N 187 HIS CE1 C Y N 188 HIS NE2 N Y N 189 HIS OXT O N N 190 HIS H H N N 191 HIS H2 H N N 192 HIS HA H N N 193 HIS HB2 H N N 194 HIS HB3 H N N 195 HIS HD1 H N N 196 HIS HD2 H N N 197 HIS HE1 H N N 198 HIS HE2 H N N 199 HIS HXT H N N 200 HOH O O N N 201 HOH H1 H N N 202 HOH H2 H N N 203 ILE N N N N 204 ILE CA C N S 205 ILE C C N N 206 ILE O O N N 207 ILE CB C N S 208 ILE CG1 C N N 209 ILE CG2 C N N 210 ILE CD1 C N N 211 ILE OXT O N N 212 ILE H H N N 213 ILE H2 H N N 214 ILE HA H N N 215 ILE HB H N N 216 ILE HG12 H N N 217 ILE HG13 H N N 218 ILE HG21 H N N 219 ILE HG22 H N N 220 ILE HG23 H N N 221 ILE HD11 H N N 222 ILE HD12 H N N 223 ILE HD13 H N N 224 ILE HXT H N N 225 LEU N N N N 226 LEU CA C N S 227 LEU C C N N 228 LEU O O N N 229 LEU CB C N N 230 LEU CG C N N 231 LEU CD1 C N N 232 LEU CD2 C N N 233 LEU OXT O N N 234 LEU H H N N 235 LEU H2 H N N 236 LEU HA H N N 237 LEU HB2 H N N 238 LEU HB3 H N N 239 LEU HG H N N 240 LEU HD11 H N N 241 LEU HD12 H N N 242 LEU HD13 H N N 243 LEU HD21 H N N 244 LEU HD22 H N N 245 LEU HD23 H N N 246 LEU HXT H N N 247 LYS N N N N 248 LYS CA C N S 249 LYS C C N N 250 LYS O O N N 251 LYS CB C N N 252 LYS CG C N N 253 LYS CD C N N 254 LYS CE C N N 255 LYS NZ N N N 256 LYS OXT O N N 257 LYS H H N N 258 LYS H2 H N N 259 LYS HA H N N 260 LYS HB2 H N N 261 LYS HB3 H N N 262 LYS HG2 H N N 263 LYS HG3 H N N 264 LYS HD2 H N N 265 LYS HD3 H N N 266 LYS HE2 H N N 267 LYS HE3 H N N 268 LYS HZ1 H N N 269 LYS HZ2 H N N 270 LYS HZ3 H N N 271 LYS HXT H N N 272 MET N N N N 273 MET CA C N S 274 MET C C N N 275 MET O O N N 276 MET CB C N N 277 MET CG C N N 278 MET SD S N N 279 MET CE C N N 280 MET OXT O N N 281 MET H H N N 282 MET H2 H N N 283 MET HA H N N 284 MET HB2 H N N 285 MET HB3 H N N 286 MET HG2 H N N 287 MET HG3 H N N 288 MET HE1 H N N 289 MET HE2 H N N 290 MET HE3 H N N 291 MET HXT H N N 292 PHE N N N N 293 PHE CA C N S 294 PHE C C N N 295 PHE O O N N 296 PHE CB C N N 297 PHE CG C Y N 298 PHE CD1 C Y N 299 PHE CD2 C Y N 300 PHE CE1 C Y N 301 PHE CE2 C Y N 302 PHE CZ C Y N 303 PHE OXT O N N 304 PHE H H N N 305 PHE H2 H N N 306 PHE HA H N N 307 PHE HB2 H N N 308 PHE HB3 H N N 309 PHE HD1 H N N 310 PHE HD2 H N N 311 PHE HE1 H N N 312 PHE HE2 H N N 313 PHE HZ H N N 314 PHE HXT H N N 315 PRO N N N N 316 PRO CA C N S 317 PRO C C N N 318 PRO O O N N 319 PRO CB C N N 320 PRO CG C N N 321 PRO CD C N N 322 PRO OXT O N N 323 PRO H H N N 324 PRO HA H N N 325 PRO HB2 H N N 326 PRO HB3 H N N 327 PRO HG2 H N N 328 PRO HG3 H N N 329 PRO HD2 H N N 330 PRO HD3 H N N 331 PRO HXT H N N 332 SER N N N N 333 SER CA C N S 334 SER C C N N 335 SER O O N N 336 SER CB C N N 337 SER OG O N N 338 SER OXT O N N 339 SER H H N N 340 SER H2 H N N 341 SER HA H N N 342 SER HB2 H N N 343 SER HB3 H N N 344 SER HG H N N 345 SER HXT H N N 346 THR N N N N 347 THR CA C N S 348 THR C C N N 349 THR O O N N 350 THR CB C N R 351 THR OG1 O N N 352 THR CG2 C N N 353 THR OXT O N N 354 THR H H N N 355 THR H2 H N N 356 THR HA H N N 357 THR HB H N N 358 THR HG1 H N N 359 THR HG21 H N N 360 THR HG22 H