data_8SQQ # _entry.id 8SQQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8SQQ pdb_00008sqq 10.2210/pdb8sqq/pdb WWPDB D_1000274280 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8SQQ _pdbx_database_status.recvd_initial_deposition_date 2023-05-04 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structure of Bacterioferritin (Bfr) from Brucella abortus (Apo Cubic Form 2, F16L mutant)' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lovell, S.' 1 0000-0002-3215-4472 primary 'Liu, L.' 2 0000-0003-0514-281X primary 'Battaile, K.P.' 3 0000-0003-0833-3259 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8SQQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 171.516 _cell.length_a_esd ? _cell.length_b 171.516 _cell.length_b_esd ? _cell.length_c 171.516 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 96 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8SQQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Bacterioferritin 18856.180 1 1.16.3.1 F16L ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 5 water nat water 18.015 29 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGSMKGEPKVIERLNEALLLELGAVNQYWLHYRLLNDWGYTRLAKKEREESIEEMHHADKLIDRIIFLEGFPNLQTVSP LRIGQNVKEVLEADLKGEYDARASYKESREICDKLGDYVSKQLFDELLADEEGHIDFLETQLDLLAKIGGERYGQLNAAP ADEAE ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGSMKGEPKVIERLNEALLLELGAVNQYWLHYRLLNDWGYTRLAKKEREESIEEMHHADKLIDRIIFLEGFPNLQTVSP LRIGQNVKEVLEADLKGEYDARASYKESREICDKLGDYVSKQLFDELLADEEGHIDFLETQLDLLAKIGGERYGQLNAAP ADEAE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 MET n 1 6 LYS n 1 7 GLY n 1 8 GLU n 1 9 PRO n 1 10 LYS n 1 11 VAL n 1 12 ILE n 1 13 GLU n 1 14 ARG n 1 15 LEU n 1 16 ASN n 1 17 GLU n 1 18 ALA n 1 19 LEU n 1 20 LEU n 1 21 LEU n 1 22 GLU n 1 23 LEU n 1 24 GLY n 1 25 ALA n 1 26 VAL n 1 27 ASN n 1 28 GLN n 1 29 TYR n 1 30 TRP n 1 31 LEU n 1 32 HIS n 1 33 TYR n 1 34 ARG n 1 35 LEU n 1 36 LEU n 1 37 ASN n 1 38 ASP n 1 39 TRP n 1 40 GLY n 1 41 TYR n 1 42 THR n 1 43 ARG n 1 44 LEU n 1 45 ALA n 1 46 LYS n 1 47 LYS n 1 48 GLU n 1 49 ARG n 1 50 GLU n 1 51 GLU n 1 52 SER n 1 53 ILE n 1 54 GLU n 1 55 GLU n 1 56 MET n 1 57 HIS n 1 58 HIS n 1 59 ALA n 1 60 ASP n 1 61 LYS n 1 62 LEU n 1 63 ILE n 1 64 ASP n 1 65 ARG n 1 66 ILE n 1 67 ILE n 1 68 PHE n 1 69 LEU n 1 70 GLU n 1 71 GLY n 1 72 PHE n 1 73 PRO n 1 74 ASN n 1 75 LEU n 1 76 GLN n 1 77 THR n 1 78 VAL n 1 79 SER n 1 80 PRO n 1 81 LEU n 1 82 ARG n 1 83 ILE n 1 84 GLY n 1 85 GLN n 1 86 ASN n 1 87 VAL n 1 88 LYS n 1 89 GLU n 1 90 VAL n 1 91 LEU n 1 92 GLU n 1 93 ALA n 1 94 ASP n 1 95 LEU n 1 96 LYS n 1 97 GLY n 1 98 GLU n 1 99 TYR n 1 100 ASP n 1 101 ALA n 1 102 ARG n 1 103 ALA n 1 104 SER n 1 105 TYR n 1 106 LYS n 1 107 GLU n 1 108 SER n 1 109 ARG n 1 110 GLU n 1 111 ILE n 1 112 CYS n 1 113 ASP n 1 114 LYS n 1 115 LEU n 1 116 GLY n 1 117 ASP n 1 118 TYR n 1 119 VAL n 1 120 SER n 1 121 LYS n 1 122 GLN n 1 123 LEU n 1 124 PHE n 1 125 ASP n 1 126 GLU n 1 127 LEU n 1 128 LEU n 1 129 ALA n 1 130 ASP n 1 131 GLU n 1 132 GLU n 1 133 GLY n 1 134 HIS n 1 135 ILE n 1 136 ASP n 1 137 PHE n 1 138 LEU n 1 139 GLU n 1 140 THR n 1 141 GLN n 1 142 LEU n 1 143 ASP n 1 144 LEU n 1 145 LEU n 1 146 ALA n 1 147 LYS n 1 148 ILE n 1 149 GLY n 1 150 GLY n 1 151 GLU n 1 152 ARG n 1 153 TYR n 1 154 GLY n 1 155 GLN n 1 156 LEU n 1 157 ASN n 1 158 ALA n 1 159 ALA n 1 160 PRO n 1 161 ALA n 1 162 ASP n 1 163 GLU n 1 164 ALA n 1 165 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 165 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'bfr, BAB2_0675' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Brucella abortus 2308' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 359391 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name BrabA.00028.a.A1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q2YKI4_BRUA2 _struct_ref.pdbx_db_accession Q2YKI4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKGEPKVIERLNEALFLELGAVNQYWLHYRLLNDWGYTRLAKKEREESIEEMHHADKLIDRIIFLEGFPNLQTVSPLRIG QNVKEVLEADLKGEYDARASYKESREICDKLGDYVSKQLFDELLADEEGHIDFLETQLDLLAKIGGERYGQLNAAPADEA E ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8SQQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 165 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2YKI4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 161 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8SQQ GLY A 1 ? UNP Q2YKI4 ? ? 'expression tag' -3 1 1 8SQQ PRO A 2 ? UNP Q2YKI4 ? ? 'expression tag' -2 2 1 8SQQ GLY A 3 ? UNP Q2YKI4 ? ? 'expression tag' -1 3 1 8SQQ SER A 4 ? UNP Q2YKI4 ? ? 'expression tag' 0 4 1 8SQQ LEU A 20 ? UNP Q2YKI4 PHE 16 'engineered mutation' 16 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8SQQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.79 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.87 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Berkeley G7: 1.5M ammonium sulfate, 5% (v/v) MPD, 100 mM sodium acetate pH 4.5, BrabA.00028.a.A1.PW39164 at 10 mg/mL. Plate: 10390, well G7 drop 2. Puck: PSL-1810, Cryo: 2.5M lithium sulfate ; _exptl_crystal_grow.pdbx_pH_range "'" _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-03-14 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double Crystal Si 111' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8SQQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.25 _reflns.d_resolution_low 42.88 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10780 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 38.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.00 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.209 _reflns.pdbx_Rpim_I_all 0.033 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 419133 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.206 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.25 _reflns_shell.d_res_low 2.32 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 39593 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 961 _reflns_shell.percent_possible_obs 100.0 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 41.2 _reflns_shell.pdbx_chi_squared 1.00 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.9 _reflns_shell.pdbx_Rrim_I_all 2.892 _reflns_shell.pdbx_Rpim_I_all 0.448 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.668 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.857 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8SQQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.25 _refine.ls_d_res_low 39.35 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10773 _refine.ls_number_reflns_R_free 520 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.94 _refine.ls_percent_reflns_R_free 4.83 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1917 _refine.ls_R_factor_R_free 0.2455 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1890 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.13 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.25 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.25 _refine_hist.d_res_low 39.35 _refine_hist.number_atoms_solvent 29 _refine_hist.number_atoms_total 1378 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1294 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 55 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 ? 1374 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.139 ? 1868 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.631 ? 510 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.045 ? 191 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.011 ? 240 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.25 2.48 . . 134 2477 100.00 . . . . 0.2204 . . . . . . . . . . . 0.2937 'X-RAY DIFFRACTION' 2.48 2.84 . . 126 2496 100.00 . . . . 0.2350 . . . . . . . . . . . 0.2883 'X-RAY DIFFRACTION' 2.84 3.57 . . 133 2556 100.00 . . . . 0.2163 . . . . . . . . . . . 0.2626 'X-RAY DIFFRACTION' 3.57 39.35 . . 127 2724 100.00 . . . . 0.1604 . . . . . . . . . . . 0.2183 # _struct.entry_id 8SQQ _struct.title 'Crystal Structure of Bacterioferritin (Bfr) from Brucella abortus (Apo Cubic Form 2, F16L mutant)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8SQQ _struct_keywords.text 'SSGCID, STRUCTURAL GENOMICS, SEATTLE STRUCTURAL GENOMICS CENTER FOR INFECTIOUS DISEASE, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 8 ? GLY A 40 ? GLU A 4 GLY A 36 1 ? 33 HELX_P HELX_P2 AA2 TYR A 41 ? LEU A 69 ? TYR A 37 LEU A 65 1 ? 29 HELX_P HELX_P3 AA3 ASN A 86 ? GLY A 116 ? ASN A 82 GLY A 112 1 ? 31 HELX_P HELX_P4 AA4 ASP A 117 ? GLY A 149 ? ASP A 113 GLY A 145 1 ? 33 HELX_P HELX_P5 AA5 GLY A 149 ? ASN A 157 ? GLY A 145 ASN A 153 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A MET 56 SD ? ? ? 1_555 F HEM . FE ? ? A MET 52 A HEM 205 1_555 ? ? ? ? ? ? ? 2.257 ? ? metalc2 metalc ? ? A MET 56 SD ? ? ? 1_555 F HEM . FE ? ? A MET 52 A HEM 205 13_555 ? ? ? ? ? ? ? 2.616 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 8SQQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.005830 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005830 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005830 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 ? ? ? A . n A 1 2 PRO 2 -2 ? ? ? A . n A 1 3 GLY 3 -1 ? ? ? A . n A 1 4 SER 4 0 0 SER SER A . n A 1 5 MET 5 1 1 MET MET A . n A 1 6 LYS 6 2 2 LYS LYS A . n A 1 7 GLY 7 3 3 GLY GLY A . n A 1 8 GLU 8 4 4 GLU GLU A . n A 1 9 PRO 9 5 5 PRO PRO A . n A 1 10 LYS 10 6 6 LYS LYS A . n A 1 11 VAL 11 7 7 VAL VAL A . n A 1 12 ILE 12 8 8 ILE ILE A . n A 1 13 GLU 13 9 9 GLU GLU A . n A 1 14 ARG 14 10 10 ARG ARG A . n A 1 15 LEU 15 11 11 LEU LEU A . n A 1 16 ASN 16 12 12 ASN ASN A . n A 1 17 GLU 17 13 13 GLU GLU A . n A 1 18 ALA 18 14 14 ALA ALA A . n A 1 19 LEU 19 15 15 LEU LEU A . n A 1 20 LEU 20 16 16 LEU LEU A . n A 1 21 LEU 21 17 17 LEU LEU A . n A 1 22 GLU 22 18 18 GLU GLU A . n A 1 23 LEU 23 19 19 LEU LEU A . n A 1 24 GLY 24 20 20 GLY GLY A . n A 1 25 ALA 25 21 21 ALA ALA A . n A 1 26 VAL 26 22 22 VAL VAL A . n A 1 27 ASN 27 23 23 ASN ASN A . n A 1 28 GLN 28 24 24 GLN GLN A . n A 1 29 TYR 29 25 25 TYR TYR A . n A 1 30 TRP 30 26 26 TRP TRP A . n A 1 31 LEU 31 27 27 LEU LEU A . n A 1 32 HIS 32 28 28 HIS HIS A . n A 1 33 TYR 33 29 29 TYR TYR A . n A 1 34 ARG 34 30 30 ARG ARG A . n A 1 35 LEU 35 31 31 LEU LEU A . n A 1 36 LEU 36 32 32 LEU LEU A . n A 1 37 ASN 37 33 33 ASN ASN A . n A 1 38 ASP 38 34 34 ASP ASP A . n A 1 39 TRP 39 35 35 TRP TRP A . n A 1 40 GLY 40 36 36 GLY GLY A . n A 1 41 TYR 41 37 37 TYR TYR A . n A 1 42 THR 42 38 38 THR THR A . n A 1 43 ARG 43 39 39 ARG ARG A . n A 1 44 LEU 44 40 40 LEU LEU A . n A 1 45 ALA 45 41 41 ALA ALA A . n A 1 46 LYS 46 42 42 LYS LYS A . n A 1 47 LYS 47 43 43 LYS LYS A . n A 1 48 GLU 48 44 44 GLU GLU A . n A 1 49 ARG 49 45 45 ARG ARG A . n A 1 50 GLU 50 46 46 GLU GLU A . n A 1 51 GLU 51 47 47 GLU GLU A . n A 1 52 SER 52 48 48 SER SER A . n A 1 53 ILE 53 49 49 ILE ILE A . n A 1 54 GLU 54 50 50 GLU GLU A . n A 1 55 GLU 55 51 51 GLU GLU A . n A 1 56 MET 56 52 52 MET MET A . n A 1 57 HIS 57 53 53 HIS HIS A . n A 1 58 HIS 58 54 54 HIS HIS A . n A 1 59 ALA 59 55 55 ALA ALA A . n A 1 60 ASP 60 56 56 ASP ASP A . n A 1 61 LYS 61 57 57 LYS LYS A . n A 1 62 LEU 62 58 58 LEU LEU A . n A 1 63 ILE 63 59 59 ILE ILE A . n A 1 64 ASP 64 60 60 ASP ASP A . n A 1 65 ARG 65 61 61 ARG ARG A . n A 1 66 ILE 66 62 62 ILE ILE A . n A 1 67 ILE 67 63 63 ILE ILE A . n A 1 68 PHE 68 64 64 PHE PHE A . n A 1 69 LEU 69 65 65 LEU LEU A . n A 1 70 GLU 70 66 66 GLU GLU A . n A 1 71 GLY 71 67 67 GLY GLY A . n A 1 72 PHE 72 68 68 PHE PHE A . n A 1 73 PRO 73 69 69 PRO PRO A . n A 1 74 ASN 74 70 70 ASN ASN A . n A 1 75 LEU 75 71 71 LEU LEU A . n A 1 76 GLN 76 72 72 GLN GLN A . n A 1 77 THR 77 73 73 THR THR A . n A 1 78 VAL 78 74 74 VAL VAL A . n A 1 79 SER 79 75 75 SER SER A . n A 1 80 PRO 80 76 76 PRO PRO A . n A 1 81 LEU 81 77 77 LEU LEU A . n A 1 82 ARG 82 78 78 ARG ARG A . n A 1 83 ILE 83 79 79 ILE ILE A . n A 1 84 GLY 84 80 80 GLY GLY A . n A 1 85 GLN 85 81 81 GLN GLN A . n A 1 86 ASN 86 82 82 ASN ASN A . n A 1 87 VAL 87 83 83 VAL VAL A . n A 1 88 LYS 88 84 84 LYS LYS A . n A 1 89 GLU 89 85 85 GLU GLU A . n A 1 90 VAL 90 86 86 VAL VAL A . n A 1 91 LEU 91 87 87 LEU LEU A . n A 1 92 GLU 92 88 88 GLU GLU A . n A 1 93 ALA 93 89 89 ALA ALA A . n A 1 94 ASP 94 90 90 ASP ASP A . n A 1 95 LEU 95 91 91 LEU LEU A . n A 1 96 LYS 96 92 92 LYS LYS A . n A 1 97 GLY 97 93 93 GLY GLY A . n A 1 98 GLU 98 94 94 GLU GLU A . n A 1 99 TYR 99 95 95 TYR TYR A . n A 1 100 ASP 100 96 96 ASP ASP A . n A 1 101 ALA 101 97 97 ALA ALA A . n A 1 102 ARG 102 98 98 ARG ARG A . n A 1 103 ALA 103 99 99 ALA ALA A . n A 1 104 SER 104 100 100 SER SER A . n A 1 105 TYR 105 101 101 TYR TYR A . n A 1 106 LYS 106 102 102 LYS LYS A . n A 1 107 GLU 107 103 103 GLU GLU A . n A 1 108 SER 108 104 104 SER SER A . n A 1 109 ARG 109 105 105 ARG ARG A . n A 1 110 GLU 110 106 106 GLU GLU A . n A 1 111 ILE 111 107 107 ILE ILE A . n A 1 112 CYS 112 108 108 CYS CYS A . n A 1 113 ASP 113 109 109 ASP ASP A . n A 1 114 LYS 114 110 110 LYS LYS A . n A 1 115 LEU 115 111 111 LEU LEU A . n A 1 116 GLY 116 112 112 GLY GLY A . n A 1 117 ASP 117 113 113 ASP ASP A . n A 1 118 TYR 118 114 114 TYR TYR A . n A 1 119 VAL 119 115 115 VAL VAL A . n A 1 120 SER 120 116 116 SER SER A . n A 1 121 LYS 121 117 117 LYS LYS A . n A 1 122 GLN 122 118 118 GLN GLN A . n A 1 123 LEU 123 119 119 LEU LEU A . n A 1 124 PHE 124 120 120 PHE PHE A . n A 1 125 ASP 125 121 121 ASP ASP A . n A 1 126 GLU 126 122 122 GLU GLU A . n A 1 127 LEU 127 123 123 LEU LEU A . n A 1 128 LEU 128 124 124 LEU LEU A . n A 1 129 ALA 129 125 125 ALA ALA A . n A 1 130 ASP 130 126 126 ASP ASP A . n A 1 131 GLU 131 127 127 GLU GLU A . n A 1 132 GLU 132 128 128 GLU GLU A . n A 1 133 GLY 133 129 129 GLY GLY A . n A 1 134 HIS 134 130 130 HIS HIS A . n A 1 135 ILE 135 131 131 ILE ILE A . n A 1 136 ASP 136 132 132 ASP ASP A . n A 1 137 PHE 137 133 133 PHE PHE A . n A 1 138 LEU 138 134 134 LEU LEU A . n A 1 139 GLU 139 135 135 GLU GLU A . n A 1 140 THR 140 136 136 THR THR A . n A 1 141 GLN 141 137 137 GLN GLN A . n A 1 142 LEU 142 138 138 LEU LEU A . n A 1 143 ASP 143 139 139 ASP ASP A . n A 1 144 LEU 144 140 140 LEU LEU A . n A 1 145 LEU 145 141 141 LEU LEU A . n A 1 146 ALA 146 142 142 ALA ALA A . n A 1 147 LYS 147 143 143 LYS LYS A . n A 1 148 ILE 148 144 144 ILE ILE A . n A 1 149 GLY 149 145 145 GLY GLY A . n A 1 150 GLY 150 146 146 GLY GLY A . n A 1 151 GLU 151 147 147 GLU GLU A . n A 1 152 ARG 152 148 148 ARG ARG A . n A 1 153 TYR 153 149 149 TYR TYR A . n A 1 154 GLY 154 150 150 GLY GLY A . n A 1 155 GLN 155 151 151 GLN GLN A . n A 1 156 LEU 156 152 152 LEU LEU A . n A 1 157 ASN 157 153 153 ASN ASN A . n A 1 158 ALA 158 154 154 ALA ALA A . n A 1 159 ALA 159 155 155 ALA ALA A . n A 1 160 PRO 160 156 156 PRO PRO A . n A 1 161 ALA 161 157 157 ALA ALA A . n A 1 162 ASP 162 158 158 ASP ASP A . n A 1 163 GLU 163 159 159 GLU GLU A . n A 1 164 ALA 164 160 ? ? ? A . n A 1 165 GLU 165 161 ? ? ? A . n # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 swlovell@ku.edu Scott Lovell ? 'principal investigator/group leader' 0000-0002-3215-4472 3 isabelle.phan@seattlechildrens.org Isabelle Phan ? 'principal investigator/group leader' 0000-0001-6873-3401 4 julie.early@seattlechildrens.org Julie Early ? 'principal investigator/group leader' 0000-0003-1224-2747 5 peter.myler@seattlechildrens.org Peter Myler ? 'principal investigator/group leader' 0000-0002-0056-0513 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 201 2 CL CL A . C 2 CL 1 202 3 CL CL A . D 3 SO4 1 203 2 SO4 SO4 A . E 3 SO4 1 204 3 SO4 SO4 A . F 4 HEM 1 205 1 HEM HEM A . G 5 HOH 1 301 14 HOH HOH A . G 5 HOH 2 302 16 HOH HOH A . G 5 HOH 3 303 24 HOH HOH A . G 5 HOH 4 304 2 HOH HOH A . G 5 HOH 5 305 21 HOH HOH A . G 5 HOH 6 306 25 HOH HOH A . G 5 HOH 7 307 27 HOH HOH A . G 5 HOH 8 308 15 HOH HOH A . G 5 HOH 9 309 9 HOH HOH A . G 5 HOH 10 310 19 HOH HOH A . G 5 HOH 11 311 6 HOH HOH A . G 5 HOH 12 312 29 HOH HOH A . G 5 HOH 13 313 18 HOH HOH A . G 5 HOH 14 314 1 HOH HOH A . G 5 HOH 15 315 12 HOH HOH A . G 5 HOH 16 316 5 HOH HOH A . G 5 HOH 17 317 8 HOH HOH A . G 5 HOH 18 318 23 HOH HOH A . G 5 HOH 19 319 11 HOH HOH A . G 5 HOH 20 320 3 HOH HOH A . G 5 HOH 21 321 17 HOH HOH A . G 5 HOH 22 322 7 HOH HOH A . G 5 HOH 23 323 26 HOH HOH A . G 5 HOH 24 324 20 HOH HOH A . G 5 HOH 25 325 13 HOH HOH A . G 5 HOH 26 326 4 HOH HOH A . G 5 HOH 27 327 10 HOH HOH A . G 5 HOH 28 328 22 HOH HOH A . G 5 HOH 29 329 28 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 85740 ? 1 MORE -1141 ? 1 'SSA (A^2)' 136720 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 13 'crystal symmetry operation' 13_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 14 'crystal symmetry operation' 14_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 15 'crystal symmetry operation' 15_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_555 x,z,-y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 18_555 -x,z,y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_555 -x,-z,-y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 20_555 x,-z,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_555 z,y,-x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 22 'crystal symmetry operation' 22_555 z,-y,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_555 -z,y,x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 24 'crystal symmetry operation' 24_555 -z,-y,-x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CL 201 ? B CL . 2 1 A CL 202 ? C CL . 3 1 A SO4 204 ? E SO4 . 4 1 A HEM 205 ? F HEM . 5 1 A HEM 205 ? F HEM . 6 1 A HOH 306 ? G HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SD ? A MET 56 ? A MET 52 ? 1_555 FE ? F HEM . ? A HEM 205 ? 1_555 NA ? F HEM . ? A HEM 205 ? 1_555 85.4 ? 2 SD ? A MET 56 ? A MET 52 ? 1_555 FE ? F HEM . ? A HEM 205 ? 1_555 NB ? F HEM . ? A HEM 205 ? 1_555 95.2 ? 3 NA ? F HEM . ? A HEM 205 ? 1_555 FE ? F HEM . ? A HEM 205 ? 1_555 NB ? F HEM . ? A HEM 205 ? 1_555 90.7 ? 4 SD ? A MET 56 ? A MET 52 ? 1_555 FE ? F HEM . ? A HEM 205 ? 1_555 NC ? F HEM . ? A HEM 205 ? 1_555 99.7 ? 5 NA ? F HEM . ? A HEM 205 ? 1_555 FE ? F HEM . ? A HEM 205 ? 1_555 NC ? F HEM . ? A HEM 205 ? 1_555 172.6 ? 6 NB ? F HEM . ? A HEM 205 ? 1_555 FE ? F HEM . ? A HEM 205 ? 1_555 NC ? F HEM . ? A HEM 205 ? 1_555 94.2 ? 7 SD ? A MET 56 ? A MET 52 ? 1_555 FE ? F HEM . ? A HEM 205 ? 1_555 ND ? F HEM . ? A HEM 205 ? 1_555 86.8 ? 8 NA ? F HEM . ? A HEM 205 ? 1_555 FE ? F HEM . ? A HEM 205 ? 1_555 ND ? F HEM . ? A HEM 205 ? 1_555 86.2 ? 9 NB ? F HEM . ? A HEM 205 ? 1_555 FE ? F HEM . ? A HEM 205 ? 1_555 ND ? F HEM . ? A HEM 205 ? 1_555 176.1 ? 10 NC ? F HEM . ? A HEM 205 ? 1_555 FE ? F HEM . ? A HEM 205 ? 1_555 ND ? F HEM . ? A HEM 205 ? 1_555 88.7 ? 11 SD ? A MET 56 ? A MET 52 ? 1_555 FE ? F HEM . ? A HEM 205 ? 1_555 SD ? A MET 56 ? A MET 52 ? 1_555 0.0 ? 12 NA ? F HEM . ? A HEM 205 ? 1_555 FE ? F HEM . ? A HEM 205 ? 1_555 SD ? A MET 56 ? A MET 52 ? 1_555 85.4 ? 13 NB ? F HEM . ? A HEM 205 ? 1_555 FE ? F HEM . ? A HEM 205 ? 1_555 SD ? A MET 56 ? A MET 52 ? 1_555 95.2 ? 14 NC ? F HEM . ? A HEM 205 ? 1_555 FE ? F HEM . ? A HEM 205 ? 1_555 SD ? A MET 56 ? A MET 52 ? 1_555 99.7 ? 15 ND ? F HEM . ? A HEM 205 ? 1_555 FE ? F HEM . ? A HEM 205 ? 1_555 SD ? A MET 56 ? A MET 52 ? 1_555 86.8 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-05-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 32.5183 30.8267 6.6633 0.3608 ? -0.1139 ? -0.0745 ? 0.3564 ? 0.0430 ? 0.4280 ? 2.4187 ? -3.6997 ? -2.3752 ? 5.7017 ? 3.8987 ? 3.6382 ? -0.1896 ? -0.1968 ? -0.1243 ? -0.0539 ? 0.1386 ? 0.4494 ? -0.0774 ? 0.2285 ? 0.1198 ? 2 'X-RAY DIFFRACTION' ? refined 41.7021 26.5848 15.0650 0.3373 ? -0.0854 ? -0.0462 ? 0.4800 ? -0.0321 ? 0.4507 ? 0.9994 ? -1.8343 ? -1.3762 ? 3.4019 ? 2.7057 ? 2.4387 ? 0.0415 ? -0.1363 ? 0.1957 ? 0.0625 ? 0.0742 ? -0.1146 ? -0.1665 ? 0.1940 ? -0.1308 ? 3 'X-RAY DIFFRACTION' ? refined 44.3968 6.6980 -2.1382 0.2391 ? -0.0334 ? 0.0159 ? 0.3990 ? 0.0237 ? 0.3889 ? 1.9244 ? 0.7731 ? 2.1957 ? 6.2423 ? 2.8807 ? 3.5457 ? -0.2871 ? 0.0588 ? 0.1247 ? -0.0594 ? 0.0295 ? -0.0722 ? -0.0982 ? -0.1670 ? 0.2146 ? 4 'X-RAY DIFFRACTION' ? refined 37.3698 33.5578 7.3231 0.3415 ? -0.0793 ? -0.0529 ? 0.4345 ? -0.0203 ? 0.5169 ? 2.4150 ? -2.1894 ? -2.5993 ? 4.4024 ? 2.5946 ? 3.4203 ? -0.2139 ? -0.3933 ? 0.0933 ? -0.0548 ? 0.1824 ? 0.3402 ? -0.2957 ? 0.5354 ? 0.0078 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 36 through 74 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 75 through 144 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 145 through 159 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 0 through 35 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.21rc1_4933: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 8SQQ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 110 ? CG ? A LYS 114 CG 2 1 Y 1 A LYS 110 ? CD ? A LYS 114 CD 3 1 Y 1 A LYS 110 ? CE ? A LYS 114 CE 4 1 Y 1 A LYS 110 ? NZ ? A LYS 114 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -3 ? A GLY 1 2 1 Y 1 A PRO -2 ? A PRO 2 3 1 Y 1 A GLY -1 ? A GLY 3 4 1 Y 1 A ALA 160 ? A ALA 164 5 1 Y 1 A GLU 161 ? A GLU 165 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' HHSN272201700059C 1 'National Institutes of Health/Office of the Director' 'United States' S10OD030394 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HEM _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HEM _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 'SULFATE ION' SO4 4 'PROTOPORPHYRIN IX CONTAINING FE' HEM 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3FVB _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #