data_8USS
#
_entry.id 8USS
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 5.397
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
loop_
_database_2.database_id
_database_2.database_code
_database_2.pdbx_database_accession
_database_2.pdbx_DOI
PDB 8USS pdb_00008uss 10.2210/pdb8uss/pdb
WWPDB D_1000278569 ? ?
#
loop_
_pdbx_audit_revision_history.ordinal
_pdbx_audit_revision_history.data_content_type
_pdbx_audit_revision_history.major_revision
_pdbx_audit_revision_history.minor_revision
_pdbx_audit_revision_history.revision_date
1 'Structure model' 1 0 2024-04-03
2 'Structure model' 1 1 2024-04-17
3 'Structure model' 1 2 2024-05-01
4 'Structure model' 1 3 2024-10-09
#
_pdbx_audit_revision_details.ordinal 1
_pdbx_audit_revision_details.revision_ordinal 1
_pdbx_audit_revision_details.data_content_type 'Structure model'
_pdbx_audit_revision_details.provider repository
_pdbx_audit_revision_details.type 'Initial release'
_pdbx_audit_revision_details.description ?
_pdbx_audit_revision_details.details ?
#
loop_
_pdbx_audit_revision_group.ordinal
_pdbx_audit_revision_group.revision_ordinal
_pdbx_audit_revision_group.data_content_type
_pdbx_audit_revision_group.group
1 2 'Structure model' 'Database references'
2 3 'Structure model' 'Database references'
3 4 'Structure model' 'Structure summary'
#
loop_
_pdbx_audit_revision_category.ordinal
_pdbx_audit_revision_category.revision_ordinal
_pdbx_audit_revision_category.data_content_type
_pdbx_audit_revision_category.category
1 2 'Structure model' citation
2 2 'Structure model' citation_author
3 3 'Structure model' citation
4 3 'Structure model' citation_author
5 4 'Structure model' pdbx_entry_details
6 4 'Structure model' pdbx_modification_feature
#
loop_
_pdbx_audit_revision_item.ordinal
_pdbx_audit_revision_item.revision_ordinal
_pdbx_audit_revision_item.data_content_type
_pdbx_audit_revision_item.item
1 2 'Structure model' '_citation.pdbx_database_id_PubMed'
2 2 'Structure model' '_citation.title'
3 3 'Structure model' '_citation.journal_volume'
4 3 'Structure model' '_citation.page_first'
5 3 'Structure model' '_citation.page_last'
6 3 'Structure model' '_citation_author.identifier_ORCID'
7 4 'Structure model' '_pdbx_entry_details.has_protein_modification'
#
_pdbx_database_status.status_code REL
_pdbx_database_status.status_code_sf REL
_pdbx_database_status.status_code_mr ?
_pdbx_database_status.entry_id 8USS
_pdbx_database_status.recvd_initial_deposition_date 2023-10-29
_pdbx_database_status.SG_entry N
_pdbx_database_status.deposit_site RCSB
_pdbx_database_status.process_site RCSB
_pdbx_database_status.status_code_cs ?
_pdbx_database_status.status_code_nmr_data ?
_pdbx_database_status.methods_development_category ?
_pdbx_database_status.pdb_format_compatible Y
#
_pdbx_contact_author.id 3
_pdbx_contact_author.email maria.argiriadi@abbvie.com
_pdbx_contact_author.name_first Maria
_pdbx_contact_author.name_last Argiriadi
_pdbx_contact_author.name_mi ?
_pdbx_contact_author.role 'principal investigator/group leader'
_pdbx_contact_author.identifier_ORCID 0000-0001-5813-5758
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
_audit_author.identifier_ORCID
'Argiriadi, M.A.' 1 0000-0001-5813-5758
'Ramos, A.L.' 2 0009-0009-8824-9807
#
_citation.abstract ?
_citation.abstract_id_CAS ?
_citation.book_id_ISBN ?
_citation.book_publisher ?
_citation.book_publisher_city ?
_citation.book_title ?
_citation.coordinate_linkage ?
_citation.country US
_citation.database_id_Medline ?
_citation.details ?
_citation.id primary
_citation.journal_abbrev J.Med.Chem.
_citation.journal_id_ASTM JMCMAR
_citation.journal_id_CSD 0151
_citation.journal_id_ISSN 0022-2623
_citation.journal_full ?
_citation.journal_issue ?
_citation.journal_volume 67
_citation.language ?
_citation.page_first 6456
_citation.page_last 6494
_citation.title
;Discovery of Small Molecule Interleukin 17A Inhibitors with Novel Binding Mode and Stoichiometry: Optimization of DNA-Encoded Chemical Library Hits to In Vivo Active Compounds.
;
_citation.year 2024
_citation.database_id_CSD ?
_citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.3c02397
_citation.pdbx_database_id_PubMed 38574366
_citation.pdbx_database_id_patent ?
_citation.unpublished_flag ?
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
_citation_author.identifier_ORCID
primary 'Ramos, A.L.' 1 0009-0009-8824-9807
primary 'Goedken, E.R.' 2 ?
primary 'Frank, K.E.' 3 0000-0001-7915-8334
primary 'Argiriadi, M.A.' 4 ?
primary 'Bazzaz, S.' 5 ?
primary 'Bian, Z.' 6 ?
primary 'Brown, J.T.C.' 7 ?
primary 'Centrella, P.A.' 8 ?
primary 'Chen, H.J.' 9 ?
primary 'Disch, J.S.' 10 0000-0002-0357-1672
primary 'Donner, P.L.' 11 ?
primary 'Duignan, D.B.' 12 ?
primary 'Gikunju, D.' 13 ?
primary 'Greszler, S.N.' 14 0000-0003-1993-2417
primary 'Guie, M.A.' 15 ?
primary 'Habeshian, S.' 16 ?
primary 'Hartl, H.E.' 17 ?
primary 'Hein, C.D.' 18 ?
primary 'Hutchins, C.W.' 19 ?
primary 'Jetson, R.' 20 ?
primary 'Keefe, A.D.' 21 ?
primary 'Khan, H.' 22 ?
primary 'Li, H.Q.' 23 ?
primary 'Olszewski, A.' 24 ?
primary 'Ortiz Cardona, B.J.' 25 0000-0001-5016-9427
primary 'Osuma, A.' 26 ?
primary 'Panchal, S.C.' 27 ?
primary 'Phelan, R.' 28 0000-0002-7462-8787
primary 'Qiu, W.' 29 ?
primary 'Shotwell, J.B.' 30 0000-0002-7758-146X
primary 'Shrestha, A.' 31 ?
primary 'Srikumaran, M.' 32 ?
primary 'Su, Z.' 33 ?
primary 'Sun, C.' 34 ?
primary 'Upadhyay, A.K.' 35 ?
primary 'Wood, M.D.' 36 ?
primary 'Wu, H.' 37 ?
primary 'Zhang, R.' 38 0000-0002-7251-5527
primary 'Zhang, Y.' 39 ?
primary 'Zhao, G.' 40 ?
primary 'Zhu, H.' 41 ?
primary 'Webster, M.P.' 42 0000-0002-0205-1819
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.pdbx_ec
_entity.pdbx_mutation
_entity.pdbx_fragment
_entity.details
1 polymer man Interleukin-17A 14537.343 1 ? ? ? ?
2 non-polymer syn
;4,5-dichloro-N-[(1S)-1-cyclohexyl-2-{[(3S)-5-methyl-4-oxo-2,3,4,5-tetrahydro-1,5-benzoxazepin-3-yl]amino}-2-oxoethyl]-1H-pyrrole-2-carboxamide
;
493.383 1 ? ? ? ?
3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ?
4 water nat water 18.015 72 ? ? ? ?
#
_entity_name_com.entity_id 1
_entity_name_com.name 'IL-17,IL-17A,Cytotoxic T-lymphocyte-associated antigen 8,CTLA-8'
#
_entity_poly.entity_id 1
_entity_poly.type 'polypeptide(L)'
_entity_poly.nstd_linkage no
_entity_poly.nstd_monomer no
_entity_poly.pdbx_seq_one_letter_code
;GSAMAPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDY
HMNSVPIQQEILVLRREPPHSPNSFRLEKILVSVGCTCVTPIVHHVA
;
_entity_poly.pdbx_seq_one_letter_code_can
;GSAMAPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDY
HMNSVPIQQEILVLRREPPHSPNSFRLEKILVSVGCTCVTPIVHHVA
;
_entity_poly.pdbx_strand_id A
_entity_poly.pdbx_target_identifier ?
#
loop_
_pdbx_entity_nonpoly.entity_id
_pdbx_entity_nonpoly.name
_pdbx_entity_nonpoly.comp_id
2
;4,5-dichloro-N-[(1S)-1-cyclohexyl-2-{[(3S)-5-methyl-4-oxo-2,3,4,5-tetrahydro-1,5-benzoxazepin-3-yl]amino}-2-oxoethyl]-1H-pyrrole-2-carboxamide
;
XCW
3 'CHLORIDE ION' CL
4 water HOH
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 GLY n
1 2 SER n
1 3 ALA n
1 4 MET n
1 5 ALA n
1 6 PRO n
1 7 ASN n
1 8 SER n
1 9 GLU n
1 10 ASP n
1 11 LYS n
1 12 ASN n
1 13 PHE n
1 14 PRO n
1 15 ARG n
1 16 THR n
1 17 VAL n
1 18 MET n
1 19 VAL n
1 20 ASN n
1 21 LEU n
1 22 ASN n
1 23 ILE n
1 24 HIS n
1 25 ASN n
1 26 ARG n
1 27 ASN n
1 28 THR n
1 29 ASN n
1 30 THR n
1 31 ASN n
1 32 PRO n
1 33 LYS n
1 34 ARG n
1 35 SER n
1 36 SER n
1 37 ASP n
1 38 TYR n
1 39 TYR n
1 40 ASN n
1 41 ARG n
1 42 SER n
1 43 THR n
1 44 SER n
1 45 PRO n
1 46 TRP n
1 47 ASN n
1 48 LEU n
1 49 HIS n
1 50 ARG n
1 51 ASN n
1 52 GLU n
1 53 ASP n
1 54 PRO n
1 55 GLU n
1 56 ARG n
1 57 TYR n
1 58 PRO n
1 59 SER n
1 60 VAL n
1 61 ILE n
1 62 TRP n
1 63 GLU n
1 64 ALA n
1 65 LYS n
1 66 CYS n
1 67 ARG n
1 68 HIS n
1 69 LEU n
1 70 GLY n
1 71 CYS n
1 72 ILE n
1 73 ASN n
1 74 ALA n
1 75 ASP n
1 76 GLY n
1 77 ASN n
1 78 VAL n
1 79 ASP n
1 80 TYR n
1 81 HIS n
1 82 MET n
1 83 ASN n
1 84 SER n
1 85 VAL n
1 86 PRO n
1 87 ILE n
1 88 GLN n
1 89 GLN n
1 90 GLU n
1 91 ILE n
1 92 LEU n
1 93 VAL n
1 94 LEU n
1 95 ARG n
1 96 ARG n
1 97 GLU n
1 98 PRO n
1 99 PRO n
1 100 HIS n
1 101 SER n
1 102 PRO n
1 103 ASN n
1 104 SER n
1 105 PHE n
1 106 ARG n
1 107 LEU n
1 108 GLU n
1 109 LYS n
1 110 ILE n
1 111 LEU n
1 112 VAL n
1 113 SER n
1 114 VAL n
1 115 GLY n
1 116 CYS n
1 117 THR n
1 118 CYS n
1 119 VAL n
1 120 THR n
1 121 PRO n
1 122 ILE n
1 123 VAL n
1 124 HIS n
1 125 HIS n
1 126 VAL n
1 127 ALA n
#
_entity_src_gen.entity_id 1
_entity_src_gen.pdbx_src_id 1
_entity_src_gen.pdbx_alt_source_flag sample
_entity_src_gen.pdbx_seq_type 'Biological sequence'
_entity_src_gen.pdbx_beg_seq_num 1
_entity_src_gen.pdbx_end_seq_num 127
_entity_src_gen.gene_src_common_name human
_entity_src_gen.gene_src_genus ?
_entity_src_gen.pdbx_gene_src_gene 'IL17A, CTLA8, IL17'
_entity_src_gen.gene_src_species ?
_entity_src_gen.gene_src_strain ?
_entity_src_gen.gene_src_tissue ?
_entity_src_gen.gene_src_tissue_fraction ?
_entity_src_gen.gene_src_details ?
_entity_src_gen.pdbx_gene_src_fragment ?
_entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens'
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606
_entity_src_gen.pdbx_gene_src_variant ?
_entity_src_gen.pdbx_gene_src_cell_line ?
_entity_src_gen.pdbx_gene_src_atcc ?
_entity_src_gen.pdbx_gene_src_organ ?
_entity_src_gen.pdbx_gene_src_organelle ?
_entity_src_gen.pdbx_gene_src_cell ?
_entity_src_gen.pdbx_gene_src_cellular_location ?
_entity_src_gen.host_org_common_name ?
_entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli'
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562
_entity_src_gen.host_org_genus ?
_entity_src_gen.pdbx_host_org_gene ?
_entity_src_gen.pdbx_host_org_organ ?
_entity_src_gen.host_org_species ?
_entity_src_gen.pdbx_host_org_tissue ?
_entity_src_gen.pdbx_host_org_tissue_fraction ?
_entity_src_gen.pdbx_host_org_strain ?
_entity_src_gen.pdbx_host_org_variant ?
_entity_src_gen.pdbx_host_org_cell_line ?
_entity_src_gen.pdbx_host_org_atcc ?
_entity_src_gen.pdbx_host_org_culture_collection ?
_entity_src_gen.pdbx_host_org_cell ?
_entity_src_gen.pdbx_host_org_organelle ?
_entity_src_gen.pdbx_host_org_cellular_location ?
_entity_src_gen.pdbx_host_org_vector_type ?
_entity_src_gen.pdbx_host_org_vector ?
_entity_src_gen.host_org_details ?
_entity_src_gen.expression_system_id ?
_entity_src_gen.plasmid_name ?
_entity_src_gen.plasmid_details ?
_entity_src_gen.pdbx_description ?
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103
CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129
GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162
HOH non-polymer . WATER ? 'H2 O' 18.015
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146
XCW non-polymer .
;4,5-dichloro-N-[(1S)-1-cyclohexyl-2-{[(3S)-5-methyl-4-oxo-2,3,4,5-tetrahydro-1,5-benzoxazepin-3-yl]amino}-2-oxoethyl]-1H-pyrrole-2-carboxamide
;
? 'C23 H26 Cl2 N4 O4' 493.383
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.ndb_seq_num
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
_pdbx_poly_seq_scheme.hetero
A 1 1 GLY 1 29 ? ? ? A . n
A 1 2 SER 2 30 ? ? ? A . n
A 1 3 ALA 3 31 ? ? ? A . n
A 1 4 MET 4 32 ? ? ? A . n
A 1 5 ALA 5 33 ? ? ? A . n
A 1 6 PRO 6 34 ? ? ? A . n
A 1 7 ASN 7 35 ? ? ? A . n
A 1 8 SER 8 36 ? ? ? A . n
A 1 9 GLU 9 37 ? ? ? A . n
A 1 10 ASP 10 38 ? ? ? A . n
A 1 11 LYS 11 39 ? ? ? A . n
A 1 12 ASN 12 40 ? ? ? A . n
A 1 13 PHE 13 41 ? ? ? A . n
A 1 14 PRO 14 42 ? ? ? A . n
A 1 15 ARG 15 43 43 ARG ARG A . n
A 1 16 THR 16 44 44 THR THR A . n
A 1 17 VAL 17 45 45 VAL VAL A . n
A 1 18 MET 18 46 46 MET MET A . n
A 1 19 VAL 19 47 47 VAL VAL A . n
A 1 20 ASN 20 48 48 ASN ASN A . n
A 1 21 LEU 21 49 49 LEU LEU A . n
A 1 22 ASN 22 50 50 ASN ASN A . n
A 1 23 ILE 23 51 51 ILE ILE A . n
A 1 24 HIS 24 52 52 HIS HIS A . n
A 1 25 ASN 25 53 53 ASN ASN A . n
A 1 26 ARG 26 54 54 ARG ARG A . n
A 1 27 ASN 27 55 55 ASN ASN A . n
A 1 28 THR 28 56 56 THR THR A . n
A 1 29 ASN 29 57 57 ASN ASN A . n
A 1 30 THR 30 58 58 THR THR A . n
A 1 31 ASN 31 59 59 ASN ASN A . n
A 1 32 PRO 32 60 60 PRO PRO A . n
A 1 33 LYS 33 61 61 LYS LYS A . n
A 1 34 ARG 34 62 62 ARG ARG A . n
A 1 35 SER 35 63 63 SER SER A . n
A 1 36 SER 36 64 64 SER SER A . n
A 1 37 ASP 37 65 65 ASP ASP A . n
A 1 38 TYR 38 66 66 TYR TYR A . n
A 1 39 TYR 39 67 67 TYR TYR A . n
A 1 40 ASN 40 68 68 ASN ASN A . n
A 1 41 ARG 41 69 69 ARG ARG A . n
A 1 42 SER 42 70 70 SER SER A . n
A 1 43 THR 43 71 71 THR THR A . n
A 1 44 SER 44 72 72 SER SER A . n
A 1 45 PRO 45 73 73 PRO PRO A . n
A 1 46 TRP 46 74 74 TRP TRP A . n
A 1 47 ASN 47 75 75 ASN ASN A . n
A 1 48 LEU 48 76 76 LEU LEU A . n
A 1 49 HIS 49 77 77 HIS HIS A . n
A 1 50 ARG 50 78 78 ARG ARG A . n
A 1 51 ASN 51 79 79 ASN ASN A . n
A 1 52 GLU 52 80 80 GLU GLU A . n
A 1 53 ASP 53 81 81 ASP ASP A . n
A 1 54 PRO 54 82 82 PRO PRO A . n
A 1 55 GLU 55 83 83 GLU GLU A . n
A 1 56 ARG 56 84 84 ARG ARG A . n
A 1 57 TYR 57 85 85 TYR TYR A . n
A 1 58 PRO 58 86 86 PRO PRO A . n
A 1 59 SER 59 87 87 SER SER A . n
A 1 60 VAL 60 88 88 VAL VAL A . n
A 1 61 ILE 61 89 89 ILE ILE A . n
A 1 62 TRP 62 90 90 TRP TRP A . n
A 1 63 GLU 63 91 91 GLU GLU A . n
A 1 64 ALA 64 92 92 ALA ALA A . n
A 1 65 LYS 65 93 93 LYS LYS A . n
A 1 66 CYS 66 94 94 CYS CYS A . n
A 1 67 ARG 67 95 95 ARG ARG A . n
A 1 68 HIS 68 96 96 HIS HIS A . n
A 1 69 LEU 69 97 97 LEU LEU A . n
A 1 70 GLY 70 98 98 GLY GLY A . n
A 1 71 CYS 71 99 99 CYS CYS A . n
A 1 72 ILE 72 100 100 ILE ILE A . n
A 1 73 ASN 73 101 101 ASN ASN A . n
A 1 74 ALA 74 102 102 ALA ALA A . n
A 1 75 ASP 75 103 103 ASP ASP A . n
A 1 76 GLY 76 104 104 GLY GLY A . n
A 1 77 ASN 77 105 105 ASN ASN A . n
A 1 78 VAL 78 106 106 VAL VAL A . n
A 1 79 ASP 79 107 107 ASP ASP A . n
A 1 80 TYR 80 108 108 TYR TYR A . n
A 1 81 HIS 81 109 109 HIS HIS A . n
A 1 82 MET 82 110 110 MET MET A . n
A 1 83 ASN 83 111 111 ASN ASN A . n
A 1 84 SER 84 112 112 SER SER A . n
A 1 85 VAL 85 113 113 VAL VAL A . n
A 1 86 PRO 86 114 114 PRO PRO A . n
A 1 87 ILE 87 115 115 ILE ILE A . n
A 1 88 GLN 88 116 116 GLN GLN A . n
A 1 89 GLN 89 117 117 GLN GLN A . n
A 1 90 GLU 90 118 118 GLU GLU A . n
A 1 91 ILE 91 119 119 ILE ILE A . n
A 1 92 LEU 92 120 120 LEU LEU A . n
A 1 93 VAL 93 121 121 VAL VAL A . n
A 1 94 LEU 94 122 122 LEU LEU A . n
A 1 95 ARG 95 123 123 ARG ARG A . n
A 1 96 ARG 96 124 124 ARG ARG A . n
A 1 97 GLU 97 125 125 GLU GLU A . n
A 1 98 PRO 98 126 126 PRO PRO A . n
A 1 99 PRO 99 127 127 PRO PRO A . n
A 1 100 HIS 100 128 ? ? ? A . n
A 1 101 SER 101 129 ? ? ? A . n
A 1 102 PRO 102 130 ? ? ? A . n
A 1 103 ASN 103 131 ? ? ? A . n
A 1 104 SER 104 132 ? ? ? A . n
A 1 105 PHE 105 133 ? ? ? A . n
A 1 106 ARG 106 134 134 ARG ARG A . n
A 1 107 LEU 107 135 135 LEU LEU A . n
A 1 108 GLU 108 136 136 GLU GLU A . n
A 1 109 LYS 109 137 137 LYS LYS A . n
A 1 110 ILE 110 138 138 ILE ILE A . n
A 1 111 LEU 111 139 139 LEU LEU A . n
A 1 112 VAL 112 140 140 VAL VAL A . n
A 1 113 SER 113 141 141 SER SER A . n
A 1 114 VAL 114 142 142 VAL VAL A . n
A 1 115 GLY 115 143 143 GLY GLY A . n
A 1 116 CYS 116 144 144 CYS CYS A . n
A 1 117 THR 117 145 145 THR THR A . n
A 1 118 CYS 118 146 146 CYS CYS A . n
A 1 119 VAL 119 147 147 VAL VAL A . n
A 1 120 THR 120 148 148 THR THR A . n
A 1 121 PRO 121 149 149 PRO PRO A . n
A 1 122 ILE 122 150 150 ILE ILE A . n
A 1 123 VAL 123 151 151 VAL VAL A . n
A 1 124 HIS 124 152 152 HIS HIS A . n
A 1 125 HIS 125 153 153 HIS HIS A . n
A 1 126 VAL 126 154 154 VAL VAL A . n
A 1 127 ALA 127 155 155 ALA ALA A . n
#
_pdbx_entity_instance_feature.ordinal 1
_pdbx_entity_instance_feature.comp_id XCW
_pdbx_entity_instance_feature.asym_id ?
_pdbx_entity_instance_feature.seq_num ?
_pdbx_entity_instance_feature.auth_comp_id XCW
_pdbx_entity_instance_feature.auth_asym_id ?
_pdbx_entity_instance_feature.auth_seq_num ?
_pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION'
_pdbx_entity_instance_feature.details ?
#
loop_
_pdbx_nonpoly_scheme.asym_id
_pdbx_nonpoly_scheme.entity_id
_pdbx_nonpoly_scheme.mon_id
_pdbx_nonpoly_scheme.ndb_seq_num
_pdbx_nonpoly_scheme.pdb_seq_num
_pdbx_nonpoly_scheme.auth_seq_num
_pdbx_nonpoly_scheme.pdb_mon_id
_pdbx_nonpoly_scheme.auth_mon_id
_pdbx_nonpoly_scheme.pdb_strand_id
_pdbx_nonpoly_scheme.pdb_ins_code
B 2 XCW 1 201 1 XCW UNL A .
C 3 CL 1 202 1 CL CL A .
D 4 HOH 1 301 50 HOH HOH A .
D 4 HOH 2 302 73 HOH HOH A .
D 4 HOH 3 303 65 HOH HOH A .
D 4 HOH 4 304 66 HOH HOH A .
D 4 HOH 5 305 60 HOH HOH A .
D 4 HOH 6 306 69 HOH HOH A .
D 4 HOH 7 307 42 HOH HOH A .
D 4 HOH 8 308 45 HOH HOH A .
D 4 HOH 9 309 43 HOH HOH A .
D 4 HOH 10 310 71 HOH HOH A .
D 4 HOH 11 311 44 HOH HOH A .
D 4 HOH 12 312 28 HOH HOH A .
D 4 HOH 13 313 19 HOH HOH A .
D 4 HOH 14 314 70 HOH HOH A .
D 4 HOH 15 315 7 HOH HOH A .
D 4 HOH 16 316 10 HOH HOH A .
D 4 HOH 17 317 6 HOH HOH A .
D 4 HOH 18 318 30 HOH HOH A .
D 4 HOH 19 319 24 HOH HOH A .
D 4 HOH 20 320 61 HOH HOH A .
D 4 HOH 21 321 54 HOH HOH A .
D 4 HOH 22 322 72 HOH HOH A .
D 4 HOH 23 323 63 HOH HOH A .
D 4 HOH 24 324 14 HOH HOH A .
D 4 HOH 25 325 2 HOH HOH A .
D 4 HOH 26 326 1 HOH HOH A .
D 4 HOH 27 327 15 HOH HOH A .
D 4 HOH 28 328 46 HOH HOH A .
D 4 HOH 29 329 3 HOH HOH A .
D 4 HOH 30 330 62 HOH HOH A .
D 4 HOH 31 331 4 HOH HOH A .
D 4 HOH 32 332 67 HOH HOH A .
D 4 HOH 33 333 8 HOH HOH A .
D 4 HOH 34 334 23 HOH HOH A .
D 4 HOH 35 335 49 HOH HOH A .
D 4 HOH 36 336 34 HOH HOH A .
D 4 HOH 37 337 17 HOH HOH A .
D 4 HOH 38 338 47 HOH HOH A .
D 4 HOH 39 339 22 HOH HOH A .
D 4 HOH 40 340 12 HOH HOH A .
D 4 HOH 41 341 38 HOH HOH A .
D 4 HOH 42 342 40 HOH HOH A .
D 4 HOH 43 343 36 HOH HOH A .
D 4 HOH 44 344 21 HOH HOH A .
D 4 HOH 45 345 37 HOH HOH A .
D 4 HOH 46 346 27 HOH HOH A .
D 4 HOH 47 347 51 HOH HOH A .
D 4 HOH 48 348 41 HOH HOH A .
D 4 HOH 49 349 5 HOH HOH A .
D 4 HOH 50 350 20 HOH HOH A .
D 4 HOH 51 351 25 HOH HOH A .
D 4 HOH 52 352 9 HOH HOH A .
D 4 HOH 53 353 11 HOH HOH A .
D 4 HOH 54 354 57 HOH HOH A .
D 4 HOH 55 355 33 HOH HOH A .
D 4 HOH 56 356 13 HOH HOH A .
D 4 HOH 57 357 48 HOH HOH A .
D 4 HOH 58 358 53 HOH HOH A .
D 4 HOH 59 359 18 HOH HOH A .
D 4 HOH 60 360 16 HOH HOH A .
D 4 HOH 61 361 39 HOH HOH A .
D 4 HOH 62 362 55 HOH HOH A .
D 4 HOH 63 363 59 HOH HOH A .
D 4 HOH 64 364 52 HOH HOH A .
D 4 HOH 65 365 35 HOH HOH A .
D 4 HOH 66 366 56 HOH HOH A .
D 4 HOH 67 367 32 HOH HOH A .
D 4 HOH 68 368 26 HOH HOH A .
D 4 HOH 69 369 31 HOH HOH A .
D 4 HOH 70 370 29 HOH HOH A .
D 4 HOH 71 371 58 HOH HOH A .
D 4 HOH 72 372 68 HOH HOH A .
#
loop_
_pdbx_unobs_or_zero_occ_atoms.id
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num
_pdbx_unobs_or_zero_occ_atoms.polymer_flag
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id
_pdbx_unobs_or_zero_occ_atoms.label_alt_id
_pdbx_unobs_or_zero_occ_atoms.label_asym_id
_pdbx_unobs_or_zero_occ_atoms.label_comp_id
_pdbx_unobs_or_zero_occ_atoms.label_seq_id
_pdbx_unobs_or_zero_occ_atoms.label_atom_id
1 1 Y 1 A ARG 43 ? CG ? A ARG 15 CG
2 1 Y 1 A ARG 43 ? CD ? A ARG 15 CD
3 1 Y 1 A ARG 43 ? NE ? A ARG 15 NE
4 1 Y 1 A ARG 43 ? CZ ? A ARG 15 CZ
5 1 Y 1 A ARG 43 ? NH1 ? A ARG 15 NH1
6 1 Y 1 A ARG 43 ? NH2 ? A ARG 15 NH2
7 1 Y 1 A THR 44 ? OG1 ? A THR 16 OG1
8 1 Y 1 A THR 44 ? CG2 ? A THR 16 CG2
9 1 Y 1 A VAL 45 ? CG1 ? A VAL 17 CG1
10 1 Y 1 A VAL 45 ? CG2 ? A VAL 17 CG2
11 1 Y 1 A HIS 52 ? CG ? A HIS 24 CG
12 1 Y 1 A HIS 52 ? ND1 ? A HIS 24 ND1
13 1 Y 1 A HIS 52 ? CD2 ? A HIS 24 CD2
14 1 Y 1 A HIS 52 ? CE1 ? A HIS 24 CE1
15 1 Y 1 A HIS 52 ? NE2 ? A HIS 24 NE2
16 1 Y 1 A ARG 62 ? CG ? A ARG 34 CG
17 1 Y 1 A ARG 62 ? CD ? A ARG 34 CD
18 1 Y 1 A ARG 62 ? NE ? A ARG 34 NE
19 1 Y 1 A ARG 62 ? CZ ? A ARG 34 CZ
20 1 Y 1 A ARG 62 ? NH1 ? A ARG 34 NH1
21 1 Y 1 A ARG 62 ? NH2 ? A ARG 34 NH2
22 1 Y 1 A GLU 125 ? CG ? A GLU 97 CG
23 1 Y 1 A GLU 125 ? CD ? A GLU 97 CD
24 1 Y 1 A GLU 125 ? OE1 ? A GLU 97 OE1
25 1 Y 1 A GLU 125 ? OE2 ? A GLU 97 OE2
#
loop_
_software.citation_id
_software.classification
_software.compiler_name
_software.compiler_version
_software.contact_author
_software.contact_author_email
_software.date
_software.description
_software.dependencies
_software.hardware
_software.language
_software.location
_software.mods
_software.name
_software.os
_software.os_version
_software.type
_software.version
_software.pdbx_ordinal
? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1
? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? v7.0 2
? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 4
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 5
#
_cell.angle_alpha 90.000
_cell.angle_alpha_esd ?
_cell.angle_beta 90.000
_cell.angle_beta_esd ?
_cell.angle_gamma 90.000
_cell.angle_gamma_esd ?
_cell.entry_id 8USS
_cell.details ?
_cell.formula_units_Z ?
_cell.length_a 36.600
_cell.length_a_esd ?
_cell.length_b 50.380
_cell.length_b_esd ?
_cell.length_c 157.360
_cell.length_c_esd ?
_cell.volume 290157.363
_cell.volume_esd ?
_cell.Z_PDB 8
_cell.reciprocal_angle_alpha ?
_cell.reciprocal_angle_beta ?
_cell.reciprocal_angle_gamma ?
_cell.reciprocal_angle_alpha_esd ?
_cell.reciprocal_angle_beta_esd ?
_cell.reciprocal_angle_gamma_esd ?
_cell.reciprocal_length_a ?
_cell.reciprocal_length_b ?
_cell.reciprocal_length_c ?
_cell.reciprocal_length_a_esd ?
_cell.reciprocal_length_b_esd ?
_cell.reciprocal_length_c_esd ?
_cell.pdbx_unique_axis ?
_cell.pdbx_esd_method ?
#
_symmetry.entry_id 8USS
_symmetry.cell_setting ?
_symmetry.Int_Tables_number 23
_symmetry.space_group_name_Hall 'I 2 2'
_symmetry.space_group_name_H-M 'I 2 2 2'
_symmetry.pdbx_full_space_group_name_H-M ?
#
_exptl.absorpt_coefficient_mu ?
_exptl.absorpt_correction_T_max ?
_exptl.absorpt_correction_T_min ?
_exptl.absorpt_correction_type ?
_exptl.absorpt_process_details ?
_exptl.entry_id 8USS
_exptl.crystals_number 1
_exptl.details ?
_exptl.method 'X-RAY DIFFRACTION'
_exptl.method_details ?
#
_exptl_crystal.colour ?
_exptl_crystal.density_diffrn ?
_exptl_crystal.density_Matthews 2.48
_exptl_crystal.density_method ?
_exptl_crystal.density_percent_sol 50.46
_exptl_crystal.description ?
_exptl_crystal.F_000 ?
_exptl_crystal.id 1
_exptl_crystal.preparation ?
_exptl_crystal.size_max ?
_exptl_crystal.size_mid ?
_exptl_crystal.size_min ?
_exptl_crystal.size_rad ?
_exptl_crystal.colour_lustre ?
_exptl_crystal.colour_modifier ?
_exptl_crystal.colour_primary ?
_exptl_crystal.density_meas ?
_exptl_crystal.density_meas_esd ?
_exptl_crystal.density_meas_gt ?
_exptl_crystal.density_meas_lt ?
_exptl_crystal.density_meas_temp ?
_exptl_crystal.density_meas_temp_esd ?
_exptl_crystal.density_meas_temp_gt ?
_exptl_crystal.density_meas_temp_lt ?
_exptl_crystal.pdbx_crystal_image_url ?
_exptl_crystal.pdbx_crystal_image_format ?
_exptl_crystal.pdbx_mosaicity ?
_exptl_crystal.pdbx_mosaicity_esd ?
_exptl_crystal.pdbx_mosaic_method ?
_exptl_crystal.pdbx_mosaic_block_size ?
_exptl_crystal.pdbx_mosaic_block_size_esd ?
#
_exptl_crystal_grow.apparatus ?
_exptl_crystal_grow.atmosphere ?
_exptl_crystal_grow.crystal_id 1
_exptl_crystal_grow.details ?
_exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP'
_exptl_crystal_grow.method_ref ?
_exptl_crystal_grow.pH ?
_exptl_crystal_grow.pressure ?
_exptl_crystal_grow.pressure_esd ?
_exptl_crystal_grow.seeding ?
_exptl_crystal_grow.seeding_ref ?
_exptl_crystal_grow.temp_details ?
_exptl_crystal_grow.temp_esd ?
_exptl_crystal_grow.time ?
_exptl_crystal_grow.pdbx_details '15% w/v PEG 8K, 0.2 M MgCl2, 0.1 M Tris pH 8.5'
_exptl_crystal_grow.pdbx_pH_range ?
_exptl_crystal_grow.temp 296
#
_diffrn.ambient_environment ?
_diffrn.ambient_temp 100
_diffrn.ambient_temp_details ?
_diffrn.ambient_temp_esd ?
_diffrn.crystal_id 1
_diffrn.crystal_support ?
_diffrn.crystal_treatment ?
_diffrn.details ?
_diffrn.id 1
_diffrn.ambient_pressure ?
_diffrn.ambient_pressure_esd ?
_diffrn.ambient_pressure_gt ?
_diffrn.ambient_pressure_lt ?
_diffrn.ambient_temp_gt ?
_diffrn.ambient_temp_lt ?
_diffrn.pdbx_serial_crystal_experiment N
#
_diffrn_detector.details ?
_diffrn_detector.detector PIXEL
_diffrn_detector.diffrn_id 1
_diffrn_detector.type 'DECTRIS PILATUS 6M'
_diffrn_detector.area_resol_mean ?
_diffrn_detector.dtime ?
_diffrn_detector.pdbx_frames_total ?
_diffrn_detector.pdbx_collection_time_total ?
_diffrn_detector.pdbx_collection_date 2018-02-14
_diffrn_detector.pdbx_frequency ?
_diffrn_detector.id ?
_diffrn_detector.number_of_axes ?
#
_diffrn_radiation.collimation ?
_diffrn_radiation.diffrn_id 1
_diffrn_radiation.filter_edge ?
_diffrn_radiation.inhomogeneity ?
_diffrn_radiation.monochromator ?
_diffrn_radiation.polarisn_norm ?
_diffrn_radiation.polarisn_ratio ?
_diffrn_radiation.probe ?
_diffrn_radiation.type ?
_diffrn_radiation.xray_symbol ?
_diffrn_radiation.wavelength_id 1
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l M
_diffrn_radiation.pdbx_wavelength_list ?
_diffrn_radiation.pdbx_wavelength ?
_diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH'
_diffrn_radiation.pdbx_analyzer ?
_diffrn_radiation.pdbx_scattering_type x-ray
#
_diffrn_radiation_wavelength.id 1
_diffrn_radiation_wavelength.wavelength 1.00
_diffrn_radiation_wavelength.wt 1.0
#
_diffrn_source.current ?
_diffrn_source.details ?
_diffrn_source.diffrn_id 1
_diffrn_source.power ?
_diffrn_source.size ?
_diffrn_source.source SYNCHROTRON
_diffrn_source.target ?
_diffrn_source.type 'APS BEAMLINE 17-ID'
_diffrn_source.voltage ?
_diffrn_source.take-off_angle ?
_diffrn_source.pdbx_wavelength_list 1.00
_diffrn_source.pdbx_wavelength ?
_diffrn_source.pdbx_synchrotron_beamline 17-ID
_diffrn_source.pdbx_synchrotron_site APS
#
_reflns.B_iso_Wilson_estimate 20.53
_reflns.entry_id 8USS
_reflns.data_reduction_details ?
_reflns.data_reduction_method ?
_reflns.d_resolution_high 1.465
_reflns.d_resolution_low 78.7
_reflns.details ?
_reflns.limit_h_max ?
_reflns.limit_h_min ?
_reflns.limit_k_max ?
_reflns.limit_k_min ?
_reflns.limit_l_max ?
_reflns.limit_l_min ?
_reflns.number_all ?
_reflns.number_obs 21942
_reflns.observed_criterion ?
_reflns.observed_criterion_F_max ?
_reflns.observed_criterion_F_min ?
_reflns.observed_criterion_I_max ?
_reflns.observed_criterion_I_min ?
_reflns.observed_criterion_sigma_F ?
_reflns.observed_criterion_sigma_I ?
_reflns.percent_possible_obs 85.6
_reflns.R_free_details ?
_reflns.Rmerge_F_all ?
_reflns.Rmerge_F_obs ?
_reflns.Friedel_coverage ?
_reflns.number_gt ?
_reflns.threshold_expression ?
_reflns.pdbx_redundancy 5.1
_reflns.pdbx_netI_over_av_sigmaI ?
_reflns.pdbx_netI_over_sigmaI 21.9
_reflns.pdbx_res_netI_over_av_sigmaI_2 ?
_reflns.pdbx_res_netI_over_sigmaI_2 ?
_reflns.pdbx_chi_squared ?
_reflns.pdbx_scaling_rejects ?
_reflns.pdbx_d_res_high_opt ?
_reflns.pdbx_d_res_low_opt ?
_reflns.pdbx_d_res_opt_method ?
_reflns.phase_calculation_details ?
_reflns.pdbx_Rrim_I_all ?
_reflns.pdbx_Rpim_I_all ?
_reflns.pdbx_d_opt ?
_reflns.pdbx_number_measured_all ?
_reflns.pdbx_diffrn_id 1
_reflns.pdbx_ordinal 1
_reflns.pdbx_CC_half 1.0
_reflns.pdbx_CC_star ?
_reflns.pdbx_R_split ?
_reflns.pdbx_Rmerge_I_obs ?
_reflns.pdbx_Rmerge_I_all ?
_reflns.pdbx_Rsym_value 0.04
_reflns.pdbx_CC_split_method ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_1 ?
_reflns.pdbx_aniso_diffraction_limit_2 ?
_reflns.pdbx_aniso_diffraction_limit_3 ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_1 ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_2 ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_3 ?
_reflns.pdbx_orthogonalization_convention ?
_reflns.pdbx_percent_possible_ellipsoidal ?
_reflns.pdbx_percent_possible_spherical ?
_reflns.pdbx_percent_possible_ellipsoidal_anomalous ?
_reflns.pdbx_percent_possible_spherical_anomalous ?
_reflns.pdbx_redundancy_anomalous ?
_reflns.pdbx_CC_half_anomalous ?
_reflns.pdbx_absDiff_over_sigma_anomalous ?
_reflns.pdbx_percent_possible_anomalous ?
_reflns.pdbx_observed_signal_threshold ?
_reflns.pdbx_signal_type ?
_reflns.pdbx_signal_details ?
_reflns.pdbx_signal_software_id ?
#
_reflns_shell.d_res_high 1.465
_reflns_shell.d_res_low 1.526
_reflns_shell.meanI_over_sigI_all ?
_reflns_shell.meanI_over_sigI_obs ?
_reflns_shell.number_measured_all ?
_reflns_shell.number_measured_obs ?
_reflns_shell.number_possible ?
_reflns_shell.number_unique_all ?
_reflns_shell.number_unique_obs 1098
_reflns_shell.percent_possible_obs ?
_reflns_shell.Rmerge_F_all ?
_reflns_shell.Rmerge_F_obs ?
_reflns_shell.meanI_over_sigI_gt ?
_reflns_shell.meanI_over_uI_all ?
_reflns_shell.meanI_over_uI_gt ?
_reflns_shell.number_measured_gt ?
_reflns_shell.number_unique_gt ?
_reflns_shell.percent_possible_gt ?
_reflns_shell.Rmerge_F_gt ?
_reflns_shell.Rmerge_I_gt ?
_reflns_shell.pdbx_redundancy ?
_reflns_shell.pdbx_chi_squared ?
_reflns_shell.pdbx_netI_over_sigmaI_all ?
_reflns_shell.pdbx_netI_over_sigmaI_obs ?
_reflns_shell.pdbx_Rrim_I_all ?
_reflns_shell.pdbx_Rpim_I_all ?
_reflns_shell.pdbx_rejects ?
_reflns_shell.pdbx_ordinal 1
_reflns_shell.pdbx_diffrn_id 1
_reflns_shell.pdbx_CC_half 0.88
_reflns_shell.pdbx_CC_star ?
_reflns_shell.pdbx_R_split ?
_reflns_shell.percent_possible_all ?
_reflns_shell.Rmerge_I_all ?
_reflns_shell.Rmerge_I_obs ?
_reflns_shell.pdbx_Rsym_value 0.269
_reflns_shell.pdbx_percent_possible_ellipsoidal ?
_reflns_shell.pdbx_percent_possible_spherical ?
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ?
_reflns_shell.pdbx_percent_possible_spherical_anomalous ?
_reflns_shell.pdbx_redundancy_anomalous ?
_reflns_shell.pdbx_CC_half_anomalous ?
_reflns_shell.pdbx_absDiff_over_sigma_anomalous ?
_reflns_shell.pdbx_percent_possible_anomalous ?
#
_refine.aniso_B[1][1] ?
_refine.aniso_B[1][2] ?
_refine.aniso_B[1][3] ?
_refine.aniso_B[2][2] ?
_refine.aniso_B[2][3] ?
_refine.aniso_B[3][3] ?
_refine.B_iso_max ?
_refine.B_iso_mean 29.22
_refine.B_iso_min ?
_refine.correlation_coeff_Fo_to_Fc ?
_refine.correlation_coeff_Fo_to_Fc_free ?
_refine.details ?
_refine.diff_density_max ?
_refine.diff_density_max_esd ?
_refine.diff_density_min ?
_refine.diff_density_min_esd ?
_refine.diff_density_rms ?
_refine.diff_density_rms_esd ?
_refine.entry_id 8USS
_refine.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine.ls_abs_structure_details ?
_refine.ls_abs_structure_Flack ?
_refine.ls_abs_structure_Flack_esd ?
_refine.ls_abs_structure_Rogers ?
_refine.ls_abs_structure_Rogers_esd ?
_refine.ls_d_res_high 1.47
_refine.ls_d_res_low 15.78
_refine.ls_extinction_coef ?
_refine.ls_extinction_coef_esd ?
_refine.ls_extinction_expression ?
_refine.ls_extinction_method ?
_refine.ls_goodness_of_fit_all ?
_refine.ls_goodness_of_fit_all_esd ?
_refine.ls_goodness_of_fit_obs ?
_refine.ls_goodness_of_fit_obs_esd ?
_refine.ls_hydrogen_treatment ?
_refine.ls_matrix_type ?
_refine.ls_number_constraints ?
_refine.ls_number_parameters ?
_refine.ls_number_reflns_all ?
_refine.ls_number_reflns_obs 21830
_refine.ls_number_reflns_R_free 1053
_refine.ls_number_reflns_R_work 20777
_refine.ls_number_restraints ?
_refine.ls_percent_reflns_obs 86.33
_refine.ls_percent_reflns_R_free 4.82
_refine.ls_R_factor_all ?
_refine.ls_R_factor_obs 0.2220
_refine.ls_R_factor_R_free 0.2355
_refine.ls_R_factor_R_free_error ?
_refine.ls_R_factor_R_free_error_details ?
_refine.ls_R_factor_R_work 0.2214
_refine.ls_R_Fsqd_factor_obs ?
_refine.ls_R_I_factor_obs ?
_refine.ls_redundancy_reflns_all ?
_refine.ls_redundancy_reflns_obs ?
_refine.ls_restrained_S_all ?
_refine.ls_restrained_S_obs ?
_refine.ls_shift_over_esd_max ?
_refine.ls_shift_over_esd_mean ?
_refine.ls_structure_factor_coef ?
_refine.ls_weighting_details ?
_refine.ls_weighting_scheme ?
_refine.ls_wR_factor_all ?
_refine.ls_wR_factor_obs ?
_refine.ls_wR_factor_R_free ?
_refine.ls_wR_factor_R_work ?
_refine.occupancy_max ?
_refine.occupancy_min ?
_refine.solvent_model_details 'FLAT BULK SOLVENT MODEL'
_refine.solvent_model_param_bsol ?
_refine.solvent_model_param_ksol ?
_refine.pdbx_R_complete ?
_refine.ls_R_factor_gt ?
_refine.ls_goodness_of_fit_gt ?
_refine.ls_goodness_of_fit_ref ?
_refine.ls_shift_over_su_max ?
_refine.ls_shift_over_su_max_lt ?
_refine.ls_shift_over_su_mean ?
_refine.ls_shift_over_su_mean_lt ?
_refine.pdbx_ls_sigma_I ?
_refine.pdbx_ls_sigma_F 0.32
_refine.pdbx_ls_sigma_Fsqd ?
_refine.pdbx_data_cutoff_high_absF ?
_refine.pdbx_data_cutoff_high_rms_absF ?
_refine.pdbx_data_cutoff_low_absF ?
_refine.pdbx_isotropic_thermal_model ?
_refine.pdbx_ls_cross_valid_method 'FREE R-VALUE'
_refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT'
_refine.pdbx_starting_model ?
_refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2'
_refine.pdbx_R_Free_selection_details ?
_refine.pdbx_stereochem_target_val_spec_case ?
_refine.pdbx_overall_ESU_R ?
_refine.pdbx_overall_ESU_R_Free ?
_refine.pdbx_solvent_vdw_probe_radii 1.1000
_refine.pdbx_solvent_ion_probe_radii ?
_refine.pdbx_solvent_shrinkage_radii 0.9000
_refine.pdbx_real_space_R ?
_refine.pdbx_density_correlation ?
_refine.pdbx_pd_number_of_powder_patterns ?
_refine.pdbx_pd_number_of_points ?
_refine.pdbx_pd_meas_number_of_points ?
_refine.pdbx_pd_proc_ls_prof_R_factor ?
_refine.pdbx_pd_proc_ls_prof_wR_factor ?
_refine.pdbx_pd_Marquardt_correlation_coeff ?
_refine.pdbx_pd_Fsqrd_R_factor ?
_refine.pdbx_pd_ls_matrix_band_width ?
_refine.pdbx_overall_phase_error 27.7431
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI ?
_refine.pdbx_overall_SU_R_free_Blow_DPI ?
_refine.pdbx_overall_SU_R_Blow_DPI ?
_refine.pdbx_TLS_residual_ADP_flag ?
_refine.pdbx_diffrn_id 1
_refine.overall_SU_B ?
_refine.overall_SU_ML 0.1811
_refine.overall_SU_R_Cruickshank_DPI ?
_refine.overall_SU_R_free ?
_refine.overall_FOM_free_R_set ?
_refine.overall_FOM_work_R_set ?
_refine.pdbx_average_fsc_overall ?
_refine.pdbx_average_fsc_work ?
_refine.pdbx_average_fsc_free ?
#
_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_hist.cycle_id LAST
_refine_hist.details ?
_refine_hist.d_res_high 1.47
_refine_hist.d_res_low 15.78
_refine_hist.number_atoms_solvent 72
_refine_hist.number_atoms_total 950
_refine_hist.number_reflns_all ?
_refine_hist.number_reflns_obs ?
_refine_hist.number_reflns_R_free ?
_refine_hist.number_reflns_R_work ?
_refine_hist.R_factor_all ?
_refine_hist.R_factor_obs ?
_refine_hist.R_factor_R_free ?
_refine_hist.R_factor_R_work ?
_refine_hist.pdbx_number_residues_total ?
_refine_hist.pdbx_B_iso_mean_ligand ?
_refine_hist.pdbx_B_iso_mean_solvent ?
_refine_hist.pdbx_number_atoms_protein 844
_refine_hist.pdbx_number_atoms_nucleic_acid 0
_refine_hist.pdbx_number_atoms_ligand 34
_refine_hist.pdbx_number_atoms_lipid ?
_refine_hist.pdbx_number_atoms_carb ?
_refine_hist.pdbx_pseudo_atom_details ?
#
loop_
_refine_ls_restr.pdbx_refine_id
_refine_ls_restr.criterion
_refine_ls_restr.dev_ideal
_refine_ls_restr.dev_ideal_target
_refine_ls_restr.number
_refine_ls_restr.rejects
_refine_ls_restr.type
_refine_ls_restr.weight
_refine_ls_restr.pdbx_restraint_function
'X-RAY DIFFRACTION' ? 0.0227 ? 914 ? f_bond_d ? ?
'X-RAY DIFFRACTION' ? 2.0923 ? 1254 ? f_angle_d ? ?
'X-RAY DIFFRACTION' ? 0.1503 ? 136 ? f_chiral_restr ? ?
'X-RAY DIFFRACTION' ? 0.0148 ? 170 ? f_plane_restr ? ?
'X-RAY DIFFRACTION' ? 15.2871 ? 327 ? f_dihedral_angle_d ? ?
#
loop_
_refine_ls_shell.pdbx_refine_id
_refine_ls_shell.d_res_high
_refine_ls_shell.d_res_low
_refine_ls_shell.number_reflns_all
_refine_ls_shell.number_reflns_obs
_refine_ls_shell.number_reflns_R_free
_refine_ls_shell.number_reflns_R_work
_refine_ls_shell.percent_reflns_obs
_refine_ls_shell.percent_reflns_R_free
_refine_ls_shell.R_factor_all
_refine_ls_shell.R_factor_obs
_refine_ls_shell.R_factor_R_free_error
_refine_ls_shell.R_factor_R_work
_refine_ls_shell.redundancy_reflns_all
_refine_ls_shell.redundancy_reflns_obs
_refine_ls_shell.wR_factor_all
_refine_ls_shell.wR_factor_obs
_refine_ls_shell.wR_factor_R_free
_refine_ls_shell.wR_factor_R_work
_refine_ls_shell.pdbx_R_complete
_refine_ls_shell.pdbx_total_number_of_bins_used
_refine_ls_shell.pdbx_phase_error
_refine_ls_shell.pdbx_fsc_work
_refine_ls_shell.pdbx_fsc_free
_refine_ls_shell.R_factor_R_free
'X-RAY DIFFRACTION' 1.47 1.54 . . 55 1230 41.32 . . . . 0.3343 . . . . . . . . . . . 0.3407
'X-RAY DIFFRACTION' 1.54 1.62 . . 99 1972 66.66 . . . . 0.2605 . . . . . . . . . . . 0.3017
'X-RAY DIFFRACTION' 1.62 1.72 . . 120 2509 84.51 . . . . 0.2452 . . . . . . . . . . . 0.2830
'X-RAY DIFFRACTION' 1.72 1.85 . . 164 2871 97.03 . . . . 0.2469 . . . . . . . . . . . 0.2828
'X-RAY DIFFRACTION' 1.85 2.04 . . 144 2988 100.00 . . . . 0.2327 . . . . . . . . . . . 0.2509
'X-RAY DIFFRACTION' 2.04 2.33 . . 153 3004 99.91 . . . . 0.2214 . . . . . . . . . . . 0.2319
'X-RAY DIFFRACTION' 2.33 2.94 . . 159 3038 99.88 . . . . 0.2211 . . . . . . . . . . . 0.2475
'X-RAY DIFFRACTION' 2.94 15.78 . . 159 3165 99.67 . . . . 0.2080 . . . . . . . . . . . 0.2107
#
_struct.entry_id 8USS
_struct.title 'IL17A complexed to Compound 7'
_struct.pdbx_model_details ?
_struct.pdbx_formula_weight ?
_struct.pdbx_formula_weight_method ?
_struct.pdbx_model_type_details ?
_struct.pdbx_CASP_flag N
#
_struct_keywords.entry_id 8USS
_struct_keywords.text 'Homodimer, inhibitor, DEL, CYTOKINE'
_struct_keywords.pdbx_keywords CYTOKINE
#
loop_
_struct_asym.id
_struct_asym.pdbx_blank_PDB_chainid_flag
_struct_asym.pdbx_modified
_struct_asym.entity_id
_struct_asym.details
A N N 1 ?
B N N 2 ?
C N N 3 ?
D N N 4 ?
#
_struct_ref.id 1
_struct_ref.db_name UNP
_struct_ref.db_code IL17_HUMAN
_struct_ref.pdbx_db_accession Q16552
_struct_ref.pdbx_db_isoform ?
_struct_ref.entity_id 1
_struct_ref.pdbx_seq_one_letter_code
;PNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSV
PIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
;
_struct_ref.pdbx_align_begin 34
#
_struct_ref_seq.align_id 1
_struct_ref_seq.ref_id 1
_struct_ref_seq.pdbx_PDB_id_code 8USS
_struct_ref_seq.pdbx_strand_id A
_struct_ref_seq.seq_align_beg 6
_struct_ref_seq.pdbx_seq_align_beg_ins_code ?
_struct_ref_seq.seq_align_end 127
_struct_ref_seq.pdbx_seq_align_end_ins_code ?
_struct_ref_seq.pdbx_db_accession Q16552
_struct_ref_seq.db_align_beg 34
_struct_ref_seq.pdbx_db_align_beg_ins_code ?
_struct_ref_seq.db_align_end 155
_struct_ref_seq.pdbx_db_align_end_ins_code ?
_struct_ref_seq.pdbx_auth_seq_align_beg 34
_struct_ref_seq.pdbx_auth_seq_align_end 155
#
loop_
_struct_ref_seq_dif.align_id
_struct_ref_seq_dif.pdbx_pdb_id_code
_struct_ref_seq_dif.mon_id
_struct_ref_seq_dif.pdbx_pdb_strand_id
_struct_ref_seq_dif.seq_num
_struct_ref_seq_dif.pdbx_pdb_ins_code
_struct_ref_seq_dif.pdbx_seq_db_name
_struct_ref_seq_dif.pdbx_seq_db_accession_code
_struct_ref_seq_dif.db_mon_id
_struct_ref_seq_dif.pdbx_seq_db_seq_num
_struct_ref_seq_dif.details
_struct_ref_seq_dif.pdbx_auth_seq_num
_struct_ref_seq_dif.pdbx_ordinal
1 8USS GLY A 1 ? UNP Q16552 ? ? 'expression tag' 29 1
1 8USS SER A 2 ? UNP Q16552 ? ? 'expression tag' 30 2
1 8USS ALA A 3 ? UNP Q16552 ? ? 'expression tag' 31 3
1 8USS MET A 4 ? UNP Q16552 ? ? 'expression tag' 32 4
1 8USS ALA A 5 ? UNP Q16552 ? ? 'expression tag' 33 5
1 8USS SER A 101 ? UNP Q16552 CYS 129 'engineered mutation' 129 6
#
_pdbx_struct_assembly.id 1
_pdbx_struct_assembly.details author_defined_assembly
_pdbx_struct_assembly.method_details ?
_pdbx_struct_assembly.oligomeric_details monomeric
_pdbx_struct_assembly.oligomeric_count 1
#
_pdbx_struct_assembly_gen.assembly_id 1
_pdbx_struct_assembly_gen.oper_expression 1
_pdbx_struct_assembly_gen.asym_id_list A,B,C,D
#
_pdbx_struct_oper_list.id 1
_pdbx_struct_oper_list.type 'identity operation'
_pdbx_struct_oper_list.name 1_555
_pdbx_struct_oper_list.symmetry_operation x,y,z
_pdbx_struct_oper_list.matrix[1][1] 1.0000000000
_pdbx_struct_oper_list.matrix[1][2] 0.0000000000
_pdbx_struct_oper_list.matrix[1][3] 0.0000000000
_pdbx_struct_oper_list.vector[1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][2] 1.0000000000
_pdbx_struct_oper_list.matrix[2][3] 0.0000000000
_pdbx_struct_oper_list.vector[2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][1] 0.0000000000
_pdbx_struct_oper_list.matrix[3][2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][3] 1.0000000000
_pdbx_struct_oper_list.vector[3] 0.0000000000
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 AA1 ASN A 22 ? ARG A 26 ? ASN A 50 ARG A 54 5 ? 5
HELX_P HELX_P2 AA2 ASN A 31 ? ASN A 40 ? ASN A 59 ASN A 68 1 ? 10
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
loop_
_struct_conn.id
_struct_conn.conn_type_id
_struct_conn.pdbx_leaving_atom_flag
_struct_conn.pdbx_PDB_id
_struct_conn.ptnr1_label_asym_id
_struct_conn.ptnr1_label_comp_id
_struct_conn.ptnr1_label_seq_id
_struct_conn.ptnr1_label_atom_id
_struct_conn.pdbx_ptnr1_label_alt_id
_struct_conn.pdbx_ptnr1_PDB_ins_code
_struct_conn.pdbx_ptnr1_standard_comp_id
_struct_conn.ptnr1_symmetry
_struct_conn.ptnr2_label_asym_id
_struct_conn.ptnr2_label_comp_id
_struct_conn.ptnr2_label_seq_id
_struct_conn.ptnr2_label_atom_id
_struct_conn.pdbx_ptnr2_label_alt_id
_struct_conn.pdbx_ptnr2_PDB_ins_code
_struct_conn.ptnr1_auth_asym_id
_struct_conn.ptnr1_auth_comp_id
_struct_conn.ptnr1_auth_seq_id
_struct_conn.ptnr2_auth_asym_id
_struct_conn.ptnr2_auth_comp_id
_struct_conn.ptnr2_auth_seq_id
_struct_conn.ptnr2_symmetry
_struct_conn.pdbx_ptnr3_label_atom_id
_struct_conn.pdbx_ptnr3_label_seq_id
_struct_conn.pdbx_ptnr3_label_comp_id
_struct_conn.pdbx_ptnr3_label_asym_id
_struct_conn.pdbx_ptnr3_label_alt_id
_struct_conn.pdbx_ptnr3_PDB_ins_code
_struct_conn.details
_struct_conn.pdbx_dist_value
_struct_conn.pdbx_value_order
_struct_conn.pdbx_role
disulf1 disulf ? ? A CYS 66 SG ? ? ? 1_555 A CYS 116 SG ? ? A CYS 94 A CYS 144 1_555 ? ? ? ? ? ? ? 2.160 ? ?
disulf2 disulf ? ? A CYS 71 SG ? ? ? 1_555 A CYS 118 SG ? ? A CYS 99 A CYS 146 1_555 ? ? ? ? ? ? ? 2.118 ? ?
#
_struct_conn_type.id disulf
_struct_conn_type.criteria ?
_struct_conn_type.reference ?
#
loop_
_pdbx_modification_feature.ordinal
_pdbx_modification_feature.label_comp_id
_pdbx_modification_feature.label_asym_id
_pdbx_modification_feature.label_seq_id
_pdbx_modification_feature.label_alt_id
_pdbx_modification_feature.modified_residue_label_comp_id
_pdbx_modification_feature.modified_residue_label_asym_id
_pdbx_modification_feature.modified_residue_label_seq_id
_pdbx_modification_feature.modified_residue_label_alt_id
_pdbx_modification_feature.auth_comp_id
_pdbx_modification_feature.auth_asym_id
_pdbx_modification_feature.auth_seq_id
_pdbx_modification_feature.PDB_ins_code
_pdbx_modification_feature.symmetry
_pdbx_modification_feature.modified_residue_auth_comp_id
_pdbx_modification_feature.modified_residue_auth_asym_id
_pdbx_modification_feature.modified_residue_auth_seq_id
_pdbx_modification_feature.modified_residue_PDB_ins_code
_pdbx_modification_feature.modified_residue_symmetry
_pdbx_modification_feature.comp_id_linking_atom
_pdbx_modification_feature.modified_residue_id_linking_atom
_pdbx_modification_feature.modified_residue_id
_pdbx_modification_feature.ref_pcm_id
_pdbx_modification_feature.ref_comp_id
_pdbx_modification_feature.type
_pdbx_modification_feature.category
1 CYS A 66 ? CYS A 116 ? CYS A 94 ? 1_555 CYS A 144 ? 1_555 SG SG . . . None 'Disulfide bridge'
2 CYS A 71 ? CYS A 118 ? CYS A 99 ? 1_555 CYS A 146 ? 1_555 SG SG . . . None 'Disulfide bridge'
#
loop_
_struct_mon_prot_cis.pdbx_id
_struct_mon_prot_cis.label_comp_id
_struct_mon_prot_cis.label_seq_id
_struct_mon_prot_cis.label_asym_id
_struct_mon_prot_cis.label_alt_id
_struct_mon_prot_cis.pdbx_PDB_ins_code
_struct_mon_prot_cis.auth_comp_id
_struct_mon_prot_cis.auth_seq_id
_struct_mon_prot_cis.auth_asym_id
_struct_mon_prot_cis.pdbx_label_comp_id_2
_struct_mon_prot_cis.pdbx_label_seq_id_2
_struct_mon_prot_cis.pdbx_label_asym_id_2
_struct_mon_prot_cis.pdbx_PDB_ins_code_2
_struct_mon_prot_cis.pdbx_auth_comp_id_2
_struct_mon_prot_cis.pdbx_auth_seq_id_2
_struct_mon_prot_cis.pdbx_auth_asym_id_2
_struct_mon_prot_cis.pdbx_PDB_model_num
_struct_mon_prot_cis.pdbx_omega_angle
1 TYR 57 A . ? TYR 85 A PRO 58 A ? PRO 86 A 1 3.33
2 GLU 97 A . ? GLU 125 A PRO 98 A ? PRO 126 A 1 -0.79
#
loop_
_struct_sheet.id
_struct_sheet.type
_struct_sheet.number_strands
_struct_sheet.details
AA1 ? 2 ?
AA2 ? 3 ?
AA3 ? 2 ?
#
loop_
_struct_sheet_order.sheet_id
_struct_sheet_order.range_id_1
_struct_sheet_order.range_id_2
_struct_sheet_order.offset
_struct_sheet_order.sense
AA1 1 2 ? anti-parallel
AA2 1 2 ? anti-parallel
AA2 2 3 ? anti-parallel
AA3 1 2 ? anti-parallel
#
loop_
_struct_sheet_range.sheet_id
_struct_sheet_range.id
_struct_sheet_range.beg_label_comp_id
_struct_sheet_range.beg_label_asym_id
_struct_sheet_range.beg_label_seq_id
_struct_sheet_range.pdbx_beg_PDB_ins_code
_struct_sheet_range.end_label_comp_id
_struct_sheet_range.end_label_asym_id
_struct_sheet_range.end_label_seq_id
_struct_sheet_range.pdbx_end_PDB_ins_code
_struct_sheet_range.beg_auth_comp_id
_struct_sheet_range.beg_auth_asym_id
_struct_sheet_range.beg_auth_seq_id
_struct_sheet_range.end_auth_comp_id
_struct_sheet_range.end_auth_asym_id
_struct_sheet_range.end_auth_seq_id
AA1 1 TRP A 46 ? GLU A 52 ? TRP A 74 GLU A 80
AA1 2 VAL A 60 ? CYS A 66 ? VAL A 88 CYS A 94
AA2 1 ARG A 56 ? TYR A 57 ? ARG A 84 TYR A 85
AA2 2 ASN A 83 ? ARG A 95 ? ASN A 111 ARG A 123
AA2 3 LEU A 107 ? VAL A 119 ? LEU A 135 VAL A 147
AA3 1 CYS A 71 ? ILE A 72 ? CYS A 99 ILE A 100
AA3 2 VAL A 78 ? ASP A 79 ? VAL A 106 ASP A 107
#
loop_
_pdbx_struct_sheet_hbond.sheet_id
_pdbx_struct_sheet_hbond.range_id_1
_pdbx_struct_sheet_hbond.range_id_2
_pdbx_struct_sheet_hbond.range_1_label_atom_id
_pdbx_struct_sheet_hbond.range_1_label_comp_id
_pdbx_struct_sheet_hbond.range_1_label_asym_id
_pdbx_struct_sheet_hbond.range_1_label_seq_id
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code
_pdbx_struct_sheet_hbond.range_1_auth_atom_id
_pdbx_struct_sheet_hbond.range_1_auth_comp_id
_pdbx_struct_sheet_hbond.range_1_auth_asym_id
_pdbx_struct_sheet_hbond.range_1_auth_seq_id
_pdbx_struct_sheet_hbond.range_2_label_atom_id
_pdbx_struct_sheet_hbond.range_2_label_comp_id
_pdbx_struct_sheet_hbond.range_2_label_asym_id
_pdbx_struct_sheet_hbond.range_2_label_seq_id
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code
_pdbx_struct_sheet_hbond.range_2_auth_atom_id
_pdbx_struct_sheet_hbond.range_2_auth_comp_id
_pdbx_struct_sheet_hbond.range_2_auth_asym_id
_pdbx_struct_sheet_hbond.range_2_auth_seq_id
AA1 1 2 N ASN A 47 ? N ASN A 75 O LYS A 65 ? O LYS A 93
AA2 1 2 N TYR A 57 ? N TYR A 85 O LEU A 94 ? O LEU A 122
AA2 2 3 N VAL A 93 ? N VAL A 121 O GLU A 108 ? O GLU A 136
AA3 1 2 N CYS A 71 ? N CYS A 99 O ASP A 79 ? O ASP A 107
#
_pdbx_entry_details.entry_id 8USS
_pdbx_entry_details.nonpolymer_details ?
_pdbx_entry_details.sequence_details ?
_pdbx_entry_details.compound_details ?
_pdbx_entry_details.source_details ?
_pdbx_entry_details.has_ligand_of_interest Y
_pdbx_entry_details.has_protein_modification Y
#
loop_
_pdbx_validate_rmsd_bond.id
_pdbx_validate_rmsd_bond.PDB_model_num
_pdbx_validate_rmsd_bond.auth_atom_id_1
_pdbx_validate_rmsd_bond.auth_asym_id_1
_pdbx_validate_rmsd_bond.auth_comp_id_1
_pdbx_validate_rmsd_bond.auth_seq_id_1
_pdbx_validate_rmsd_bond.PDB_ins_code_1
_pdbx_validate_rmsd_bond.label_alt_id_1
_pdbx_validate_rmsd_bond.auth_atom_id_2
_pdbx_validate_rmsd_bond.auth_asym_id_2
_pdbx_validate_rmsd_bond.auth_comp_id_2
_pdbx_validate_rmsd_bond.auth_seq_id_2
_pdbx_validate_rmsd_bond.PDB_ins_code_2
_pdbx_validate_rmsd_bond.label_alt_id_2
_pdbx_validate_rmsd_bond.bond_value
_pdbx_validate_rmsd_bond.bond_target_value
_pdbx_validate_rmsd_bond.bond_deviation
_pdbx_validate_rmsd_bond.bond_standard_deviation
_pdbx_validate_rmsd_bond.linker_flag
1 1 C A ASP 81 ? ? N A PRO 82 ? ? 1.476 1.338 0.138 0.019 Y
2 1 N A PRO 86 ? ? CA A PRO 86 ? ? 1.667 1.468 0.199 0.017 N
3 1 N A PRO 114 ? ? CA A PRO 114 ? ? 1.643 1.468 0.175 0.017 N
4 1 C A GLU 125 ? ? N A PRO 126 ? ? 1.488 1.338 0.150 0.019 Y
#
loop_
_pdbx_validate_rmsd_angle.id
_pdbx_validate_rmsd_angle.PDB_model_num
_pdbx_validate_rmsd_angle.auth_atom_id_1
_pdbx_validate_rmsd_angle.auth_asym_id_1
_pdbx_validate_rmsd_angle.auth_comp_id_1
_pdbx_validate_rmsd_angle.auth_seq_id_1
_pdbx_validate_rmsd_angle.PDB_ins_code_1
_pdbx_validate_rmsd_angle.label_alt_id_1
_pdbx_validate_rmsd_angle.auth_atom_id_2
_pdbx_validate_rmsd_angle.auth_asym_id_2
_pdbx_validate_rmsd_angle.auth_comp_id_2
_pdbx_validate_rmsd_angle.auth_seq_id_2
_pdbx_validate_rmsd_angle.PDB_ins_code_2
_pdbx_validate_rmsd_angle.label_alt_id_2
_pdbx_validate_rmsd_angle.auth_atom_id_3
_pdbx_validate_rmsd_angle.auth_asym_id_3
_pdbx_validate_rmsd_angle.auth_comp_id_3
_pdbx_validate_rmsd_angle.auth_seq_id_3
_pdbx_validate_rmsd_angle.PDB_ins_code_3
_pdbx_validate_rmsd_angle.label_alt_id_3
_pdbx_validate_rmsd_angle.angle_value
_pdbx_validate_rmsd_angle.angle_target_value
_pdbx_validate_rmsd_angle.angle_deviation
_pdbx_validate_rmsd_angle.angle_standard_deviation
_pdbx_validate_rmsd_angle.linker_flag
1 1 C A ASP 81 ? ? N A PRO 82 ? ? CA A PRO 82 ? ? 129.74 119.30 10.44 1.50 Y
2 1 C A VAL 113 ? ? N A PRO 114 ? ? CA A PRO 114 ? ? 132.46 119.30 13.16 1.50 Y
#
loop_
_pdbx_validate_torsion.id
_pdbx_validate_torsion.PDB_model_num
_pdbx_validate_torsion.auth_comp_id
_pdbx_validate_torsion.auth_asym_id
_pdbx_validate_torsion.auth_seq_id
_pdbx_validate_torsion.PDB_ins_code
_pdbx_validate_torsion.label_alt_id
_pdbx_validate_torsion.phi
_pdbx_validate_torsion.psi
1 1 VAL A 45 ? ? -110.03 -125.34
2 1 ASN A 50 ? ? -151.83 -157.49
#
loop_
_pdbx_validate_main_chain_plane.id
_pdbx_validate_main_chain_plane.PDB_model_num
_pdbx_validate_main_chain_plane.auth_comp_id
_pdbx_validate_main_chain_plane.auth_asym_id
_pdbx_validate_main_chain_plane.auth_seq_id
_pdbx_validate_main_chain_plane.PDB_ins_code
_pdbx_validate_main_chain_plane.label_alt_id
_pdbx_validate_main_chain_plane.improper_torsion_angle
1 1 THR A 148 ? A 11.62
2 1 THR A 148 ? B 13.34
#
loop_
_pdbx_struct_special_symmetry.id
_pdbx_struct_special_symmetry.PDB_model_num
_pdbx_struct_special_symmetry.auth_asym_id
_pdbx_struct_special_symmetry.auth_comp_id
_pdbx_struct_special_symmetry.auth_seq_id
_pdbx_struct_special_symmetry.PDB_ins_code
_pdbx_struct_special_symmetry.label_asym_id
_pdbx_struct_special_symmetry.label_comp_id
_pdbx_struct_special_symmetry.label_seq_id
1 1 A HOH 310 ? D HOH .
2 1 A HOH 322 ? D HOH .
#
loop_
_space_group_symop.id
_space_group_symop.operation_xyz
1 x,y,z
2 x,-y,-z
3 -x,y,-z
4 -x,-y,z
5 x+1/2,y+1/2,z+1/2
6 x+1/2,-y+1/2,-z+1/2
7 -x+1/2,y+1/2,-z+1/2
8 -x+1/2,-y+1/2,z+1/2
#
loop_
_pdbx_unobs_or_zero_occ_residues.id
_pdbx_unobs_or_zero_occ_residues.PDB_model_num
_pdbx_unobs_or_zero_occ_residues.polymer_flag
_pdbx_unobs_or_zero_occ_residues.occupancy_flag
_pdbx_unobs_or_zero_occ_residues.auth_asym_id
_pdbx_unobs_or_zero_occ_residues.auth_comp_id
_pdbx_unobs_or_zero_occ_residues.auth_seq_id
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code
_pdbx_unobs_or_zero_occ_residues.label_asym_id
_pdbx_unobs_or_zero_occ_residues.label_comp_id
_pdbx_unobs_or_zero_occ_residues.label_seq_id
1 1 Y 1 A GLY 29 ? A GLY 1
2 1 Y 1 A SER 30 ? A SER 2
3 1 Y 1 A ALA 31 ? A ALA 3
4 1 Y 1 A MET 32 ? A MET 4
5 1 Y 1 A ALA 33 ? A ALA 5
6 1 Y 1 A PRO 34 ? A PRO 6
7 1 Y 1 A ASN 35 ? A ASN 7
8 1 Y 1 A SER 36 ? A SER 8
9 1 Y 1 A GLU 37 ? A GLU 9
10 1 Y 1 A ASP 38 ? A ASP 10
11 1 Y 1 A LYS 39 ? A LYS 11
12 1 Y 1 A ASN 40 ? A ASN 12
13 1 Y 1 A PHE 41 ? A PHE 13
14 1 Y 1 A PRO 42 ? A PRO 14
15 1 Y 1 A HIS 128 ? A HIS 100
16 1 Y 1 A SER 129 ? A SER 101
17 1 Y 1 A PRO 130 ? A PRO 102
18 1 Y 1 A ASN 131 ? A ASN 103
19 1 Y 1 A SER 132 ? A SER 104
20 1 Y 1 A PHE 133 ? A PHE 105
#
loop_
_chem_comp_atom.comp_id
_chem_comp_atom.atom_id
_chem_comp_atom.type_symbol
_chem_comp_atom.pdbx_aromatic_flag
_chem_comp_atom.pdbx_stereo_config
_chem_comp_atom.pdbx_ordinal
ALA N N N N 1
ALA CA C N S 2
ALA C C N N 3
ALA O O N N 4
ALA CB C N N 5
ALA OXT O N N 6
ALA H H N N 7
ALA H2 H N N 8
ALA HA H N N 9
ALA HB1 H N N 10
ALA HB2 H N N 11
ALA HB3 H N N 12
ALA HXT H N N 13
ARG N N N N 14
ARG CA C N S 15
ARG C C N N 16
ARG O O N N 17
ARG CB C N N 18
ARG CG C N N 19
ARG CD C N N 20
ARG NE N N N 21
ARG CZ C N N 22
ARG NH1 N N N 23
ARG NH2 N N N 24
ARG OXT O N N 25
ARG H H N N 26
ARG H2 H N N 27
ARG HA H N N 28
ARG HB2 H N N 29
ARG HB3 H N N 30
ARG HG2 H N N 31
ARG HG3 H N N 32
ARG HD2 H N N 33
ARG HD3 H N N 34
ARG HE H N N 35
ARG HH11 H N N 36
ARG HH12 H N N 37
ARG HH21 H N N 38
ARG HH22 H N N 39
ARG HXT H N N 40
ASN N N N N 41
ASN CA C N S 42
ASN C C N N 43
ASN O O N N 44
ASN CB C N N 45
ASN CG C N N 46
ASN OD1 O N N 47
ASN ND2 N N N 48
ASN OXT O N N 49
ASN H H N N 50
ASN H2 H N N 51
ASN HA H N N 52
ASN HB2 H N N 53
ASN HB3 H N N 54
ASN HD21 H N N 55
ASN HD22 H N N 56
ASN HXT H N N 57
ASP N N N N 58
ASP CA C N S 59
ASP C C N N 60
ASP O O N N 61
ASP CB C N N 62
ASP CG C N N 63
ASP OD1 O N N 64
ASP OD2 O N N 65
ASP OXT O N N 66
ASP H H N N 67
ASP H2 H N N 68
ASP HA H N N 69
ASP HB2 H N N 70
ASP HB3 H N N 71
ASP HD2 H N N 72
ASP HXT H N N 73
CL CL CL N N 74
CYS N N N N 75
CYS CA C N R 76
CYS C C N N 77
CYS O O N N 78
CYS CB C N N 79
CYS SG S N N 80
CYS OXT O N N 81
CYS H H N N 82
CYS H2 H N N 83
CYS HA H N N 84
CYS HB2 H N N 85
CYS HB3 H N N 86
CYS HG H N N 87
CYS HXT H N N 88
GLN N N N N 89
GLN CA C N S 90
GLN C C N N 91
GLN O O N N 92
GLN CB C N N 93
GLN CG C N N 94
GLN CD C N N 95
GLN OE1 O N N 96
GLN NE2 N N N 97
GLN OXT O N N 98
GLN H H N N 99
GLN H2 H N N 100
GLN HA H N N 101
GLN HB2 H N N 102
GLN HB3 H N N 103
GLN HG2 H N N 104
GLN HG3 H N N 105
GLN HE21 H N N 106
GLN HE22 H N N 107
GLN HXT H N N 108
GLU N N N N 109
GLU CA C N S 110
GLU C C N N 111
GLU O O N N 112
GLU CB C N N 113
GLU CG C N N 114
GLU CD C N N 115
GLU OE1 O N N 116
GLU OE2 O N N 117
GLU OXT O N N 118
GLU H H N N 119
GLU H2 H N N 120
GLU HA H N N 121
GLU HB2 H N N 122
GLU HB3 H N N 123
GLU HG2 H N N 124
GLU HG3 H N N 125
GLU HE2 H N N 126
GLU HXT H N N 127
GLY N N N N 128
GLY CA C N N 129
GLY C C N N 130
GLY O O N N 131
GLY OXT O N N 132
GLY H H N N 133
GLY H2 H N N 134
GLY HA2 H N N 135
GLY HA3 H N N 136
GLY HXT H N N 137
HIS N N N N 138
HIS CA C N S 139
HIS C C N N 140
HIS O O N N 141
HIS CB C N N 142
HIS CG C Y N 143
HIS ND1 N Y N 144
HIS CD2 C Y N 145
HIS CE1 C Y N 146
HIS NE2 N Y N 147
HIS OXT O N N 148
HIS H H N N 149
HIS H2 H N N 150
HIS HA H N N 151
HIS HB2 H N N 152
HIS HB3 H N N 153
HIS HD1 H N N 154
HIS HD2 H N N 155
HIS HE1 H N N 156
HIS HE2 H N N 157
HIS HXT H N N 158
HOH O O N N 159
HOH H1 H N N 160
HOH H2 H N N 161
ILE N N N N 162
ILE CA C N S 163
ILE C C N N 164
ILE O O N N 165
ILE CB C N S 166
ILE CG1 C N N 167
ILE CG2 C N N 168
ILE CD1 C N N 169
ILE OXT O N N 170
ILE H H N N 171
ILE H2 H N N 172
ILE HA H N N 173
ILE HB H N N 174
ILE HG12 H N N 175
ILE HG13 H N N 176
ILE HG21 H N N 177
ILE HG22 H N N 178
ILE HG23 H N N 179
ILE HD11 H N N 180
ILE HD12 H N N 181
ILE HD13 H N N 182
ILE HXT H N N 183
LEU N N N N 184
LEU CA C N S 185
LEU C C N N 186
LEU O O N N 187
LEU CB C N N 188
LEU CG C N N 189
LEU CD1 C N N 190
LEU CD2 C N N 191
LEU OXT O N N 192
LEU H H N N 193
LEU H2 H N N 194
LEU HA H N N 195
LEU HB2 H N N 196
LEU HB3 H N N 197
LEU HG H N N 198
LEU HD11 H N N 199
LEU HD12 H N N 200
LEU HD13 H N N 201
LEU HD21 H N N 202
LEU HD22 H N N 203
LEU HD23 H N N 204
LEU HXT H N N 205
LYS N N N N 206
LYS CA C N S 207
LYS C C N N 208
LYS O O N N 209
LYS CB C N N 210
LYS CG C N N 211
LYS CD C N N 212
LYS CE C N N 213
LYS NZ N N N 214
LYS OXT O N N 215
LYS H H N N 216
LYS H2 H N N 217
LYS HA H N N 218
LYS HB2 H N N 219
LYS HB3 H N N 220
LYS HG2 H N N 221
LYS HG3 H N N 222
LYS HD2 H N N 223
LYS HD3 H N N 224
LYS HE2 H N N 225
LYS HE3 H N N 226
LYS HZ1 H N N 227
LYS HZ2 H N N 228
LYS HZ3 H N N 229
LYS HXT H N N 230
MET N N N N 231
MET CA C N S 232
MET C C N N 233
MET O O N N 234
MET CB C N N 235
MET CG C N N 236
MET SD S N N 237
MET CE C N N 238
MET OXT O N N 239
MET H H N N 240
MET H2 H N N 241
MET HA H N N 242
MET HB2 H N N 243
MET HB3 H N N 244
MET HG2 H N N 245
MET HG3 H N N 246
MET HE1 H N N 247
MET HE2 H N N 248
MET HE3 H N N 249
MET HXT H N N 250
PHE N N N N 251
PHE CA C N S 252
PHE C C N N 253
PHE O O N N 254
PHE CB C N N 255
PHE CG C Y N 256
PHE CD1 C Y N 257
PHE CD2 C Y N 258
PHE CE1 C Y N 259
PHE CE2 C Y N 260
PHE CZ C Y N 261
PHE OXT O N N 262
PHE H H N N 263
PHE H2 H N N 264
PHE HA H N N 265
PHE HB2 H N N 266
PHE HB3 H N N 267
PHE HD1 H N N 268
PHE HD2 H N N 269
PHE HE1 H N N 270
PHE HE2 H N N 271
PHE HZ H N N 272
PHE HXT H N N 273
PRO N N N N 274
PRO CA C N S 275
PRO C C N N 276
PRO O O N N 277
PRO CB C N N 278
PRO CG C N N 279
PRO CD C N N 280
PRO OXT O N N 281
PRO H H N N 282
PRO HA H N N 283
PRO HB2 H N N 284
PRO HB3 H N N 285
PRO HG2 H N N 286
PRO HG3 H N N 287
PRO HD2 H N N 288
PRO HD3 H N N 289
PRO HXT H N N 290
SER N N N N 291
SER CA C N S 292
SER C C N N 293
SER O O N N 294
SER CB C N N 295
SER OG O N N 296
SER OXT O N N 297
SER H H N N 298
SER H2 H N N 299
SER HA H N N 300
SER HB2 H N N 301
SER HB3 H N N 302
SER HG H N N 303
SER HXT H N N 304
THR N N N N 305
THR CA C N S 306
THR C C N N 307
THR O O N N 308
THR CB C N R 309
THR OG1 O N N 310
THR CG2 C N N 311
THR OXT O N N 312
THR H H N N 313
THR H2 H N N 314
THR HA H N N 315
THR HB H N N 316
THR HG1 H N N 317
THR HG21 H N N 318
THR HG22 H N N 319
THR HG23 H N N 320
THR HXT H N N 321
TRP N N N N 322
TRP CA C N S 323
TRP C C N N 324
TRP O O N N 325
TRP CB C N N 326
TRP CG C Y N 327
TRP CD1 C Y N 328
TRP CD2 C Y N 329
TRP NE1 N Y N 330
TRP CE2 C Y N 331
TRP CE3 C Y N 332
TRP CZ2 C Y N 333
TRP CZ3 C Y N 334
TRP CH2 C Y N 335
TRP OXT O N N 336
TRP H H N N 337
TRP H2 H N N 338
TRP HA H N N 339
TRP HB2 H N N 340
TRP HB3 H N N 341
TRP HD1 H N N 342
TRP HE1 H N N 343
TRP HE3 H N N 344
TRP HZ2 H N N 345
TRP HZ3 H N N 346
TRP HH2 H N N 347
TRP HXT H N N 348
TYR N N N N 349
TYR CA C N S 350
TYR C C N N 351
TYR O O N N 352
TYR CB C N N 353
TYR CG C Y N 354
TYR CD1 C Y N 355
TYR CD2 C Y N 356
TYR CE1 C Y N 357
TYR CE2 C Y N 358
TYR CZ C Y N 359
TYR OH O N N 360
TYR OXT O N N 361
TYR H H N N 362
TYR H2 H N N 363
TYR HA H N N 364
TYR HB2 H N N 365
TYR HB3 H N N 366
TYR HD1 H N N 367
TYR HD2 H N N 368
TYR HE1 H N N 369
TYR HE2 H N N 370
TYR HH H N N 371
TYR HXT H N N 372
VAL N N N N 373
VAL CA C N S 374
VAL C C N N 375
VAL O O N N 376
VAL CB C N N 377
VAL CG1 C N N 378
VAL CG2 C N N 379
VAL OXT O N N 380
VAL H H N N 381
VAL H2 H N N 382
VAL HA H N N 383
VAL HB H N N 384
VAL HG11 H N N 385
VAL HG12 H N N 386
VAL HG13 H N N 387
VAL HG21 H N N 388
VAL HG22 H N N 389
VAL HG23 H N N 390
VAL HXT H N N 391
XCW C1 C N N 392
XCW C11 C N S 393
XCW C13 C N N 394
XCW C15 C Y N 395
XCW C16 C Y N 396
XCW C17 C Y N 397
XCW C19 C Y N 398
XCW C22 C N N 399
XCW C23 C N N 400
XCW C24 C N N 401
XCW C25 C N N 402
XCW C26 C N N 403
XCW C27 C N N 404
XCW C28 C N N 405
XCW C3 C Y N 406
XCW C30 C Y N 407
XCW C31 C Y N 408
XCW C32 C Y N 409
XCW C33 C Y N 410
XCW C4 C Y N 411
XCW C6 C N N 412
XCW C7 C N S 413
XCW C9 C N N 414
XCW N12 N N N 415
XCW N2 N N N 416
XCW N21 N Y N 417
XCW N8 N N N 418
XCW O10 O N N 419
XCW O14 O N N 420
XCW O29 O N N 421
XCW O5 O N N 422
XCW CL18 CL N N 423
XCW CL20 CL N N 424
XCW H36 H N N 425
XCW H34 H N N 426
XCW H35 H N N 427
XCW H41 H N N 428
XCW H43 H N N 429
XCW H45 H N N 430
XCW H47 H N N 431
XCW H46 H N N 432
XCW H49 H N N 433
XCW H48 H N N 434
XCW H50 H N N 435
XCW H51 H N N 436
XCW H53 H N N 437
XCW H52 H N N 438
XCW H55 H N N 439
XCW H54 H N N 440
XCW H56 H N N 441
XCW H57 H N N 442
XCW H58 H N N 443
XCW H59 H N N 444
XCW H38 H N N 445
XCW H37 H N N 446
XCW H39 H N N 447
XCW H42 H N N 448
XCW H44 H N N 449
XCW H40 H N N 450
#
loop_
_chem_comp_bond.comp_id
_chem_comp_bond.atom_id_1
_chem_comp_bond.atom_id_2
_chem_comp_bond.value_order
_chem_comp_bond.pdbx_aromatic_flag
_chem_comp_bond.pdbx_stereo_config
_chem_comp_bond.pdbx_ordinal
ALA N CA sing N N 1
ALA N H sing N N 2
ALA N H2 sing N N 3
ALA CA C sing N N 4
ALA CA CB sing N N 5
ALA CA HA sing N N 6
ALA C O doub N N 7
ALA C OXT sing N N 8
ALA CB HB1 sing N N 9
ALA CB HB2 sing N N 10
ALA CB HB3 sing N N 11
ALA OXT HXT sing N N 12
ARG N CA sing N N 13
ARG N H sing N N 14
ARG N H2 sing N N 15
ARG CA C sing N N 16
ARG CA CB sing N N 17
ARG CA HA sing N N 18
ARG C O doub N N 19
ARG C OXT sing N N 20
ARG CB CG sing N N 21
ARG CB HB2 sing N N 22
ARG CB HB3 sing N N 23
ARG CG CD sing N N 24
ARG CG HG2 sing N N 25
ARG CG HG3 sing N N 26
ARG CD NE sing N N 27
ARG CD HD2 sing N N 28
ARG CD HD3 sing N N 29
ARG NE CZ sing N N 30
ARG NE HE sing N N 31
ARG CZ NH1 sing N N 32
ARG CZ NH2 doub N N 33
ARG NH1 HH11 sing N N 34
ARG NH1 HH12 sing N N 35
ARG NH2 HH21 sing N N 36
ARG NH2 HH22 sing N N 37
ARG OXT HXT sing N N 38
ASN N CA sing N N 39
ASN N H sing N N 40
ASN N H2 sing N N 41
ASN CA C sing N N 42
ASN CA CB sing N N 43
ASN CA HA sing N N 44
ASN C O doub N N 45
ASN C OXT sing N N 46
ASN CB CG sing N N 47
ASN CB HB2 sing N N 48
ASN CB HB3 sing N N 49
ASN CG OD1 doub N N 50
ASN CG ND2 sing N N 51
ASN ND2 HD21 sing N N 52
ASN ND2 HD22 sing N N 53
ASN OXT HXT sing N N 54
ASP N CA sing N N 55
ASP N H sing N N 56
ASP N H2 sing N N 57
ASP CA C sing N N 58
ASP CA CB sing N N 59
ASP CA HA sing N N 60
ASP C O doub N N 61
ASP C OXT sing N N 62
ASP CB CG sing N N 63
ASP CB HB2 sing N N 64
ASP CB HB3 sing N N 65
ASP CG OD1 doub N N 66
ASP CG OD2 sing N N 67
ASP OD2 HD2 sing N N 68
ASP OXT HXT sing N N 69
CYS N CA sing N N 70
CYS N H sing N N 71
CYS N H2 sing N N 72
CYS CA C sing N N 73
CYS CA CB sing N N 74
CYS CA HA sing N N 75
CYS C O doub N N 76
CYS C OXT sing N N 77
CYS CB SG sing N N 78
CYS CB HB2 sing N N 79
CYS CB HB3 sing N N 80
CYS SG HG sing N N 81
CYS OXT HXT sing N N 82
GLN N CA sing N N 83
GLN N H sing N N 84
GLN N H2 sing N N 85
GLN CA C sing N N 86
GLN CA CB sing N N 87
GLN CA HA sing N N 88
GLN C O doub N N 89
GLN C OXT sing N N 90
GLN CB CG sing N N 91
GLN CB HB2 sing N N 92
GLN CB HB3 sing N N 93
GLN CG CD sing N N 94
GLN CG HG2 sing N N 95
GLN CG HG3 sing N N 96
GLN CD OE1 doub N N 97
GLN CD NE2 sing N N 98
GLN NE2 HE21 sing N N 99
GLN NE2 HE22 sing N N 100
GLN OXT HXT sing N N 101
GLU N CA sing N N 102
GLU N H sing N N 103
GLU N H2 sing N N 104
GLU CA C sing N N 105
GLU CA CB sing N N 106
GLU CA HA sing N N 107
GLU C O doub N N 108
GLU C OXT sing N N 109
GLU CB CG sing N N 110
GLU CB HB2 sing N N 111
GLU CB HB3 sing N N 112
GLU CG CD sing N N 113
GLU CG HG2 sing N N 114
GLU CG HG3 sing N N 115
GLU CD OE1 doub N N 116
GLU CD OE2 sing N N 117
GLU OE2 HE2 sing N N 118
GLU OXT HXT sing N N 119
GLY N CA sing N N 120
GLY N H sing N N 121
GLY N H2 sing N N 122
GLY CA C sing N N 123
GLY CA HA2 sing N N 124
GLY CA HA3 sing N N 125
GLY C O doub N N 126
GLY C OXT sing N N 127
GLY OXT HXT sing N N 128
HIS N CA sing N N 129
HIS N H sing N N 130
HIS N H2 sing N N 131
HIS CA C sing N N 132
HIS CA CB sing N N 133
HIS CA HA sing N N 134
HIS C O doub N N 135
HIS C OXT sing N N 136
HIS CB CG sing N N 137
HIS CB HB2 sing N N 138
HIS CB HB3 sing N N 139
HIS CG ND1 sing Y N 140
HIS CG CD2 doub Y N 141
HIS ND1 CE1 doub Y N 142
HIS ND1 HD1 sing N N 143
HIS CD2 NE2 sing Y N 144
HIS CD2 HD2 sing N N 145
HIS CE1 NE2 sing Y N 146
HIS CE1 HE1 sing N N 147
HIS NE2 HE2 sing N N 148
HIS OXT HXT sing N N 149
HOH O H1 sing N N 150
HOH O H2 sing N N 151
ILE N CA sing N N 152
ILE N H sing N N 153
ILE N H2 sing N N 154
ILE CA C sing N N 155
ILE CA CB sing N N 156
ILE CA HA sing N N 157
ILE C O doub N N 158
ILE C OXT sing N N 159
ILE CB CG1 sing N N 160
ILE CB CG2 sing N N 161
ILE CB HB sing N N 162
ILE CG1 CD1 sing N N 163
ILE CG1 HG12 sing N N 164
ILE CG1 HG13 sing N N 165
ILE CG2 HG21 sing N N 166
ILE CG2 HG22 sing N N 167
ILE CG2 HG23 sing N N 168
ILE CD1 HD11 sing N N 169
ILE CD1 HD12 sing N N 170
ILE CD1 HD13 sing N N 171
ILE OXT HXT sing N N 172
LEU N CA sing N N 173
LEU N H sing N N 174
LEU N H2 sing N N 175
LEU CA C sing N N 176
LEU CA CB sing N N 177
LEU CA HA sing N N 178
LEU C O doub N N 179
LEU C OXT sing N N 180
LEU CB CG sing N N 181
LEU CB HB2 sing N N 182
LEU CB HB3 sing N N 183
LEU CG CD1 sing N N 184
LEU CG CD2 sing N N 185
LEU CG HG sing N N 186
LEU CD1 HD11 sing N N 187
LEU CD1 HD12 sing N N 188
LEU CD1 HD13 sing N N 189
LEU CD2 HD21 sing N N 190
LEU CD2 HD22 sing N N 191
LEU CD2 HD23 sing N N 192
LEU OXT HXT sing N N 193
LYS N CA sing N N 194
LYS N H sing N N 195
LYS N H2 sing N N 196
LYS CA C sing N N 197
LYS CA CB sing N N 198
LYS CA HA sing N N 199
LYS C O doub N N 200
LYS C OXT sing N N 201
LYS CB CG sing N N 202
LYS CB HB2 sing N N 203
LYS CB HB3 sing N N 204
LYS CG CD sing N N 205
LYS CG HG2 sing N N 206
LYS CG HG3 sing N N 207
LYS CD CE sing N N 208
LYS CD HD2 sing N N 209
LYS CD HD3 sing N N 210
LYS CE NZ sing N N 211
LYS CE HE2 sing N N 212
LYS CE HE3 sing N N 213
LYS NZ HZ1 sing N N 214
LYS NZ HZ2 sing N N 215
LYS NZ HZ3 sing N N 216
LYS OXT HXT sing N N 217
MET N CA sing N N 218
MET N H sing N N 219
MET N H2 sing N N 220
MET CA C sing N N 221
MET CA CB sing N N 222
MET CA HA sing N N 223
MET C O doub N N 224
MET C OXT sing N N 225
MET CB CG sing N N 226
MET CB HB2 sing N N 227
MET CB HB3 sing N N 228
MET CG SD sing N N 229
MET CG HG2 sing N N 230
MET CG HG3 sing N N 231
MET SD CE sing N N 232
MET CE HE1 sing N N 233
MET CE HE2 sing N N 234
MET CE HE3 sing N N 235
MET OXT HXT sing N N 236
PHE N CA sing N N 237
PHE N H sing N N 238
PHE N H2 sing N N 239
PHE CA C sing N N 240
PHE CA CB sing N N 241
PHE CA HA sing N N 242
PHE C O doub N N 243
PHE C OXT sing N N 244
PHE CB CG sing N N 245
PHE CB HB2 sing N N 246
PHE CB HB3 sing N N 247
PHE CG CD1 doub Y N 248
PHE CG CD2 sing Y N 249
PHE CD1 CE1 sing Y N 250
PHE CD1 HD1 sing N N 251
PHE CD2 CE2 doub Y N 252
PHE CD2 HD2 sing N N 253
PHE CE1 CZ doub Y N 254
PHE CE1 HE1 sing N N 255
PHE CE2 CZ sing Y N 256
PHE CE2 HE2 sing N N 257
PHE CZ HZ sing N N 258
PHE OXT HXT sing N N 259
PRO N CA sing N N 260
PRO N CD sing N N 261
PRO N H sing N N 262
PRO CA C sing N N 263
PRO CA CB sing N N 264
PRO CA HA sing N N 265
PRO C O doub N N 266
PRO C OXT sing N N 267
PRO CB CG sing N N 268
PRO CB HB2 sing N N 269
PRO CB HB3 sing N N 270
PRO CG CD sing N N 271
PRO CG HG2 sing N N 272
PRO CG HG3 sing N N 273
PRO CD HD2 sing N N 274
PRO CD HD3 sing N N 275
PRO OXT HXT sing N N 276
SER N CA sing N N 277
SER N H sing N N 278
SER N H2 sing N N 279
SER CA C sing N N 280
SER CA CB sing N N 281
SER CA HA sing N N 282
SER C O doub N N 283
SER C OXT sing N N 284
SER CB OG sing N N 285
SER CB HB2 sing N N 286
SER CB HB3 sing N N 287
SER OG HG sing N N 288
SER OXT HXT sing N N 289
THR N CA sing N N 290
THR N H sing N N 291
THR N H2 sing N N 292
THR CA C sing N N 293
THR CA CB sing N N 294
THR CA HA sing N N 295
THR C O doub N N 296
THR C OXT sing N N 297
THR CB OG1 sing N N 298
THR CB CG2 sing N N 299
THR CB HB sing N N 300
THR OG1 HG1 sing N N 301
THR CG2 HG21 sing N N 302
THR CG2 HG22 sing N N 303
THR CG2 HG23 sing N N 304
THR OXT HXT sing N N 305
TRP N CA sing N N 306
TRP N H sing N N 307
TRP N H2 sing N N 308
TRP CA C sing N N 309
TRP CA CB sing N N 310
TRP CA HA sing N N 311
TRP C O doub N N 312
TRP C OXT sing N N 313
TRP CB CG sing N N 314
TRP CB HB2 sing N N 315
TRP CB HB3 sing N N 316
TRP CG CD1 doub Y N 317
TRP CG CD2 sing Y N 318
TRP CD1 NE1 sing Y N 319
TRP CD1 HD1 sing N N 320
TRP CD2 CE2 doub Y N 321
TRP CD2 CE3 sing Y N 322
TRP NE1 CE2 sing Y N 323
TRP NE1 HE1 sing N N 324
TRP CE2 CZ2 sing Y N 325
TRP CE3 CZ3 doub Y N 326
TRP CE3 HE3 sing N N 327
TRP CZ2 CH2 doub Y N 328
TRP CZ2 HZ2 sing N N 329
TRP CZ3 CH2 sing Y N 330
TRP CZ3 HZ3 sing N N 331
TRP CH2 HH2 sing N N 332
TRP OXT HXT sing N N 333
TYR N CA sing N N 334
TYR N H sing N N 335
TYR N H2 sing N N 336
TYR CA C sing N N 337
TYR CA CB sing N N 338
TYR CA HA sing N N 339
TYR C O doub N N 340
TYR C OXT sing N N 341
TYR CB CG sing N N 342
TYR CB HB2 sing N N 343
TYR CB HB3 sing N N 344
TYR CG CD1 doub Y N 345
TYR CG CD2 sing Y N 346
TYR CD1 CE1 sing Y N 347
TYR CD1 HD1 sing N N 348
TYR CD2 CE2 doub Y N 349
TYR CD2 HD2 sing N N 350
TYR CE1 CZ doub Y N 351
TYR CE1 HE1 sing N N 352
TYR CE2 CZ sing Y N 353
TYR CE2 HE2 sing N N 354
TYR CZ OH sing N N 355
TYR OH HH sing N N 356
TYR OXT HXT sing N N 357
VAL N CA sing N N 358
VAL N H sing N N 359
VAL N H2 sing N N 360
VAL CA C sing N N 361
VAL CA CB sing N N 362
VAL CA HA sing N N 363
VAL C O doub N N 364
VAL C OXT sing N N 365
VAL CB CG1 sing N N 366
VAL CB CG2 sing N N 367
VAL CB HB sing N N 368
VAL CG1 HG11 sing N N 369
VAL CG1 HG12 sing N N 370
VAL CG1 HG13 sing N N 371
VAL CG2 HG21 sing N N 372
VAL CG2 HG22 sing N N 373
VAL CG2 HG23 sing N N 374
VAL OXT HXT sing N N 375
XCW C25 C26 sing N N 376
XCW C25 C24 sing N N 377
XCW C26 C27 sing N N 378
XCW C24 C23 sing N N 379
XCW C27 C22 sing N N 380
XCW C23 C22 sing N N 381
XCW C22 C11 sing N N 382
XCW C11 C9 sing N N 383
XCW C11 N12 sing N N 384
XCW O10 C9 doub N N 385
XCW C9 N8 sing N N 386
XCW N12 C13 sing N N 387
XCW C13 O14 doub N N 388
XCW C13 C15 sing N N 389
XCW N8 C7 sing N N 390
XCW C16 C15 doub Y N 391
XCW C16 C17 sing Y N 392
XCW C15 N21 sing Y N 393
XCW C7 C6 sing N N 394
XCW C7 C28 sing N N 395
XCW C6 O5 sing N N 396
XCW C17 CL18 sing N N 397
XCW C17 C19 doub Y N 398
XCW N21 C19 sing Y N 399
XCW C31 C30 doub Y N 400
XCW C31 C32 sing Y N 401
XCW C30 C4 sing Y N 402
XCW C19 CL20 sing N N 403
XCW C32 C33 doub Y N 404
XCW C4 O5 sing N N 405
XCW C4 C3 doub Y N 406
XCW C28 O29 doub N N 407
XCW C28 N2 sing N N 408
XCW C33 C3 sing Y N 409
XCW C3 N2 sing N N 410
XCW N2 C1 sing N N 411
XCW C1 H36 sing N N 412
XCW C1 H34 sing N N 413
XCW C1 H35 sing N N 414
XCW C11 H41 sing N N 415
XCW C16 H43 sing N N 416
XCW C22 H45 sing N N 417
XCW C23 H47 sing N N 418
XCW C23 H46 sing N N 419
XCW C24 H49 sing N N 420
XCW C24 H48 sing N N 421
XCW C25 H50 sing N N 422
XCW C25 H51 sing N N 423
XCW C26 H53 sing N N 424
XCW C26 H52 sing N N 425
XCW C27 H55 sing N N 426
XCW C27 H54 sing N N 427
XCW C30 H56 sing N N 428
XCW C31 H57 sing N N 429
XCW C32 H58 sing N N 430
XCW C33 H59 sing N N 431
XCW C6 H38 sing N N 432
XCW C6 H37 sing N N 433
XCW C7 H39 sing N N 434
XCW N12 H42 sing N N 435
XCW N21 H44 sing N N 436
XCW N8 H40 sing N N 437
#
_pdbx_audit_support.funding_organization 'Not funded'
_pdbx_audit_support.country ?
_pdbx_audit_support.grant_number ?
_pdbx_audit_support.ordinal 1
#
_pdbx_initial_refinement_model.id 1
_pdbx_initial_refinement_model.entity_id_list ?
_pdbx_initial_refinement_model.type 'experimental model'
_pdbx_initial_refinement_model.source_name PDB
_pdbx_initial_refinement_model.accession_code 4HR9
_pdbx_initial_refinement_model.details ?
#
_space_group.name_H-M_alt 'I 2 2 2'
_space_group.name_Hall 'I 2 2'
_space_group.IT_number 23
_space_group.crystal_system orthorhombic
_space_group.id 1
#
_atom_sites.entry_id 8USS
_atom_sites.Cartn_transf_matrix[1][1] ?
_atom_sites.Cartn_transf_matrix[1][2] ?
_atom_sites.Cartn_transf_matrix[1][3] ?
_atom_sites.Cartn_transf_matrix[2][1] ?
_atom_sites.Cartn_transf_matrix[2][2] ?
_atom_sites.Cartn_transf_matrix[2][3] ?
_atom_sites.Cartn_transf_matrix[3][1] ?
_atom_sites.Cartn_transf_matrix[3][2] ?
_atom_sites.Cartn_transf_matrix[3][3] ?
_atom_sites.Cartn_transf_vector[1] ?
_atom_sites.Cartn_transf_vector[2] ?
_atom_sites.Cartn_transf_vector[3] ?
_atom_sites.Cartn_transform_axes ?
_atom_sites.fract_transf_matrix[1][1] 0.027322
_atom_sites.fract_transf_matrix[1][2] 0.000000
_atom_sites.fract_transf_matrix[1][3] 0.000000
_atom_sites.fract_transf_matrix[2][1] 0.000000
_atom_sites.fract_transf_matrix[2][2] 0.019849
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] 0.000000
_atom_sites.fract_transf_matrix[3][3] 0.006355
_atom_sites.fract_transf_vector[1] 0.00000
_atom_sites.fract_transf_vector[2] 0.00000
_atom_sites.fract_transf_vector[3] 0.00000
_atom_sites.solution_primary ?
_atom_sites.solution_secondary ?
_atom_sites.solution_hydrogens ?
_atom_sites.special_details ?
#
loop_
_atom_type.symbol
_atom_type.scat_dispersion_real
_atom_type.scat_dispersion_imag
_atom_type.scat_Cromer_Mann_a1
_atom_type.scat_Cromer_Mann_a2
_atom_type.scat_Cromer_Mann_a3
_atom_type.scat_Cromer_Mann_a4
_atom_type.scat_Cromer_Mann_b1
_atom_type.scat_Cromer_Mann_b2
_atom_type.scat_Cromer_Mann_b3
_atom_type.scat_Cromer_Mann_b4
_atom_type.scat_Cromer_Mann_c
_atom_type.scat_source
_atom_type.scat_dispersion_source
C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
?
CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
?
H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
?
N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
?
O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
?
S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
?
#
loop_