N N 361 THR HG23 H N N 362 THR HXT H N N 363 TYR N N N N 364 TYR CA C N S 365 TYR C C N N 366 TYR O O N N 367 TYR CB C N N 368 TYR CG C Y N 369 TYR CD1 C Y N 370 TYR CD2 C Y N 371 TYR CE1 C Y N 372 TYR CE2 C Y N 373 TYR CZ C Y N 374 TYR OH O N N 375 TYR OXT O N N 376 TYR H H N N 377 TYR H2 H N N 378 TYR HA H N N 379 TYR HB2 H N N 380 TYR HB3 H N N 381 TYR HD1 H N N 382 TYR HD2 H N N 383 TYR HE1 H N N 384 TYR HE2 H N N 385 TYR HH H N N 386 TYR HXT H N N 387 VAL N N N N 388 VAL CA C N S 389 VAL C C N N 390 VAL O O N N 391 VAL CB C N N 392 VAL CG1 C N N 393 VAL CG2 C N N 394 VAL OXT O N N 395 VAL H H N N 396 VAL H2 H N N 397 VAL HA H N N 398 VAL HB H N N 399 VAL HG11 H N N 400 VAL HG12 H N N 401 VAL HG13 H N N 402 VAL HG21 H N N 403 VAL HG22 H N N 404 VAL HG23 H N N 405 VAL HXT H N N 406 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BJB C25 N26 doub Y N 70 BJB C25 S24 sing Y N 71 BJB N26 C18 sing Y N 72 BJB S24 C17 sing Y N 73 BJB C18 C19 doub Y N 74 BJB C18 C17 sing Y N 75 BJB C19 C20 sing Y N 76 BJB C17 C16 doub Y N 77 BJB C20 C15 doub Y N 78 BJB C16 C15 sing Y N 79 BJB C15 S14 sing N N 80 BJB C31 C2 sing N N 81 BJB C31 C32 sing N N 82 BJB S14 O29 doub N N 83 BJB S14 N1 sing N N 84 BJB S14 O30 doub N N 85 BJB C2 N1 sing Y N 86 BJB C2 C3 doub Y N 87 BJB N1 C5 sing Y N 88 BJB O42 C38 doub N N 89 BJB C35 C32 sing N N 90 BJB C35 C38 sing N N 91 BJB C3 C4 sing Y N 92 BJB C5 C4 doub Y N 93 BJB C5 C9 sing Y N 94 BJB C4 C6 sing Y N 95 BJB C9 C8 doub Y N 96 BJB C38 O41 sing N N 97 BJB C6 C7 doub Y N 98 BJB C8 C7 sing Y N 99 BJB C7 CL1 sing N N 100 BJB C8 H1 sing N N 101 BJB C9 H2 sing N N 102 BJB C31 H3 sing N N 103 BJB C31 H4 sing N N 104 BJB C32 H5 sing N N 105 BJB C32 H6 sing N N 106 BJB C25 H7 sing N N 107 BJB C19 H8 sing N N 108 BJB C6 H9 sing N N 109 BJB C3 H10 sing N N 110 BJB C16 H11 sing N N 111 BJB C20 H12 sing N N 112 BJB C35 H13 sing N N 113 BJB C35 H14 sing N N 114 BJB O41 H15 sing N N 115 CYS N CA sing N N 116 CYS N H sing N N 117 CYS N H2 sing N N 118 CYS CA C sing N N 119 CYS CA CB sing N N 120 CYS CA HA sing N N 121 CYS C O doub N N 122 CYS C OXT sing N N 123 CYS CB SG sing N N 124 CYS CB HB2 sing N N 125 CYS CB HB3 sing N N 126 CYS SG HG sing N N 127 CYS OXT HXT sing N N 128 GLN N CA sing N N 129 GLN N H sing N N 130 GLN N H2 sing N N 131 GLN CA C sing N N 132 GLN CA CB sing N N 133 GLN CA HA sing N N 134 GLN C O doub N N 135 GLN C OXT sing N N 136 GLN CB CG sing N N 137 GLN CB HB2 sing N N 138 GLN CB HB3 sing N N 139 GLN CG CD sing N N 140 GLN CG HG2 sing N N 141 GLN CG HG3 sing N N 142 GLN CD OE1 doub N N 143 GLN CD NE2 sing N N 144 GLN NE2 HE21 sing N N 145 GLN NE2 HE22 sing N N 146 GLN OXT HXT sing N N 147 GLU N CA sing N N 148 GLU N H sing N N 149 GLU N H2 sing N N 150 GLU CA C sing N N 151 GLU CA CB sing N N 152 GLU CA HA sing N N 153 GLU C O doub N N 154 GLU C OXT sing N N 155 GLU CB CG sing N N 156 GLU CB HB2 sing N N 157 GLU CB HB3 sing N N 158 GLU CG CD sing N N 159 GLU CG HG2 sing N N 160 GLU CG HG3 sing N N 161 GLU CD OE1 doub N N 162 GLU CD OE2 sing N N 163 GLU OE2 HE2 sing N N 164 GLU OXT HXT sing N N 165 GLY N CA sing N N 166 GLY N H sing N N 167 GLY N H2 sing N N 168 GLY CA C sing N N 169 GLY CA HA2 sing N N 170 GLY CA HA3 sing N N 171 GLY C O doub N N 172 GLY C OXT sing N N 173 GLY OXT HXT sing N N 174 HIS N CA sing N N 175 HIS N H sing N N 176 HIS N H2 sing N N 177 HIS CA C sing N N 178 HIS CA CB sing N N 179 HIS CA HA sing N N 180 HIS C O doub N N 181 HIS C OXT sing N N 182 HIS CB CG sing N N 183 HIS CB HB2 sing N N 184 HIS CB HB3 sing N N 185 HIS CG ND1 sing Y N 186 HIS CG CD2 doub Y N 187 HIS ND1 CE1 doub Y N 188 HIS ND1 HD1 sing N N 189 HIS CD2 NE2 sing Y N 190 HIS CD2 HD2 sing N N 191 HIS CE1 NE2 sing Y N 192 HIS CE1 HE1 sing N N 193 HIS NE2 HE2 sing N N 194 HIS OXT HXT sing N N 195 HOH O H1 sing N N 196 HOH O H2 sing N N 197 ILE N CA sing N N 198 ILE N H sing N N 199 ILE N H2 sing N N 200 ILE CA C sing N N 201 ILE CA CB sing N N 202 ILE CA HA sing N N 203 ILE C O doub N N 204 ILE C OXT sing N N 205 ILE CB CG1 sing N N 206 ILE CB CG2 sing N N 207 ILE CB HB sing N N 208 ILE CG1 CD1 sing N N 209 ILE CG1 HG12 sing N N 210 ILE CG1 HG13 sing N N 211 ILE CG2 HG21 sing N N 212 ILE CG2 HG22 sing N N 213 ILE CG2 HG23 sing N N 214 ILE CD1 HD11 sing N N 215 ILE CD1 HD12 sing N N 216 ILE CD1 HD13 sing N N 217 ILE OXT HXT sing N N 218 LEU N CA sing N N 219 LEU N H sing N N 220 LEU N H2 sing N N 221 LEU CA C sing N N 222 LEU CA CB sing N N 223 LEU CA HA sing N N 224 LEU C O doub N N 225 LEU C OXT sing N N 226 LEU CB CG sing N N 227 LEU CB HB2 sing N N 228 LEU CB HB3 sing N N 229 LEU CG CD1 sing N N 230 LEU CG CD2 sing N N 231 LEU CG HG sing N N 232 LEU CD1 HD11 sing N N 233 LEU CD1 HD12 sing N N 234 LEU CD1 HD13 sing N N 235 LEU CD2 HD21 sing N N 236 LEU CD2 HD22 sing N N 237 LEU CD2 HD23 sing N N 238 LEU OXT HXT sing N N 239 LYS N CA sing N N 240 LYS N H sing N N 241 LYS N H2 sing N N 242 LYS CA C sing N N 243 LYS CA CB sing N N 244 LYS CA HA sing N N 245 LYS C O doub N N 246 LYS C OXT sing N N 247 LYS CB CG sing N N 248 LYS CB HB2 sing N N 249 LYS CB HB3 sing N N 250 LYS CG CD sing N N 251 LYS CG HG2 sing N N 252 LYS CG HG3 sing N N 253 LYS CD CE sing N N 254 LYS CD HD2 sing N N 255 LYS CD HD3 sing N N 256 LYS CE NZ sing N N 257 LYS CE HE2 sing N N 258 LYS CE HE3 sing N N 259 LYS NZ HZ1 sing N N 260 LYS NZ HZ2 sing N N 261 LYS NZ HZ3 sing N N 262 LYS OXT HXT sing N N 263 MET N CA sing N N 264 MET N H sing N N 265 MET N H2 sing N N 266 MET CA C sing N N 267 MET CA CB sing N N 268 MET CA HA sing N N 269 MET C O doub N N 270 MET C OXT sing N N 271 MET CB CG sing N N 272 MET CB HB2 sing N N 273 MET CB HB3 sing N N 274 MET CG SD sing N N 275 MET CG HG2 sing N N 276 MET CG HG3 sing N N 277 MET SD CE sing N N 278 MET CE HE1 sing N N 279 MET CE HE2 sing N N 280 MET CE HE3 sing N N 281 MET OXT HXT sing N N 282 PHE N CA sing N N 283 PHE N H sing N N 284 PHE N H2 sing N N 285 PHE CA C sing N N 286 PHE CA CB sing N N 287 PHE CA HA sing N N 288 PHE C O doub N N 289 PHE C OXT sing N N 290 PHE CB CG sing N N 291 PHE CB HB2 