data_8JNL # _entry.id 8JNL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.373 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8JNL pdb_00008jnl 10.2210/pdb8jnl/pdb WWPDB D_1300038334 ? ? EMDB EMD-33597 ? ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.details . _pdbx_database_related.db_id EMD-33597 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8JNL _pdbx_database_status.recvd_initial_deposition_date 2023-06-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'You, X.' 1 ? 'Zhang, X.' 2 ? 'Cheng, J.' 3 ? 'Xiao, Y.N.' 4 ? 'Sun, S.' 5 ? 'Sui, S.F.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of lateral hexamer of PBS-PSII-PSI-LHCs megacomplex at 6.3 Angstroms resolution.' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'You, X.' 1 ? primary 'Zhang, X.' 2 ? primary 'Cheng, J.' 3 ? primary 'Xiao, Y.N.' 4 ? primary 'Sun, S.' 5 ? primary 'Sui, S.F.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Psb34 _entity.formula_weight 9873.483 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAFVGSSVALTRAPTRVQLATKAATPRAVRGRRAASAAQMNMALESVVSSDAAFKALELINFVASKEGDFGGYLGPVLGL GSIAALIVFLSPPLKD ; _entity_poly.pdbx_seq_one_letter_code_can ;MAFVGSSVALTRAPTRVQLATKAATPRAVRGRRAASAAQMNMALESVVSSDAAFKALELINFVASKEGDFGGYLGPVLGL GSIAALIVFLSPPLKD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 PHE n 1 4 VAL n 1 5 GLY n 1 6 SER n 1 7 SER n 1 8 VAL n 1 9 ALA n 1 10 LEU n 1 11 THR n 1 12 ARG n 1 13 ALA n 1 14 PRO n 1 15 THR n 1 16 ARG n 1 17 VAL n 1 18 GLN n 1 19 LEU n 1 20 ALA n 1 21 THR n 1 22 LYS n 1 23 ALA n 1 24 ALA n 1 25 THR n 1 26 PRO n 1 27 ARG n 1 28 ALA n 1 29 VAL n 1 30 ARG n 1 31 GLY n 1 32 ARG n 1 33 ARG n 1 34 ALA n 1 35 ALA n 1 36 SER n 1 37 ALA n 1 38 ALA n 1 39 GLN n 1 40 MET n 1 41 ASN n 1 42 MET n 1 43 ALA n 1 44 LEU n 1 45 GLU n 1 46 SER n 1 47 VAL n 1 48 VAL n 1 49 SER n 1 50 SER n 1 51 ASP n 1 52 ALA n 1 53 ALA n 1 54 PHE n 1 55 LYS n 1 56 ALA n 1 57 LEU n 1 58 GLU n 1 59 LEU n 1 60 ILE n 1 61 ASN n 1 62 PHE n 1 63 VAL n 1 64 ALA n 1 65 SER n 1 66 LYS n 1 67 GLU n 1 68 GLY n 1 69 ASP n 1 70 PHE n 1 71 GLY n 1 72 GLY n 1 73 TYR n 1 74 LEU n 1 75 GLY n 1 76 PRO n 1 77 VAL n 1 78 LEU n 1 79 GLY n 1 80 LEU n 1 81 GLY n 1 82 SER n 1 83 ILE n 1 84 ALA n 1 85 ALA n 1 86 LEU n 1 87 ILE n 1 88 VAL n 1 89 PHE n 1 90 LEU n 1 91 SER n 1 92 PRO n 1 93 PRO n 1 94 LEU n 1 95 LYS n 1 96 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 96 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FVE85_2199 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Porphyridium purpureum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 35688 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Porphyridium purpureum' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 35688 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A5J4YZ83_PORPP _struct_ref.pdbx_db_accession A0A5J4YZ83 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAFVGSSVALTRAPTRVQLATKAATPRAVRGRRAASAAQMNMALESVVSSDAAFKALELINFVASKEGDFGGYLGPVLGL GSIAALIVFLSPPLKD ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8JNL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 96 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A5J4YZ83 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 96 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 96 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8JNL _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 8JNL _struct.title 'Psb34 from red algal Porphyridium purpureum.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8JNL _struct_keywords.text 'Psb34, PHOTOSYNTHESIS' _struct_keywords.pdbx_keywords PHOTOSYNTHESIS # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id TYR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 73 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 91 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id TYR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 73 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 91 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 8JNL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 PHE 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 SER 6 6 ? ? ? A . n A 1 7 SER 7 7 ? ? ? A . n A 1 8 VAL 8 8 ? ? ? A . n A 1 9 ALA 9 9 ? ? ? A . n A 1 10 LEU 10 10 ? ? ? A . n A 1 11 THR 11 11 ? ? ? A . n A 1 12 ARG 12 12 ? ? ? A . n A 1 13 ALA 13 13 ? ? ? A . n A 1 14 PRO 14 14 ? ? ? A . n A 1 15 THR 15 15 ? ? ? A . n A 1 16 ARG 16 16 ? ? ? A . n A 1 17 VAL 17 17 ? ? ? A . n A 1 18 GLN 18 18 ? ? ? A . n A 1 19 LEU 19 19 ? ? ? A . n A 1 20 ALA 20 20 ? ? ? A . n A 1 21 THR 21 21 ? ? ? A . n A 1 22 LYS 22 22 ? ? ? A . n A 1 23 ALA 23 23 ? ? ? A . n A 1 24 ALA 24 24 ? ? ? A . n A 1 25 THR 25 25 ? ? ? A . n A 1 26 PRO 26 26 ? ? ? A . n A 1 27 ARG 27 27 ? ? ? A . n A 1 28 ALA 28 28 ? ? ? A . n A 1 29 VAL 29 29 ? ? ? A . n A 1 30 ARG 30 30 ? ? ? A . n A 1 31 GLY 31 31 ? ? ? A . n A 1 32 ARG 32 32 ? ? ? A . n A 1 33 ARG 33 33 ? ? ? A . n A 1 34 ALA 34 34 ? ? ? A . n A 1 35 ALA 35 35 ? ? ? A . n A 1 36 SER 36 36 ? ? ? A . n A 1 37 ALA 37 37 ? ? ? A . n A 1 38 ALA 38 38 ? ? ? A . n A 1 39 GLN 39 39 ? ? ? A . n A 1 40 MET 40 40 ? ? ? A . n A 1 41 ASN 41 41 ? ? ? A . n A 1 42 MET 42 42 ? ? ? A . n A 1 43 ALA 43 43 ? ? ? A . n A 1 44 LEU 44 44 ? ? ? A . n A 1 45 GLU 45 45 ? ? ? A . n A 1 46 SER 46 46 ? ? ? A . n A 1 47 VAL 47 47 ? ? ? A . n A 1 48 VAL 48 48 ? ? ? A . n A 1 49 SER 49 49 ? ? ? A . n A 1 50 SER 50 50 ? ? ? A . n A 1 51 ASP 51 51 ? ? ? A . n A 1 52 ALA 52 52 ? ? ? A . n A 1 53 ALA 53 53 ? ? ? A . n A 1 54 PHE 54 54 ? ? ? A . n A 1 55 LYS 55 55 ? ? ? A . n A 1 56 ALA 56 56 ? ? ? A . n A 1 57 LEU 57 57 ? ? ? A . n A 1 58 GLU 58 58 ? ? ? A . n A 1 59 LEU 59 59 ? ? ? A . n A 1 60 ILE 60 60 ? ? ? A . n A 1 61 ASN 61 61 ? ? ? A . n A 1 62 PHE 62 62 ? ? ? A . n A 1 63 VAL 63 63 ? ? ? A . n A 1 64 ALA 64 64 ? ? ? A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ASP 96 96 96 ASP ASP A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email youxin0927@126.com _pdbx_contact_author.name_first Xin _pdbx_contact_author.name_last You _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9181-8646 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _em_3d_fitting.id 1 _em_3d_fitting.entry_id 8JNL _em_3d_fitting.method ? _em_3d_fitting.target_criteria ? _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_space ? _em_3d_fitting.ref_protocol ? # _em_3d_reconstruction.entry_id 8JNL _em_3d_reconstruction.id 1 _em_3d_reconstruction.method ? _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.details ? _em_3d_reconstruction.resolution 3.2 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.num_particles 762000 _em_3d_reconstruction.euler_angles_details ? _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.symmetry_type POINT # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.name ? _em_buffer.details ? _em_buffer.pH 7.6 # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.source NATURAL _em_entity_assembly.type CELL _em_entity_assembly.name 'PSII subunit Psb34 from Porphyridium purpureum.' _em_entity_assembly.details ? _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? _em_entity_assembly.entity_id_list 1 # _em_imaging.entry_id 8JNL _em_imaging.id 1 _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? _em_imaging.residual_tilt ? _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.specimen_holder_type ? _em_imaging.specimen_holder_model ? _em_imaging.details ? _em_imaging.date ? _em_imaging.accelerating_voltage 300 _em_imaging.illumination_mode 'SPOT SCAN' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_min 1000 _em_imaging.nominal_defocus_max 6000 _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_defocus_max ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.nominal_magnification ? _em_imaging.calibrated_magnification ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.citation_id ? _em_imaging.temperature ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_minimum ? _em_imaging.recording_temperature_maximum ? _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.specimen_id 1 _em_imaging.cryogen ? # _em_vitrification.entry_id 8JNL _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.cryogen_name ETHANE _em_vitrification.humidity ? _em_vitrification.temp ? _em_vitrification.chamber_temperature ? _em_vitrification.instrument ? _em_vitrification.method ? _em_vitrification.time_resolved_state ? _em_vitrification.citation_id ? _em_vitrification.details ? # _em_experiment.entry_id 8JNL _em_experiment.id 1 _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.aggregation_state CELL _em_experiment.entity_assembly_id 1 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LEU _pdbx_validate_close_contact.auth_seq_id_1 86 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 CD2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LEU _pdbx_validate_close_contact.auth_seq_id_2 90 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.51 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 70 ? ? 33.93 -117.97 2 1 TYR A 73 ? ? 89.98 -10.86 3 1 LYS A 95 ? ? 49.91 -130.03 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A PHE 3 ? A PHE 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A SER 6 ? A SER 6 7 1 Y 1 A SER 7 ? A SER 7 8 1 Y 1 A VAL 8 ? A VAL 8 9 1 Y 1 A ALA 9 ? A ALA 9 10 1 Y 1 A LEU 10 ? A LEU 10 11 1 Y 1 A THR 11 ? A THR 11 12 1 Y 1 A ARG 12 ? A ARG 12 13 1 Y 1 A ALA 13 ? A ALA 13 14 1 Y 1 A PRO 14 ? A PRO 14 15 1 Y 1 A THR 15 ? A THR 15 16 1 Y 1 A ARG 16 ? A ARG 16 17 1 Y 1 A VAL 17 ? A VAL 17 18 1 Y 1 A GLN 18 ? A GLN 18 19 1 Y 1 A LEU 19 ? A LEU 19 20 1 Y 1 A ALA 20 ? A ALA 20 21 1 Y 1 A THR 21 ? A THR 21 22 1 Y 1 A LYS 22 ? A LYS 22 23 1 Y 1 A ALA 23 ? A ALA 23 24 1 Y 1 A ALA 24 ? A ALA 24 25 1 Y 1 A THR 25 ? A THR 25 26 1 Y 1 A PRO 26 ? A PRO 26 27 1 Y 1 A ARG 27 ? A ARG 27 28 1 Y 1 A ALA 28 ? A ALA 28 29 1 Y 1 A VAL 29 ? A VAL 29 30 1 Y 1 A ARG 30 ? A ARG 30 31 1 Y 1 A GLY 31 ? A GLY 31 32 1 Y 1 A ARG 32 ? A ARG 32 33 1 Y 1 A ARG 33 ? A ARG 33 34 1 Y 1 A ALA 34 ? A ALA 34 35 1 Y 1 A ALA 35 ? A ALA 35 36 1 Y 1 A SER 36 ? A SER 36 37 1 Y 1 A ALA 37 ? A ALA 37 38 1 Y 1 A ALA 38 ? A ALA 38 39 1 Y 1 A GLN 39 ? A GLN 39 40 1 Y 1 A MET 40 ? A MET 40 41 1 Y 1 A ASN 41 ? A ASN 41 42 1 Y 1 A MET 42 ? A MET 42 43 1 Y 1 A ALA 43 ? A ALA 43 44 1 Y 1 A LEU 44 ? A LEU 44 45 1 Y 1 A GLU 45 ? A GLU 45 46 1 Y 1 A SER 46 ? A SER 46 47 1 Y 1 A VAL 47 ? A VAL 47 48 1 Y 1 A VAL 48 ? A VAL 48 49 1 Y 1 A SER 49 ? A SER 49 50 1 Y 1 A SER 50 ? A SER 50 51 1 Y 1 A ASP 51 ? A ASP 51 52 1 Y 1 A ALA 52 ? A ALA 52 53 1 Y 1 A ALA 53 ? A ALA 53 54 1 Y 1 A PHE 54 ? A PHE 54 55 1 Y 1 A LYS 55 ? A LYS 55 56 1 Y 1 A ALA 56 ? A ALA 56 57 1 Y 1 A LEU 57 ? A LEU 57 58 1 Y 1 A GLU 58 ? A GLU 58 59 1 Y 1 A LEU 59 ? A LEU 59 60 1 Y 1 A ILE 60 ? A ILE 60 61 1 Y 1 A ASN 61 ? A ASN 61 62 1 Y 1 A PHE 62 ? A PHE 62 63 1 Y 1 A VAL 63 ? A VAL 63 64 1 Y 1 A ALA 64 ? A ALA 64 # _em_ctf_correction.details ? _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.id 1 _em_ctf_correction.type 'PHASE FLIPPING ONLY' # _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.ncbi_tax_id 35688 _em_entity_assembly_naturalsource.organism 'Porphyridium purpureum' _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_image_processing.details ? _em_image_processing.id 1 _em_image_processing.image_recording_id 1 # _em_image_recording.average_exposure_time ? _em_image_recording.avg_electron_dose_per_subtomogram ? _em_image_recording.avg_electron_dose_per_image 35 _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K3 (6k x 4k)' _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # loop_ _em_software.category _em_software.details _em_software.id _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id _em_software.name _em_software.version 'PARTICLE SELECTION' ? 1 1 ? ? ? ? 'IMAGE ACQUISITION' ? 2 ? ? 1 ? ? MASKING ? 3 ? ? ? ? ? 'CTF CORRECTION' ? 4 1 ? ? ? ? 'LAYERLINE INDEXING' ? 5 ? ? ? ? ? 'DIFFRACTION INDEXING' ? 6 ? ? ? ? ? 'MODEL FITTING' ? 7 ? ? ? ? ? 'MODEL REFINEMENT' ? 8 ? ? ? ? ? OTHER ? 9 ? ? ? ? ? 'INITIAL EULER ASSIGNMENT' ? 10 1 ? ? ? ? 'FINAL EULER ASSIGNMENT' ? 11 1 ? ? ? ? CLASSIFICATION ? 12 1 ? ? ? ? RECONSTRUCTION ? 13 1 ? ? ? ? # _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details 'not applicable' #