data_8BV2 # _entry.id 8BV2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.373 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8BV2 pdb_00008bv2 10.2210/pdb8bv2/pdb WWPDB D_1292127112 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8BV2 _pdbx_database_status.recvd_initial_deposition_date 2022-12-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ruff, M.' 1 0000-0001-5451-6377 'Benarous, R.' 2 0000-0003-0242-2816 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Antimicrob.Agents Chemother.' _citation.journal_id_ASTM AMACCQ _citation.journal_id_CSD 0788 _citation.journal_id_ISSN 1098-6596 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 67 _citation.language ? _citation.page_first e0046223 _citation.page_last e0046223 _citation.title 'Biological and Structural Analyses of New Potent Allosteric Inhibitors of HIV-1 Integrase.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/aac.00462-23 _citation.pdbx_database_id_PubMed 37310224 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bonnard, D.' 1 0000-0001-9529-5785 primary 'Le Rouzic, E.' 2 ? primary 'Singer, M.R.' 3 ? primary 'Yu, Z.' 4 ? primary 'Le Strat, F.' 5 ? primary 'Batisse, C.' 6 ? primary 'Batisse, J.' 7 ? primary 'Amadori, C.' 8 ? primary 'Chasset, S.' 9 ? primary 'Pye, V.E.' 10 ? primary 'Emiliani, S.' 11 ? primary 'Ledoussal, B.' 12 ? primary 'Ruff, M.' 13 ? primary 'Moreau, F.' 14 ? primary 'Cherepanov, P.' 15 0000-0002-0634-538X primary 'Benarous, R.' 16 0000-0003-0242-2816 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8BV2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 72.570 _cell.length_a_esd ? _cell.length_b 72.570 _cell.length_b_esd ? _cell.length_c 65.965 _cell.length_c_esd ? _cell.volume 300855.839 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8BV2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ;P 31 2" ; _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Integrase 20139.646 1 2.7.7.-,3.1.-.- ? ? ? 2 non-polymer syn '(2S)-2-[3-cyclopropyl-2-(3,4-dihydro-2H-chromen-6-yl)-6-methyl-phenyl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid' 394.503 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 5 water nat water 18.015 102 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name IN # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSMHGQVDCSPGIWQLD(CAS)THLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAG RWPVKTVHTDNGSNFTSTTVKAA(CAS)WWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFI HNKKRKGGIGGYSAGERIVDIIATDIQTKE ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPV KTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGG IGGYSAGERIVDIIATDIQTKE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 MET n 1 21 HIS n 1 22 GLY n 1 23 GLN n 1 24 VAL n 1 25 ASP n 1 26 CYS n 1 27 SER n 1 28 PRO n 1 29 GLY n 1 30 ILE n 1 31 TRP n 1 32 GLN n 1 33 LEU n 1 34 ASP n 1 35 CAS n 1 36 THR n 1 37 HIS n 1 38 LEU n 1 39 GLU n 1 40 GLY n 1 41 LYS n 1 42 VAL n 1 43 ILE n 1 44 LEU n 1 45 VAL n 1 46 ALA n 1 47 VAL n 1 48 HIS n 1 49 VAL n 1 50 ALA n 1 51 SER n 1 52 GLY n 1 53 TYR n 1 54 ILE n 1 55 GLU n 1 56 ALA n 1 57 GLU n 1 58 VAL n 1 59 ILE n 1 60 PRO n 1 61 ALA n 1 62 GLU n 1 63 THR n 1 64 GLY n 1 65 GLN n 1 66 GLU n 1 67 THR n 1 68 ALA n 1 69 TYR n 1 70 PHE n 1 71 LEU n 1 72 LEU n 1 73 LYS n 1 74 LEU n 1 75 ALA n 1 76 GLY n 1 77 ARG n 1 78 TRP n 1 79 PRO n 1 80 VAL n 1 81 LYS n 1 82 THR n 1 83 VAL n 1 84 HIS n 1 85 THR n 1 86 ASP n 1 87 ASN n 1 88 GLY n 1 89 SER n 1 90 ASN n 1 91 PHE n 1 92 THR n 1 93 SER n 1 94 THR n 1 95 THR n 1 96 VAL n 1 97 LYS n 1 98 ALA n 1 99 ALA n 1 100 CAS n 1 101 TRP n 1 102 TRP n 1 103 ALA n 1 104 GLY n 1 105 ILE n 1 106 LYS n 1 107 GLN n 1 108 GLU n 1 109 PHE n 1 110 GLY n 1 111 ILE n 1 112 PRO n 1 113 TYR n 1 114 ASN n 1 115 PRO n 1 116 GLN n 1 117 SER n 1 118 GLN n 1 119 GLY n 1 120 VAL n 1 121 VAL n 1 122 GLU n 1 123 SER n 1 124 MET n 1 125 ASN n 1 126 LYS n 1 127 GLU n 1 128 LEU n 1 129 LYS n 1 130 LYS n 1 131 ILE n 1 132 ILE n 1 133 GLY n 1 134 GLN n 1 135 VAL n 1 136 ARG n 1 137 ASP n 1 138 GLN n 1 139 ALA n 1 140 GLU n 1 141 HIS n 1 142 LEU n 1 143 LYS n 1 144 THR n 1 145 ALA n 1 146 VAL n 1 147 GLN n 1 148 MET n 1 149 ALA n 1 150 VAL n 1 151 PHE n 1 152 ILE n 1 153 HIS n 1 154 ASN n 1 155 LYS n 1 156 LYS n 1 157 ARG n 1 158 LYS n 1 159 GLY n 1 160 GLY n 1 161 ILE n 1 162 GLY n 1 163 GLY n 1 164 TYR n 1 165 SER n 1 166 ALA n 1 167 GLY n 1 168 GLU n 1 169 ARG n 1 170 ILE n 1 171 VAL n 1 172 ASP n 1 173 ILE n 1 174 ILE n 1 175 ALA n 1 176 THR n 1 177 ASP n 1 178 ILE n 1 179 GLN n 1 180 THR n 1 181 LYS n 1 182 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 182 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene gag-pol _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POL_HV1N5 _struct_ref.pdbx_db_accession P12497 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAA CWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQ TKE ; _struct_ref.pdbx_align_begin 1197 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8BV2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 20 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 182 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P12497 _struct_ref_seq.db_align_beg 1197 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1359 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 50 _struct_ref_seq.pdbx_auth_seq_align_end 212 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8BV2 MET A 1 ? UNP P12497 ? ? 'initiating methionine' 31 1 1 8BV2 GLY A 2 ? UNP P12497 ? ? 'expression tag' 32 2 1 8BV2 SER A 3 ? UNP P12497 ? ? 'expression tag' 33 3 1 8BV2 SER A 4 ? UNP P12497 ? ? 'expression tag' 34 4 1 8BV2 HIS A 5 ? UNP P12497 ? ? 'expression tag' 35 5 1 8BV2 HIS A 6 ? UNP P12497 ? ? 'expression tag' 36 6 1 8BV2 HIS A 7 ? UNP P12497 ? ? 'expression tag' 37 7 1 8BV2 HIS A 8 ? UNP P12497 ? ? 'expression tag' 38 8 1 8BV2 HIS A 9 ? UNP P12497 ? ? 'expression tag' 39 9 1 8BV2 HIS A 10 ? UNP P12497 ? ? 'expression tag' 40 10 1 8BV2 SER A 11 ? UNP P12497 ? ? 'expression tag' 41 11 1 8BV2 SER A 12 ? UNP P12497 ? ? 'expression tag' 42 12 1 8BV2 GLY A 13 ? UNP P12497 ? ? 'expression tag' 43 13 1 8BV2 LEU A 14 ? UNP P12497 ? ? 'expression tag' 44 14 1 8BV2 VAL A 15 ? UNP P12497 ? ? 'expression tag' 45 15 1 8BV2 PRO A 16 ? UNP P12497 ? ? 'expression tag' 46 16 1 8BV2 ARG A 17 ? UNP P12497 ? ? 'expression tag' 47 17 1 8BV2 GLY A 18 ? UNP P12497 ? ? 'expression tag' 48 18 1 8BV2 SER A 19 ? UNP P12497 ? ? 'expression tag' 49 19 1 8BV2 VAL A 121 ? UNP P12497 ILE 1298 'engineered mutation' 151 20 1 8BV2 LYS A 155 ? UNP P12497 PHE 1332 'engineered mutation' 185 21 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CAS 'L-peptide linking' n 'S-(DIMETHYLARSENIC)CYSTEINE' ? 'C5 H12 As N O2 S' 225.141 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RWR non-polymer . '(2S)-2-[3-cyclopropyl-2-(3,4-dihydro-2H-chromen-6-yl)-6-methyl-phenyl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid' ? 'C25 H30 O4' 394.503 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8BV2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.60 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;3 microliters of protein at 5 mg/mL in 50 mM MES pH5.5, 50 mM NaCl, 5 mM DTT mixed with 3 microliters of reservoir solution containing 0.1 M sodium cacodylate pH 6.5, 1.26 M ammonium sulfate. ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 120 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER R 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-09-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-X' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 29.84 _reflns.entry_id 8BV2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 20.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 131582 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 57.43 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.03 _reflns.pdbx_Rpim_I_all 0.01 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star 1 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.0286 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.072 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 11.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 13489 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 9.9 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.2094 _reflns_shell.pdbx_Rpim_I_all 0.06627 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.986 _reflns_shell.pdbx_CC_star 0.997 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.1985 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 31.65 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8BV2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 19.97 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 25842 _refine.ls_number_reflns_R_free 2555 _refine.ls_number_reflns_R_work 23287 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.58 _refine.ls_percent_reflns_R_free 9.89 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1985 _refine.ls_R_factor_R_free 0.2262 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1955 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.9872 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2016 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 19.97 _refine_hist.number_atoms_solvent 102 _refine_hist.number_atoms_total 1157 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1020 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 35 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0083 ? 1075 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.0241 ? 1461 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0533 ? 166 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0065 ? 175 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 9.2270 ? 145 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.00 2.04 . . 146 1275 100.00 . . . . 0.2227 . . . . . . . . . . . 0.2738 'X-RAY DIFFRACTION' 2.04 2.08 . . 148 1320 100.00 . . . . 0.2070 . . . . . . . . . . . 0.2786 'X-RAY DIFFRACTION' 2.08 2.13 . . 142 1347 100.00 . . . . 0.1911 . . . . . . . . . . . 0.2043 'X-RAY DIFFRACTION' 2.13 2.17 . . 140 1301 100.00 . . . . 0.1863 . . . . . . . . . . . 0.2586 'X-RAY DIFFRACTION' 2.18 2.23 . . 139 1216 94.29 . . . . 0.2532 . . . . . . . . . . . 0.3461 'X-RAY DIFFRACTION' 2.23 2.29 . . 121 1100 83.23 . . . . 0.3356 . . . . . . . . . . . 0.3438 'X-RAY DIFFRACTION' 2.29 2.36 . . 140 1302 100.00 . . . . 0.2087 . . . . . . . . . . . 0.3376 'X-RAY DIFFRACTION' 2.36 2.43 . . 146 1313 100.00 . . . . 0.2111 . . . . . . . . . . . 0.2713 'X-RAY DIFFRACTION' 2.43 2.52 . . 148 1321 99.93 . . . . 0.2110 . . . . . . . . . . . 0.2199 'X-RAY DIFFRACTION' 2.52 2.62 . . 142 1289 99.86 . . . . 0.2131 . . . . . . . . . . . 0.2489 'X-RAY DIFFRACTION' 2.62 2.74 . . 141 1350 99.87 . . . . 0.1977 . . . . . . . . . . . 0.2722 'X-RAY DIFFRACTION' 2.74 2.88 . . 144 1310 100.00 . . . . 0.2213 . . . . . . . . . . . 0.2371 'X-RAY DIFFRACTION' 2.88 3.06 . . 148 1311 99.86 . . . . 0.2036 . . . . . . . . . . . 0.2029 'X-RAY DIFFRACTION' 3.06 3.30 . . 138 1319 99.93 . . . . 0.1940 . . . . . . . . . . . 0.2123 'X-RAY DIFFRACTION' 3.30 3.63 . . 147 1312 99.79 . . . . 0.1786 . . . . . . . . . . . 0.1806 'X-RAY DIFFRACTION' 3.63 4.15 . . 145 1260 97.77 . . . . 0.1695 . . . . . . . . . . . 0.1632 'X-RAY DIFFRACTION' 4.15 5.20 . . 138 1328 100.00 . . . . 0.1630 . . . . . . . . . . . 0.2136 'X-RAY DIFFRACTION' 5.22 19.97 . . 142 1313 99.93 . . . . 0.1890 . . . . . . . . . . . 0.2307 # _struct.entry_id 8BV2 _struct.title 'Biological and structural analysis of new potent Integrase-LEDGF allosteric HIV-1 inhibitors' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8BV2 _struct_keywords.text 'inhibitors, integrase, HIV-1, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 63 ? TRP A 78 ? THR A 93 TRP A 108 1 ? 16 HELX_P HELX_P2 AA2 ASN A 87 ? THR A 92 ? ASN A 117 THR A 122 5 ? 6 HELX_P HELX_P3 AA3 SER A 93 ? GLY A 104 ? SER A 123 GLY A 134 1 ? 12 HELX_P HELX_P4 AA4 ASN A 125 ? ARG A 136 ? ASN A 155 ARG A 166 1 ? 12 HELX_P HELX_P5 AA5 ASP A 137 ? ALA A 139 ? ASP A 167 ALA A 169 5 ? 3 HELX_P HELX_P6 AA6 HIS A 141 ? LYS A 156 ? HIS A 171 LYS A 186 1 ? 16 HELX_P HELX_P7 AA7 SER A 165 ? ILE A 178 ? SER A 195 ILE A 208 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 34 C ? ? ? 1_555 A CAS 35 N ? ? A ASP 64 A CAS 65 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale2 covale both ? A CAS 35 C ? ? ? 1_555 A THR 36 N ? ? A CAS 65 A THR 66 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale3 covale both ? A ALA 99 C ? ? ? 1_555 A CAS 100 N ? ? A ALA 129 A CAS 130 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale4 covale both ? A CAS 100 C ? ? ? 1_555 A TRP 101 N ? ? A CAS 130 A TRP 131 1_555 ? ? ? ? ? ? ? 1.322 ? ? metalc1 metalc ? ? C MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 302 A HOH 429 1_555 ? ? ? ? ? ? ? 2.679 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 54 ? ILE A 59 ? ILE A 84 ILE A 89 AA1 2 LYS A 41 ? HIS A 48 ? LYS A 71 HIS A 78 AA1 3 ILE A 30 ? LEU A 38 ? ILE A 60 LEU A 68 AA1 4 THR A 82 ? HIS A 84 ? THR A 112 HIS A 114 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 55 ? O GLU A 85 N ALA A 46 ? N ALA A 76 AA1 2 3 O ILE A 43 ? O ILE A 73 N THR A 36 ? N THR A 66 AA1 3 4 N LEU A 33 ? N LEU A 63 O HIS A 84 ? O HIS A 114 # _atom_sites.entry_id 8BV2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013780 _atom_sites.fract_transf_matrix[1][2] 0.007956 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015912 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015160 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source AS ? ? 25.88022 7.02060 ? ? 1.67971 31.58991 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 ? ? 2.59044 63.03566 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 31 ? ? ? A . n A 1 2 GLY 2 32 ? ? ? A . n A 1 3 SER 3 33 ? ? ? A . n A 1 4 SER 4 34 ? ? ? A . n A 1 5 HIS 5 35 ? ? ? A . n A 1 6 HIS 6 36 ? ? ? A . n A 1 7 HIS 7 37 ? ? ? A . n A 1 8 HIS 8 38 ? ? ? A . n A 1 9 HIS 9 39 ? ? ? A . n A 1 10 HIS 10 40 ? ? ? A . n A 1 11 SER 11 41 ? ? ? A . n A 1 12 SER 12 42 ? ? ? A . n A 1 13 GLY 13 43 ? ? ? A . n A 1 14 LEU 14 44 ? ? ? A . n A 1 15 VAL 15 45 ? ? ? A . n A 1 16 PRO 16 46 ? ? ? A . n A 1 17 ARG 17 47 ? ? ? A . n A 1 18 GLY 18 48 ? ? ? A . n A 1 19 SER 19 49 ? ? ? A . n A 1 20 MET 20 50 ? ? ? A . n A 1 21 HIS 21 51 ? ? ? A . n A 1 22 GLY 22 52 ? ? ? A . n A 1 23 GLN 23 53 ? ? ? A . n A 1 24 VAL 24 54 ? ? ? A . n A 1 25 ASP 25 55 ? ? ? A . n A 1 26 CYS 26 56 ? ? ? A . n A 1 27 SER 27 57 57 SER SER A . n A 1 28 PRO 28 58 58 PRO PRO A . n A 1 29 GLY 29 59 59 GLY GLY A . n A 1 30 ILE 30 60 60 ILE ILE A . n A 1 31 TRP 31 61 61 TRP TRP A . n A 1 32 GLN 32 62 62 GLN GLN A . n A 1 33 LEU 33 63 63 LEU LEU A . n A 1 34 ASP 34 64 64 ASP ASP A . n A 1 35 CAS 35 65 65 CAS CAS A . n A 1 36 THR 36 66 66 THR THR A . n A 1 37 HIS 37 67 67 HIS HIS A . n A 1 38 LEU 38 68 68 LEU LEU A . n A 1 39 GLU 39 69 69 GLU GLU A . n A 1 40 GLY 40 70 70 GLY GLY A . n A 1 41 LYS 41 71 71 LYS LYS A . n A 1 42 VAL 42 72 72 VAL VAL A . n A 1 43 ILE 43 73 73 ILE ILE A . n A 1 44 LEU 44 74 74 LEU LEU A . n A 1 45 VAL 45 75 75 VAL VAL A . n A 1 46 ALA 46 76 76 ALA ALA A . n A 1 47 VAL 47 77 77 VAL VAL A . n A 1 48 HIS 48 78 78 HIS HIS A . n A 1 49 VAL 49 79 79 VAL VAL A . n A 1 50 ALA 50 80 80 ALA ALA A . n A 1 51 SER 51 81 81 SER SER A . n A 1 52 GLY 52 82 82 GLY GLY A . n A 1 53 TYR 53 83 83 TYR TYR A . n A 1 54 ILE 54 84 84 ILE ILE A . n A 1 55 GLU 55 85 85 GLU GLU A . n A 1 56 ALA 56 86 86 ALA ALA A . n A 1 57 GLU 57 87 87 GLU GLU A . n A 1 58 VAL 58 88 88 VAL VAL A . n A 1 59 ILE 59 89 89 ILE ILE A . n A 1 60 PRO 60 90 90 PRO PRO A . n A 1 61 ALA 61 91 91 ALA ALA A . n A 1 62 GLU 62 92 92 GLU GLU A . n A 1 63 THR 63 93 93 THR THR A . n A 1 64 GLY 64 94 94 GLY GLY A . n A 1 65 GLN 65 95 95 GLN GLN A . n A 1 66 GLU 66 96 96 GLU GLU A . n A 1 67 THR 67 97 97 THR THR A . n A 1 68 ALA 68 98 98 ALA ALA A . n A 1 69 TYR 69 99 99 TYR TYR A . n A 1 70 PHE 70 100 100 PHE PHE A . n A 1 71 LEU 71 101 101 LEU LEU A . n A 1 72 LEU 72 102 102 LEU LEU A . n A 1 73 LYS 73 103 103 LYS LYS A . n A 1 74 LEU 74 104 104 LEU LEU A . n A 1 75 ALA 75 105 105 ALA ALA A . n A 1 76 GLY 76 106 106 GLY GLY A . n A 1 77 ARG 77 107 107 ARG ARG A . n A 1 78 TRP 78 108 108 TRP TRP A . n A 1 79 PRO 79 109 109 PRO PRO A . n A 1 80 VAL 80 110 110 VAL VAL A . n A 1 81 LYS 81 111 111 LYS LYS A . n A 1 82 THR 82 112 112 THR THR A . n A 1 83 VAL 83 113 113 VAL VAL A . n A 1 84 HIS 84 114 114 HIS HIS A . n A 1 85 THR 85 115 115 THR THR A . n A 1 86 ASP 86 116 116 ASP ASP A . n A 1 87 ASN 87 117 117 ASN ASN A . n A 1 88 GLY 88 118 118 GLY GLY A . n A 1 89 SER 89 119 119 SER SER A . n A 1 90 ASN 90 120 120 ASN ASN A . n A 1 91 PHE 91 121 121 PHE PHE A . n A 1 92 THR 92 122 122 THR THR A . n A 1 93 SER 93 123 123 SER SER A . n A 1 94 THR 94 124 124 THR THR A . n A 1 95 THR 95 125 125 THR THR A . n A 1 96 VAL 96 126 126 VAL VAL A . n A 1 97 LYS 97 127 127 LYS LYS A . n A 1 98 ALA 98 128 128 ALA ALA A . n A 1 99 ALA 99 129 129 ALA ALA A . n A 1 100 CAS 100 130 130 CAS CAS A . n A 1 101 TRP 101 131 131 TRP TRP A . n A 1 102 TRP 102 132 132 TRP TRP A . n A 1 103 ALA 103 133 133 ALA ALA A . n A 1 104 GLY 104 134 134 GLY GLY A . n A 1 105 ILE 105 135 135 ILE ILE A . n A 1 106 LYS 106 136 136 LYS LYS A . n A 1 107 GLN 107 137 137 GLN GLN A . n A 1 108 GLU 108 138 ? ? ? A . n A 1 109 PHE 109 139 ? ? ? A . n A 1 110 GLY 110 140 ? ? ? A . n A 1 111 ILE 111 141 ? ? ? A . n A 1 112 PRO 112 142 ? ? ? A . n A 1 113 TYR 113 143 ? ? ? A . n A 1 114 ASN 114 144 ? ? ? A . n A 1 115 PRO 115 145 ? ? ? A . n A 1 116 GLN 116 146 ? ? ? A . n A 1 117 SER 117 147 ? ? ? A . n A 1 118 GLN 118 148 ? ? ? A . n A 1 119 GLY 119 149 ? ? ? A . n A 1 120 VAL 120 150 ? ? ? A . n A 1 121 VAL 121 151 ? ? ? A . n A 1 122 GLU 122 152 ? ? ? A . n A 1 123 SER 123 153 ? ? ? A . n A 1 124 MET 124 154 154 MET MET A . n A 1 125 ASN 125 155 155 ASN ASN A . n A 1 126 LYS 126 156 156 LYS LYS A . n A 1 127 GLU 127 157 157 GLU GLU A . n A 1 128 LEU 128 158 158 LEU LEU A . n A 1 129 LYS 129 159 159 LYS LYS A . n A 1 130 LYS 130 160 160 LYS LYS A . n A 1 131 ILE 131 161 161 ILE ILE A . n A 1 132 ILE 132 162 162 ILE ILE A . n A 1 133 GLY 133 163 163 GLY GLY A . n A 1 134 GLN 134 164 164 GLN GLN A . n A 1 135 VAL 135 165 165 VAL VAL A . n A 1 136 ARG 136 166 166 ARG ARG A . n A 1 137 ASP 137 167 167 ASP ASP A . n A 1 138 GLN 138 168 168 GLN GLN A . n A 1 139 ALA 139 169 169 ALA ALA A . n A 1 140 GLU 140 170 170 GLU GLU A . n A 1 141 HIS 141 171 171 HIS HIS A . n A 1 142 LEU 142 172 172 LEU LEU A . n A 1 143 LYS 143 173 173 LYS LYS A . n A 1 144 THR 144 174 174 THR THR A . n A 1 145 ALA 145 175 175 ALA ALA A . n A 1 146 VAL 146 176 176 VAL VAL A . n A 1 147 GLN 147 177 177 GLN GLN A . n A 1 148 MET 148 178 178 MET MET A . n A 1 149 ALA 149 179 179 ALA ALA A . n A 1 150 VAL 150 180 180 VAL VAL A . n A 1 151 PHE 151 181 181 PHE PHE A . n A 1 152 ILE 152 182 182 ILE ILE A . n A 1 153 HIS 153 183 183 HIS HIS A . n A 1 154 ASN 154 184 184 ASN ASN A . n A 1 155 LYS 155 185 185 LYS LYS A . n A 1 156 LYS 156 186 186 LYS LYS A . n A 1 157 ARG 157 187 187 ARG ARG A . n A 1 158 LYS 158 188 188 LYS LYS A . n A 1 159 GLY 159 189 ? ? ? A . n A 1 160 GLY 160 190 ? ? ? A . n A 1 161 ILE 161 191 ? ? ? A . n A 1 162 GLY 162 192 ? ? ? A . n A 1 163 GLY 163 193 ? ? ? A . n A 1 164 TYR 164 194 194 TYR TYR A . n A 1 165 SER 165 195 195 SER SER A . n A 1 166 ALA 166 196 196 ALA ALA A . n A 1 167 GLY 167 197 197 GLY GLY A . n A 1 168 GLU 168 198 198 GLU GLU A . n A 1 169 ARG 169 199 199 ARG ARG A . n A 1 170 ILE 170 200 200 ILE ILE A . n A 1 171 VAL 171 201 201 VAL VAL A . n A 1 172 ASP 172 202 202 ASP ASP A . n A 1 173 ILE 173 203 203 ILE ILE A . n A 1 174 ILE 174 204 204 ILE ILE A . n A 1 175 ALA 175 205 205 ALA ALA A . n A 1 176 THR 176 206 206 THR THR A . n A 1 177 ASP 177 207 207 ASP ASP A . n A 1 178 ILE 178 208 208 ILE ILE A . n A 1 179 GLN 179 209 ? ? ? A . n A 1 180 THR 180 210 ? ? ? A . n A 1 181 LYS 181 211 ? ? ? A . n A 1 182 GLU 182 212 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email benarous.r@wanadoo.fr _pdbx_contact_author.name_first Richard _pdbx_contact_author.name_last Benarous _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0242-2816 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 RWR 1 301 1 RWR BDM A . C 3 MG 1 302 1 MG MG A . D 4 SO4 1 303 1 SO4 SO4 A . E 5 HOH 1 401 88 HOH HOH A . E 5 HOH 2 402 24 HOH HOH A . E 5 HOH 3 403 8 HOH HOH A . E 5 HOH 4 404 34 HOH HOH A . E 5 HOH 5 405 29 HOH HOH A . E 5 HOH 6 406 4 HOH HOH A . E 5 HOH 7 407 35 HOH HOH A . E 5 HOH 8 408 95 HOH HOH A . E 5 HOH 9 409 55 HOH HOH A . E 5 HOH 10 410 16 HOH HOH A . E 5 HOH 11 411 96 HOH HOH A . E 5 HOH 12 412 10 HOH HOH A . E 5 HOH 13 413 5 HOH HOH A . E 5 HOH 14 414 26 HOH HOH A . E 5 HOH 15 415 48 HOH HOH A . E 5 HOH 16 416 60 HOH HOH A . E 5 HOH 17 417 22 HOH HOH A . E 5 HOH 18 418 68 HOH HOH A . E 5 HOH 19 419 9 HOH HOH A . E 5 HOH 20 420 1 HOH HOH A . E 5 HOH 21 421 12 HOH HOH A . E 5 HOH 22 422 47 HOH HOH A . E 5 HOH 23 423 11 HOH HOH A . E 5 HOH 24 424 82 HOH HOH A . E 5 HOH 25 425 80 HOH HOH A . E 5 HOH 26 426 85 HOH HOH A . E 5 HOH 27 427 6 HOH HOH A . E 5 HOH 28 428 30 HOH HOH A . E 5 HOH 29 429 14 HOH HOH A . E 5 HOH 30 430 19 HOH HOH A . E 5 HOH 31 431 21 HOH HOH A . E 5 HOH 32 432 36 HOH HOH A . E 5 HOH 33 433 50 HOH HOH A . E 5 HOH 34 434 7 HOH HOH A . E 5 HOH 35 435 15 HOH HOH A . E 5 HOH 36 436 17 HOH HOH A . E 5 HOH 37 437 77 HOH HOH A . E 5 HOH 38 438 39 HOH HOH A . E 5 HOH 39 439 2 HOH HOH A . E 5 HOH 40 440 3 HOH HOH A . E 5 HOH 41 441 65 HOH HOH A . E 5 HOH 42 442 44 HOH HOH A . E 5 HOH 43 443 51 HOH HOH A . E 5 HOH 44 444 38 HOH HOH A . E 5 HOH 45 445 23 HOH HOH A . E 5 HOH 46 446 59 HOH HOH A . E 5 HOH 47 447 104 HOH HOH A . E 5 HOH 48 448 20 HOH HOH A . E 5 HOH 49 449 45 HOH HOH A . E 5 HOH 50 450 27 HOH HOH A . E 5 HOH 51 451 52 HOH HOH A . E 5 HOH 52 452 81 HOH HOH A . E 5 HOH 53 453 87 HOH HOH A . E 5 HOH 54 454 94 HOH HOH A . E 5 HOH 55 455 102 HOH HOH A . E 5 HOH 56 456 53 HOH HOH A . E 5 HOH 57 457 76 HOH HOH A . E 5 HOH 58 458 42 HOH HOH A . E 5 HOH 59 459 31 HOH HOH A . E 5 HOH 60 460 91 HOH HOH A . E 5 HOH 61 461 78 HOH HOH A . E 5 HOH 62 462 64 HOH HOH A . E 5 HOH 63 463 28 HOH HOH A . E 5 HOH 64 464 69 HOH HOH A . E 5 HOH 65 465 54 HOH HOH A . E 5 HOH 66 466 57 HOH HOH A . E 5 HOH 67 467 61 HOH HOH A . E 5 HOH 68 468 105 HOH HOH A . E 5 HOH 69 469 43 HOH HOH A . E 5 HOH 70 470 79 HOH HOH A . E 5 HOH 71 471 66 HOH HOH A . E 5 HOH 72 472 40 HOH HOH A . E 5 HOH 73 473 25 HOH HOH A . E 5 HOH 74 474 92 HOH HOH A . E 5 HOH 75 475 98 HOH HOH A . E 5 HOH 76 476 70 HOH HOH A . E 5 HOH 77 477 90 HOH HOH A . E 5 HOH 78 478 86 HOH HOH A . E 5 HOH 79 479 67 HOH HOH A . E 5 HOH 80 480 41 HOH HOH A . E 5 HOH 81 481 49 HOH HOH A . E 5 HOH 82 482 32 HOH HOH A . E 5 HOH 83 483 75 HOH HOH A . E 5 HOH 84 484 103 HOH HOH A . E 5 HOH 85 485 106 HOH HOH A . E 5 HOH 86 486 107 HOH HOH A . E 5 HOH 87 487 46 HOH HOH A . E 5 HOH 88 488 101 HOH HOH A . E 5 HOH 89 489 71 HOH HOH A . E 5 HOH 90 490 109 HOH HOH A . E 5 HOH 91 491 33 HOH HOH A . E 5 HOH 92 492 97 HOH HOH A . E 5 HOH 93 493 18 HOH HOH A . E 5 HOH 94 494 89 HOH HOH A . E 5 HOH 95 495 73 HOH HOH A . E 5 HOH 96 496 108 HOH HOH A . E 5 HOH 97 497 58 HOH HOH A . E 5 HOH 98 498 99 HOH HOH A . E 5 HOH 99 499 37 HOH HOH A . E 5 HOH 100 500 63 HOH HOH A . E 5 HOH 101 501 83 HOH HOH A . E 5 HOH 102 502 74 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CAS 35 A CAS 65 ? CYS 'modified residue' 2 A CAS 100 A CAS 130 ? CYS 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3910 ? 1 MORE -64 ? 1 'SSA (A^2)' 11540 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_554 -x,-x+y,-z-2/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -43.9766666667 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-06-07 2 'Structure model' 1 1 2023-06-21 3 'Structure model' 1 2 2023-07-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_citation.journal_volume' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+1/3 3 -x+y,-x,z+2/3 4 x-y,-y,-z+2/3 5 -x,-x+y,-z+1/3 6 y,x,-z # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20_4459 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 8BV2 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 502 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.58 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 155 ? CG ? A ASN 125 CG 2 1 Y 1 A ASN 155 ? OD1 ? A ASN 125 OD1 3 1 Y 1 A ASN 155 ? ND2 ? A ASN 125 ND2 4 1 Y 1 A LYS 156 ? CG ? A LYS 126 CG 5 1 Y 1 A LYS 156 ? CD ? A LYS 126 CD 6 1 Y 1 A LYS 156 ? CE ? A LYS 126 CE 7 1 Y 1 A LYS 156 ? NZ ? A LYS 126 NZ 8 1 Y 1 A LYS 188 ? CD ? A LYS 158 CD 9 1 Y 1 A LYS 188 ? CE ? A LYS 158 CE 10 1 Y 1 A LYS 188 ? NZ ? A LYS 158 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 31 ? A MET 1 2 1 Y 1 A GLY 32 ? A GLY 2 3 1 Y 1 A SER 33 ? A SER 3 4 1 Y 1 A SER 34 ? A SER 4 5 1 Y 1 A HIS 35 ? A HIS 5 6 1 Y 1 A HIS 36 ? A HIS 6 7 1 Y 1 A HIS 37 ? A HIS 7 8 1 Y 1 A HIS 38 ? A HIS 8 9 1 Y 1 A HIS 39 ? A HIS 9 10 1 Y 1 A HIS 40 ? A HIS 10 11 1 Y 1 A SER 41 ? A SER 11 12 1 Y 1 A SER 42 ? A SER 12 13 1 Y 1 A GLY 43 ? A GLY 13 14 1 Y 1 A LEU 44 ? A LEU 14 15 1 Y 1 A VAL 45 ? A VAL 15 16 1 Y 1 A PRO 46 ? A PRO 16 17 1 Y 1 A ARG 47 ? A ARG 17 18 1 Y 1 A GLY 48 ? A GLY 18 19 1 Y 1 A SER 49 ? A SER 19 20 1 Y 1 A MET 50 ? A MET 20 21 1 Y 1 A HIS 51 ? A HIS 21 22 1 Y 1 A GLY 52 ? A GLY 22 23 1 Y 1 A GLN 53 ? A GLN 23 24 1 Y 1 A VAL 54 ? A VAL 24 25 1 Y 1 A ASP 55 ? A ASP 25 26 1 Y 1 A CYS 56 ? A CYS 26 27 1 Y 1 A GLU 138 ? A GLU 108 28 1 Y 1 A PHE 139 ? A PHE 109 29 1 Y 1 A GLY 140 ? A GLY 110 30 1 Y 1 A ILE 141 ? A ILE 111 31 1 Y 1 A PRO 142 ? A PRO 112 32 1 Y 1 A TYR 143 ? A TYR 113 33 1 Y 1 A ASN 144 ? A ASN 114 34 1 Y 1 A PRO 145 ? A PRO 115 35 1 Y 1 A GLN 146 ? A GLN 116 36 1 Y 1 A SER 147 ? A SER 117 37 1 Y 1 A GLN 148 ? A GLN 118 38 1 Y 1 A GLY 149 ? A GLY 119 39 1 Y 1 A VAL 150 ? A VAL 120 40 1 Y 1 A VAL 151 ? A VAL 121 41 1 Y 1 A GLU 152 ? A GLU 122 42 1 Y 1 A SER 153 ? A SER 123 43 1 Y 1 A GLY 189 ? A GLY 159 44 1 Y 1 A GLY 190 ? A GLY 160 45 1 Y 1 A ILE 191 ? A ILE 161 46 1 Y 1 A GLY 192 ? A GLY 162 47 1 Y 1 A GLY 193 ? A GLY 163 48 1 Y 1 A GLN 209 ? A GLN 179 49 1 Y 1 A THR 210 ? A THR 180 50 1 Y 1 A LYS 211 ? A LYS 181 51 1 Y 1 A GLU 212 ? A GLU 182 # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id RWR _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id RWR _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2S)-2-[3-cyclopropyl-2-(3,4-dihydro-2H-chromen-6-yl)-6-methyl-phenyl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid' RWR 3 'MAGNESIUM ION' MG 4 'SULFATE ION' SO4 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4LH4 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 31 2 1' _space_group.name_Hall ;P 31 2" ; _space_group.IT_number 152 _space_group.crystal_system trigonal _space_group.id 1 #