sing N N 292 PHE CB HB3 sing N N 293 PHE CG CD1 doub Y N 294 PHE CG CD2 sing Y N 295 PHE CD1 CE1 sing Y N 296 PHE CD1 HD1 sing N N 297 PHE CD2 CE2 doub Y N 298 PHE CD2 HD2 sing N N 299 PHE CE1 CZ doub Y N 300 PHE CE1 HE1 sing N N 301 PHE CE2 CZ sing Y N 302 PHE CE2 HE2 sing N N 303 PHE CZ HZ sing N N 304 PHE OXT HXT sing N N 305 PRO N CA sing N N 306 PRO N CD sing N N 307 PRO N H sing N N 308 PRO CA C sing N N 309 PRO CA CB sing N N 310 PRO CA HA sing N N 311 PRO C O doub N N 312 PRO C OXT sing N N 313 PRO CB CG sing N N 314 PRO CB HB2 sing N N 315 PRO CB HB3 sing N N 316 PRO CG CD sing N N 317 PRO CG HG2 sing N N 318 PRO CG HG3 sing N N 319 PRO CD HD2 sing N N 320 PRO CD HD3 sing N N 321 PRO OXT HXT sing N N 322 SER N CA sing N N 323 SER N H sing N N 324 SER N H2 sing N N 325 SER CA C sing N N 326 SER CA CB sing N N 327 SER CA HA sing N N 328 SER C O doub N N 329 SER C OXT sing N N 330 SER CB OG sing N N 331 SER CB HB2 sing N N 332 SER CB HB3 sing N N 333 SER OG HG sing N N 334 SER OXT HXT sing N N 335 THR N CA sing N N 336 THR N H sing N N 337 THR N H2 sing N N 338 THR CA C sing N N 339 THR CA CB sing N N 340 THR CA HA sing N N 341 THR C O doub N N 342 THR C OXT sing N N 343 THR CB OG1 sing N N 344 THR CB CG2 sing N N 345 THR CB HB sing N N 346 THR OG1 HG1 sing N N 347 THR CG2 HG21 sing N N 348 THR CG2 HG22 sing N N 349 THR CG2 HG23 sing N N 350 THR OXT HXT sing N N 351 TYR N CA sing N N 352 TYR N H sing N N 353 TYR N H2 sing N N 354 TYR CA C sing N N 355 TYR CA CB sing N N 356 TYR CA HA sing N N 357 TYR C O doub N N 358 TYR C OXT sing N N 359 TYR CB CG sing N N 360 TYR CB HB2 sing N N 361 TYR CB HB3 sing N N 362 TYR CG CD1 doub Y N 363 TYR CG CD2 sing Y N 364 TYR CD1 CE1 sing Y N 365 TYR CD1 HD1 sing N N 366 TYR CD2 CE2 doub Y N 367 TYR CD2 HD2 sing N N 368 TYR CE1 CZ doub Y N 369 TYR CE1 HE1 sing N N 370 TYR CE2 CZ sing Y N 371 TYR CE2 HE2 sing N N 372 TYR CZ OH sing N N 373 TYR OH HH sing N N 374 TYR OXT HXT sing N N 375 VAL N CA sing N N 376 VAL N H sing N N 377 VAL N H2 sing N N 378 VAL CA C sing N N 379 VAL CA CB sing N N 380 VAL CA HA sing N N 381 VAL C O doub N N 382 VAL C OXT sing N N 383 VAL CB CG1 sing N N 384 VAL CB CG2 sing N N 385 VAL CB HB sing N N 386 VAL CG1 HG11 sing N N 387 VAL CG1 HG12 sing N N 388 VAL CG1 HG13 sing N N 389 VAL CG2 HG21 sing N N 390 VAL CG2 HG22 sing N N 391 VAL CG2 HG23 sing N N 392 VAL OXT HXT sing N N 393 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Japan Society for the Promotion of Science (JSPS)' Japan 22K15049 1 'Japan Society for the Promotion of Science (JSPS)' Japan 22H05577 2 'Japan Agency for Medical Research and Development (AMED)' Japan JP21am0101071 3 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id BJB _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id BJB _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 '4-[1-(1,3-benzothiazol-6-ylsulfonyl)-5-chloro-indol-2-yl]butanoic acid' BJB 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1WM0 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #