data_8C17 # _entry.id 8C17 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.368 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8C17 pdb_00008c17 10.2210/pdb8c17/pdb WWPDB D_1292127598 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8C17 _pdbx_database_status.recvd_initial_deposition_date 2022-12-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Scheufler, C.' 1 0000-0002-3693-3529 'Kallen, J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Chem.Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1554-8937 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 18 _citation.language ? _citation.page_first 643 _citation.page_last 651 _citation.title ;Biochemical and Structural Characterization of a Peptidic Inhibitor of the YAP:TEAD Interaction That Binds to the alpha-Helix Pocket on TEAD. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acschembio.2c00936 _citation.pdbx_database_id_PubMed 36825662 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mesrouze, Y.' 1 ? primary 'Gubler, H.' 2 ? primary 'Villard, F.' 3 ? primary 'Boesch, R.' 4 ? primary 'Ottl, J.' 5 ? primary 'Kallen, J.' 6 ? primary 'Reid, P.C.' 7 ? primary 'Scheufler, C.' 8 ? primary 'Marzinzik, A.L.' 9 ? primary 'Chene, P.' 10 ? # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 120 _cell.angle_gamma_esd ? _cell.entry_id 8C17 _cell.details ? _cell.formula_units_Z ? _cell.length_a 54.468 _cell.length_a_esd ? _cell.length_b 54.468 _cell.length_b_esd ? _cell.length_c 166.429 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8C17 _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcriptional enhancer factor TEF-3' 25597.838 1 ? ? ? ? 2 polymer syn 'Stapled peptide' 2250.511 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 4 non-polymer syn 'MYRISTIC ACID' 228.371 1 ? ? ? ? 5 water nat water 18.015 57 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TEA domain family member 4,TEAD-4,Transcription factor 13-like 1,Transcription factor RTEF-1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GPRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFF LVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFI HKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE ; ;GPRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFF LVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFI HKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE ; A ? 2 'polypeptide(L)' no yes '(ACY)FSP(NAL)DFH(T79)DI(NAL)CDV(NAL)RG(NH2)' XFSPADFHXDIACDVARGX B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 ARG n 1 4 SER n 1 5 VAL n 1 6 ALA n 1 7 SER n 1 8 SER n 1 9 LYS n 1 10 LEU n 1 11 TRP n 1 12 MET n 1 13 LEU n 1 14 GLU n 1 15 PHE n 1 16 SER n 1 17 ALA n 1 18 PHE n 1 19 LEU n 1 20 GLU n 1 21 GLN n 1 22 GLN n 1 23 GLN n 1 24 ASP n 1 25 PRO n 1 26 ASP n 1 27 THR n 1 28 TYR n 1 29 ASN n 1 30 LYS n 1 31 HIS n 1 32 LEU n 1 33 PHE n 1 34 VAL n 1 35 HIS n 1 36 ILE n 1 37 GLY n 1 38 GLN n 1 39 SER n 1 40 SER n 1 41 PRO n 1 42 SER n 1 43 TYR n 1 44 SER n 1 45 ASP n 1 46 PRO n 1 47 TYR n 1 48 LEU n 1 49 GLU n 1 50 ALA n 1 51 VAL n 1 52 ASP n 1 53 ILE n 1 54 ARG n 1 55 GLN n 1 56 ILE n 1 57 TYR n 1 58 ASP n 1 59 LYS n 1 60 PHE n 1 61 PRO n 1 62 GLU n 1 63 LYS n 1 64 LYS n 1 65 GLY n 1 66 GLY n 1 67 LEU n 1 68 LYS n 1 69 ASP n 1 70 LEU n 1 71 PHE n 1 72 GLU n 1 73 ARG n 1 74 GLY n 1 75 PRO n 1 76 SER n 1 77 ASN n 1 78 ALA n 1 79 PHE n 1 80 PHE n 1 81 LEU n 1 82 VAL n 1 83 LYS n 1 84 PHE n 1 85 TRP n 1 86 ALA n 1 87 ASP n 1 88 LEU n 1 89 ASN n 1 90 THR n 1 91 ASN n 1 92 ILE n 1 93 GLU n 1 94 ASP n 1 95 GLU n 1 96 GLY n 1 97 SER n 1 98 SER n 1 99 PHE n 1 100 TYR n 1 101 GLY n 1 102 VAL n 1 103 SER n 1 104 SER n 1 105 GLN n 1 106 TYR n 1 107 GLU n 1 108 SER n 1 109 PRO n 1 110 GLU n 1 111 ASN n 1 112 MET n 1 113 ILE n 1 114 ILE n 1 115 THR n 1 116 CYS n 1 117 SER n 1 118 THR n 1 119 LYS n 1 120 VAL n 1 121 CYS n 1 122 SER n 1 123 PHE n 1 124 GLY n 1 125 LYS n 1 126 GLN n 1 127 VAL n 1 128 VAL n 1 129 GLU n 1 130 LYS n 1 131 VAL n 1 132 GLU n 1 133 THR n 1 134 GLU n 1 135 TYR n 1 136 ALA n 1 137 ARG n 1 138 TYR n 1 139 GLU n 1 140 ASN n 1 141 GLY n 1 142 HIS n 1 143 TYR n 1 144 SER n 1 145 TYR n 1 146 ARG n 1 147 ILE n 1 148 HIS n 1 149 ARG n 1 150 SER n 1 151 PRO n 1 152 LEU n 1 153 CYS n 1 154 GLU n 1 155 TYR n 1 156 MET n 1 157 ILE n 1 158 ASN n 1 159 PHE n 1 160 ILE n 1 161 HIS n 1 162 LYS n 1 163 LEU n 1 164 LYS n 1 165 HIS n 1 166 LEU n 1 167 PRO n 1 168 GLU n 1 169 LYS n 1 170 TYR n 1 171 MET n 1 172 MET n 1 173 ASN n 1 174 SER n 1 175 VAL n 1 176 LEU n 1 177 GLU n 1 178 ASN n 1 179 PHE n 1 180 THR n 1 181 ILE n 1 182 LEU n 1 183 GLN n 1 184 VAL n 1 185 VAL n 1 186 THR n 1 187 ASN n 1 188 ARG n 1 189 ASP n 1 190 THR n 1 191 GLN n 1 192 GLU n 1 193 THR n 1 194 LEU n 1 195 LEU n 1 196 CYS n 1 197 ILE n 1 198 ALA n 1 199 TYR n 1 200 VAL n 1 201 PHE n 1 202 GLU n 1 203 VAL n 1 204 SER n 1 205 ALA n 1 206 SER n 1 207 GLU n 1 208 HIS n 1 209 GLY n 1 210 ALA n 1 211 GLN n 1 212 HIS n 1 213 HIS n 1 214 ILE n 1 215 TYR n 1 216 ARG n 1 217 LEU n 1 218 VAL n 1 219 LYS n 1 220 GLU n 2 1 ACY n 2 2 PHE n 2 3 SER n 2 4 PRO n 2 5 NAL n 2 6 ASP n 2 7 PHE n 2 8 HIS n 2 9 T79 n 2 10 ASP n 2 11 ILE n 2 12 NAL n 2 13 CYS n 2 14 ASP n 2 15 VAL n 2 16 NAL n 2 17 ARG n 2 18 GLY n 2 19 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 220 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TEAD4, RTEF1, TCF13L1, TEF3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 19 _pdbx_entity_src_syn.organism_scientific 'Synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP TEAD4_HUMAN Q15561 ? 1 ;RSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLV KFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHK LKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE ; 217 2 PDB 8C17 8C17 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8C17 A 3 ? 220 ? Q15561 217 ? 434 ? 217 434 2 2 8C17 B 1 ? 19 ? 8C17 1 ? 19 ? 1 19 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8C17 GLY A 1 ? UNP Q15561 ? ? 'expression tag' 215 1 1 8C17 PRO A 2 ? UNP Q15561 ? ? 'expression tag' 216 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACY non-polymer . 'ACETIC ACID' ? 'C2 H4 O2' 60.052 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MYR non-polymer . 'MYRISTIC ACID' ? 'C14 H28 O2' 228.371 NAL 'L-peptide linking' n 'BETA-(2-NAPHTHYL)-ALANINE' ? 'C13 H13 N O2' 215.248 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 T79 'L-peptide linking' . '(2S)-2-azanylhex-4-ynoic acid' '(S)-2-Aminohex-4-ynoic acid; peptide staple' 'C6 H9 N O2' 127.141 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8C17 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.48 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.44 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.4 M sodium malonate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-09-05 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8C17 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.25 _reflns.d_resolution_low 24.45 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12749 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 89.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.112 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.25 _reflns_shell.d_res_low 2.34 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 639 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.819 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.332 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.9101 _refine.aniso_B[1][2] 0 _refine.aniso_B[1][3] 0 _refine.aniso_B[2][2] 0.9101 _refine.aniso_B[2][3] 0 _refine.aniso_B[3][3] -1.8202 _refine.B_iso_max ? _refine.B_iso_mean 47.73 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.942 _refine.correlation_coeff_Fo_to_Fc_free 0.93 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8C17 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.25 _refine.ls_d_res_low 18.49 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12728 _refine.ls_number_reflns_R_free 612 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 89.3 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2106 _refine.ls_R_factor_R_free 0.2384 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2092 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.219 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.221 _refine.pdbx_overall_SU_R_Blow_DPI 0.33 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.314 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 8C17 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.33 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.25 _refine_hist.d_res_low 18.49 _refine_hist.number_atoms_solvent 57 _refine_hist.number_atoms_total 1986 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1761 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 168 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1984 ? t_bond_d 2 HARMONIC 'X-RAY DIFFRACTION' ? 0.99 ? 2688 ? t_angle_deg 2 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 674 ? t_dihedral_angle_d 2 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 333 ? t_gen_planes 5 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1984 ? t_it 10 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 247 ? t_chiral_improper_torsion 5 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? 1418 ? t_ideal_dist_contact 4 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 3.52 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 11.22 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.25 _refine_ls_shell.d_res_low 2.31 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 425 _refine_ls_shell.number_reflns_R_free 20 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.percent_reflns_obs 39.27 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs 0.2339 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2357 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.1993 # _struct.entry_id 8C17 _struct.title 'Crystal structure of TEAD4 in complex with peptide 1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8C17 _struct_keywords.text 'Complex, Inhibitor, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 54 ? PHE A 60 ? ARG A 268 PHE A 274 5 ? 7 HELX_P HELX_P2 AA2 GLY A 66 ? GLY A 74 ? GLY A 280 GLY A 288 1 ? 9 HELX_P HELX_P3 AA3 PRO A 75 ? ASN A 77 ? PRO A 289 ASN A 291 5 ? 3 HELX_P HELX_P4 AA4 CYS A 153 ? HIS A 165 ? CYS A 367 HIS A 379 1 ? 13 HELX_P HELX_P5 AA5 GLU A 168 ? GLU A 177 ? GLU A 382 GLU A 391 1 ? 10 HELX_P HELX_P6 AA6 SER B 3 ? CYS B 13 ? SER B 3 CYS B 13 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? A LYS 130 NZ ? ? ? 1_555 E MYR . C1 ? ? A LYS 344 A MYR 503 1_555 ? ? ? ? ? ? ? 1.356 ? ? covale2 covale one ? B ACY 1 C ? ? ? 1_555 B PHE 2 N ? ? B ACY 1 B PHE 2 1_555 ? ? ? ? ? ? ? 1.355 ? ? covale3 covale both ? B PRO 4 C ? ? ? 1_555 B NAL 5 N ? ? B PRO 4 B NAL 5 1_555 ? ? ? ? ? ? ? 1.356 ? ? covale4 covale both ? B NAL 5 C ? ? ? 1_555 B ASP 6 N ? ? B NAL 5 B ASP 6 1_555 ? ? ? ? ? ? ? 1.359 ? ? covale5 covale both ? B HIS 8 C ? ? ? 1_555 B T79 9 N ? ? B HIS 8 B T79 9 1_555 ? ? ? ? ? ? ? 1.360 ? ? covale6 covale both ? B T79 9 C ? ? ? 1_555 B ASP 10 N ? ? B T79 9 B ASP 10 1_555 ? ? ? ? ? ? ? 1.368 ? ? covale7 covale none ? B T79 9 CE1 ? ? ? 1_555 B CYS 13 SG ? ? B T79 9 B CYS 13 1_555 ? ? ? ? ? ? ? 1.818 ? ? covale8 covale both ? B ILE 11 C ? ? ? 1_555 B NAL 12 N ? ? B ILE 11 B NAL 12 1_555 ? ? ? ? ? ? ? 1.356 ? ? covale9 covale both ? B NAL 12 C ? ? ? 1_555 B CYS 13 N ? ? B NAL 12 B CYS 13 1_555 ? ? ? ? ? ? ? 1.354 ? ? covale10 covale both ? B VAL 15 C ? ? ? 1_555 B NAL 16 N ? ? B VAL 15 B NAL 16 1_555 ? ? ? ? ? ? ? 1.360 ? ? covale11 covale both ? B NAL 16 C ? ? ? 1_555 B ARG 17 N ? ? B NAL 16 B ARG 17 1_555 ? ? ? ? ? ? ? 1.356 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 74 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 288 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 75 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 289 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.95 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? AA3 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 5 ? ALA A 6 ? VAL A 219 ALA A 220 AA1 2 TRP A 11 ? ASP A 24 ? TRP A 225 ASP A 238 AA1 3 THR A 27 ? ILE A 36 ? THR A 241 ILE A 250 AA2 1 VAL A 5 ? ALA A 6 ? VAL A 219 ALA A 220 AA2 2 TRP A 11 ? ASP A 24 ? TRP A 225 ASP A 238 AA2 3 SER A 97 ? SER A 108 ? SER A 311 SER A 322 AA2 4 HIS A 142 ? PRO A 151 ? HIS A 356 PRO A 365 AA2 5 ARG A 137 ? GLU A 139 ? ARG A 351 GLU A 353 AA3 1 ALA A 50 ? ASP A 52 ? ALA A 264 ASP A 266 AA3 2 GLN A 211 ? VAL A 218 ? GLN A 425 VAL A 432 AA3 3 PHE A 79 ? ALA A 86 ? PHE A 293 ALA A 300 AA3 4 THR A 193 ? VAL A 203 ? THR A 407 VAL A 417 AA3 5 PHE A 179 ? ASN A 187 ? PHE A 393 ASN A 401 AA3 6 ILE A 114 ? SER A 122 ? ILE A 328 SER A 336 AA3 7 LYS A 125 ? GLU A 134 ? LYS A 339 GLU A 348 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 5 ? N VAL A 219 O MET A 12 ? O MET A 226 AA1 2 3 N GLN A 21 ? N GLN A 235 O ASN A 29 ? O ASN A 243 AA2 1 2 N VAL A 5 ? N VAL A 219 O MET A 12 ? O MET A 226 AA2 2 3 N GLN A 22 ? N GLN A 236 O SER A 97 ? O SER A 311 AA2 3 4 N TYR A 106 ? N TYR A 320 O TYR A 145 ? O TYR A 359 AA2 4 5 O SER A 144 ? O SER A 358 N ARG A 137 ? N ARG A 351 AA3 1 2 N VAL A 51 ? N VAL A 265 O ARG A 216 ? O ARG A 430 AA3 2 3 O TYR A 215 ? O TYR A 429 N LEU A 81 ? N LEU A 295 AA3 3 4 N ALA A 86 ? N ALA A 300 O GLU A 202 ? O GLU A 416 AA3 4 5 O LEU A 195 ? O LEU A 409 N VAL A 185 ? N VAL A 399 AA3 5 6 O THR A 180 ? O THR A 394 N CYS A 121 ? N CYS A 335 AA3 6 7 N CYS A 116 ? N CYS A 330 O GLU A 132 ? O GLU A 346 # _atom_sites.entry_id 8C17 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018359 _atom_sites.fract_transf_matrix[1][2] 0.010600 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021200 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006009 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 215 215 GLY GLY A . n A 1 2 PRO 2 216 216 PRO PRO A . n A 1 3 ARG 3 217 217 ARG ARG A . n A 1 4 SER 4 218 218 SER SER A . n A 1 5 VAL 5 219 219 VAL VAL A . n A 1 6 ALA 6 220 220 ALA ALA A . n A 1 7 SER 7 221 221 SER SER A . n A 1 8 SER 8 222 222 SER SER A . n A 1 9 LYS 9 223 223 LYS LYS A . n A 1 10 LEU 10 224 224 LEU LEU A . n A 1 11 TRP 11 225 225 TRP TRP A . n A 1 12 MET 12 226 226 MET MET A . n A 1 13 LEU 13 227 227 LEU LEU A . n A 1 14 GLU 14 228 228 GLU GLU A . n A 1 15 PHE 15 229 229 PHE PHE A . n A 1 16 SER 16 230 230 SER SER A . n A 1 17 ALA 17 231 231 ALA ALA A . n A 1 18 PHE 18 232 232 PHE PHE A . n A 1 19 LEU 19 233 233 LEU LEU A . n A 1 20 GLU 20 234 234 GLU GLU A . n A 1 21 GLN 21 235 235 GLN GLN A . n A 1 22 GLN 22 236 236 GLN GLN A . n A 1 23 GLN 23 237 237 GLN GLN A . n A 1 24 ASP 24 238 238 ASP ASP A . n A 1 25 PRO 25 239 239 PRO PRO A . n A 1 26 ASP 26 240 240 ASP ASP A . n A 1 27 THR 27 241 241 THR THR A . n A 1 28 TYR 28 242 242 TYR TYR A . n A 1 29 ASN 29 243 243 ASN ASN A . n A 1 30 LYS 30 244 244 LYS LYS A . n A 1 31 HIS 31 245 245 HIS HIS A . n A 1 32 LEU 32 246 246 LEU LEU A . n A 1 33 PHE 33 247 247 PHE PHE A . n A 1 34 VAL 34 248 248 VAL VAL A . n A 1 35 HIS 35 249 249 HIS HIS A . n A 1 36 ILE 36 250 250 ILE ILE A . n A 1 37 GLY 37 251 251 GLY GLY A . n A 1 38 GLN 38 252 252 GLN GLN A . n A 1 39 SER 39 253 253 SER SER A . n A 1 40 SER 40 254 254 SER SER A . n A 1 41 PRO 41 255 255 PRO PRO A . n A 1 42 SER 42 256 256 SER SER A . n A 1 43 TYR 43 257 257 TYR TYR A . n A 1 44 SER 44 258 258 SER SER A . n A 1 45 ASP 45 259 259 ASP ASP A . n A 1 46 PRO 46 260 260 PRO PRO A . n A 1 47 TYR 47 261 261 TYR TYR A . n A 1 48 LEU 48 262 262 LEU LEU A . n A 1 49 GLU 49 263 263 GLU GLU A . n A 1 50 ALA 50 264 264 ALA ALA A . n A 1 51 VAL 51 265 265 VAL VAL A . n A 1 52 ASP 52 266 266 ASP ASP A . n A 1 53 ILE 53 267 267 ILE ILE A . n A 1 54 ARG 54 268 268 ARG ARG A . n A 1 55 GLN 55 269 269 GLN GLN A . n A 1 56 ILE 56 270 270 ILE ILE A . n A 1 57 TYR 57 271 271 TYR TYR A . n A 1 58 ASP 58 272 272 ASP ASP A . n A 1 59 LYS 59 273 273 LYS LYS A . n A 1 60 PHE 60 274 274 PHE PHE A . n A 1 61 PRO 61 275 275 PRO PRO A . n A 1 62 GLU 62 276 276 GLU GLU A . n A 1 63 LYS 63 277 277 LYS LYS A . n A 1 64 LYS 64 278 278 LYS LYS A . n A 1 65 GLY 65 279 279 GLY GLY A . n A 1 66 GLY 66 280 280 GLY GLY A . n A 1 67 LEU 67 281 281 LEU LEU A . n A 1 68 LYS 68 282 282 LYS LYS A . n A 1 69 ASP 69 283 283 ASP ASP A . n A 1 70 LEU 70 284 284 LEU LEU A . n A 1 71 PHE 71 285 285 PHE PHE A . n A 1 72 GLU 72 286 286 GLU GLU A . n A 1 73 ARG 73 287 287 ARG ARG A . n A 1 74 GLY 74 288 288 GLY GLY A . n A 1 75 PRO 75 289 289 PRO PRO A . n A 1 76 SER 76 290 290 SER SER A . n A 1 77 ASN 77 291 291 ASN ASN A . n A 1 78 ALA 78 292 292 ALA ALA A . n A 1 79 PHE 79 293 293 PHE PHE A . n A 1 80 PHE 80 294 294 PHE PHE A . n A 1 81 LEU 81 295 295 LEU LEU A . n A 1 82 VAL 82 296 296 VAL VAL A . n A 1 83 LYS 83 297 297 LYS LYS A . n A 1 84 PHE 84 298 298 PHE PHE A . n A 1 85 TRP 85 299 299 TRP TRP A . n A 1 86 ALA 86 300 300 ALA ALA A . n A 1 87 ASP 87 301 301 ASP ASP A . n A 1 88 LEU 88 302 302 LEU LEU A . n A 1 89 ASN 89 303 303 ASN ASN A . n A 1 90 THR 90 304 304 THR THR A . n A 1 91 ASN 91 305 305 ASN ASN A . n A 1 92 ILE 92 306 306 ILE ILE A . n A 1 93 GLU 93 307 307 GLU GLU A . n A 1 94 ASP 94 308 308 ASP ASP A . n A 1 95 GLU 95 309 309 GLU GLU A . n A 1 96 GLY 96 310 310 GLY GLY A . n A 1 97 SER 97 311 311 SER SER A . n A 1 98 SER 98 312 312 SER SER A . n A 1 99 PHE 99 313 313 PHE PHE A . n A 1 100 TYR 100 314 314 TYR TYR A . n A 1 101 GLY 101 315 315 GLY GLY A . n A 1 102 VAL 102 316 316 VAL VAL A . n A 1 103 SER 103 317 317 SER SER A . n A 1 104 SER 104 318 318 SER SER A . n A 1 105 GLN 105 319 319 GLN GLN A . n A 1 106 TYR 106 320 320 TYR TYR A . n A 1 107 GLU 107 321 321 GLU GLU A . n A 1 108 SER 108 322 322 SER SER A . n A 1 109 PRO 109 323 323 PRO PRO A . n A 1 110 GLU 110 324 324 GLU GLU A . n A 1 111 ASN 111 325 325 ASN ASN A . n A 1 112 MET 112 326 326 MET MET A . n A 1 113 ILE 113 327 327 ILE ILE A . n A 1 114 ILE 114 328 328 ILE ILE A . n A 1 115 THR 115 329 329 THR THR A . n A 1 116 CYS 116 330 330 CYS CYS A . n A 1 117 SER 117 331 331 SER SER A . n A 1 118 THR 118 332 332 THR THR A . n A 1 119 LYS 119 333 333 LYS LYS A . n A 1 120 VAL 120 334 334 VAL VAL A . n A 1 121 CYS 121 335 335 CYS CYS A . n A 1 122 SER 122 336 336 SER SER A . n A 1 123 PHE 123 337 337 PHE PHE A . n A 1 124 GLY 124 338 338 GLY GLY A . n A 1 125 LYS 125 339 339 LYS LYS A . n A 1 126 GLN 126 340 340 GLN GLN A . n A 1 127 VAL 127 341 341 VAL VAL A . n A 1 128 VAL 128 342 342 VAL VAL A . n A 1 129 GLU 129 343 343 GLU GLU A . n A 1 130 LYS 130 344 344 LYS MYK A . n A 1 131 VAL 131 345 345 VAL VAL A . n A 1 132 GLU 132 346 346 GLU GLU A . n A 1 133 THR 133 347 347 THR THR A . n A 1 134 GLU 134 348 348 GLU GLU A . n A 1 135 TYR 135 349 349 TYR TYR A . n A 1 136 ALA 136 350 350 ALA ALA A . n A 1 137 ARG 137 351 351 ARG ARG A . n A 1 138 TYR 138 352 352 TYR TYR A . n A 1 139 GLU 139 353 353 GLU GLU A . n A 1 140 ASN 140 354 354 ASN ASN A . n A 1 141 GLY 141 355 355 GLY GLY A . n A 1 142 HIS 142 356 356 HIS HIS A . n A 1 143 TYR 143 357 357 TYR TYR A . n A 1 144 SER 144 358 358 SER SER A . n A 1 145 TYR 145 359 359 TYR TYR A . n A 1 146 ARG 146 360 360 ARG ARG A . n A 1 147 ILE 147 361 361 ILE ILE A . n A 1 148 HIS 148 362 362 HIS HIS A . n A 1 149 ARG 149 363 363 ARG ARG A . n A 1 150 SER 150 364 364 SER SER A . n A 1 151 PRO 151 365 365 PRO PRO A . n A 1 152 LEU 152 366 366 LEU LEU A . n A 1 153 CYS 153 367 367 CYS CYS A . n A 1 154 GLU 154 368 368 GLU GLU A . n A 1 155 TYR 155 369 369 TYR TYR A . n A 1 156 MET 156 370 370 MET MET A . n A 1 157 ILE 157 371 371 ILE ILE A . n A 1 158 ASN 158 372 372 ASN ASN A . n A 1 159 PHE 159 373 373 PHE PHE A . n A 1 160 ILE 160 374 374 ILE ILE A . n A 1 161 HIS 161 375 375 HIS HIS A . n A 1 162 LYS 162 376 376 LYS LYS A . n A 1 163 LEU 163 377 377 LEU LEU A . n A 1 164 LYS 164 378 378 LYS LYS A . n A 1 165 HIS 165 379 379 HIS HIS A . n A 1 166 LEU 166 380 380 LEU LEU A . n A 1 167 PRO 167 381 381 PRO PRO A . n A 1 168 GLU 168 382 382 GLU GLU A . n A 1 169 LYS 169 383 383 LYS LYS A . n A 1 170 TYR 170 384 384 TYR TYR A . n A 1 171 MET 171 385 385 MET MET A . n A 1 172 MET 172 386 386 MET MET A . n A 1 173 ASN 173 387 387 ASN ASN A . n A 1 174 SER 174 388 388 SER SER A . n A 1 175 VAL 175 389 389 VAL VAL A . n A 1 176 LEU 176 390 390 LEU LEU A . n A 1 177 GLU 177 391 391 GLU GLU A . n A 1 178 ASN 178 392 392 ASN ASN A . n A 1 179 PHE 179 393 393 PHE PHE A . n A 1 180 THR 180 394 394 THR THR A . n A 1 181 ILE 181 395 395 ILE ILE A . n A 1 182 LEU 182 396 396 LEU LEU A . n A 1 183 GLN 183 397 397 GLN GLN A . n A 1 184 VAL 184 398 398 VAL VAL A . n A 1 185 VAL 185 399 399 VAL VAL A . n A 1 186 THR 186 400 400 THR THR A . n A 1 187 ASN 187 401 401 ASN ASN A . n A 1 188 ARG 188 402 402 ARG ARG A . n A 1 189 ASP 189 403 403 ASP ASP A . n A 1 190 THR 190 404 404 THR THR A . n A 1 191 GLN 191 405 405 GLN GLN A . n A 1 192 GLU 192 406 406 GLU GLU A . n A 1 193 THR 193 407 407 THR THR A . n A 1 194 LEU 194 408 408 LEU LEU A . n A 1 195 LEU 195 409 409 LEU LEU A . n A 1 196 CYS 196 410 410 CYS CYS A . n A 1 197 ILE 197 411 411 ILE ILE A . n A 1 198 ALA 198 412 412 ALA ALA A . n A 1 199 TYR 199 413 413 TYR TYR A . n A 1 200 VAL 200 414 414 VAL VAL A . n A 1 201 PHE 201 415 415 PHE PHE A . n A 1 202 GLU 202 416 416 GLU GLU A . n A 1 203 VAL 203 417 417 VAL VAL A . n A 1 204 SER 204 418 418 SER SER A . n A 1 205 ALA 205 419 419 ALA ALA A . n A 1 206 SER 206 420 420 SER SER A . n A 1 207 GLU 207 421 421 GLU GLU A . n A 1 208 HIS 208 422 422 HIS HIS A . n A 1 209 GLY 209 423 423 GLY GLY A . n A 1 210 ALA 210 424 424 ALA ALA A . n A 1 211 GLN 211 425 425 GLN GLN A . n A 1 212 HIS 212 426 426 HIS HIS A . n A 1 213 HIS 213 427 427 HIS HIS A . n A 1 214 ILE 214 428 428 ILE ILE A . n A 1 215 TYR 215 429 429 TYR TYR A . n A 1 216 ARG 216 430 430 ARG ARG A . n A 1 217 LEU 217 431 431 LEU LEU A . n A 1 218 VAL 218 432 432 VAL VAL A . n A 1 219 LYS 219 433 433 LYS LYS A . n A 1 220 GLU 220 434 434 GLU GLU A . n B 2 1 ACY 1 1 1 ACY LI1 B . n B 2 2 PHE 2 2 1 PHE LI1 B . n B 2 3 SER 3 3 1 SER LI1 B . n B 2 4 PRO 4 4 1 PRO LI1 B . n B 2 5 NAL 5 5 1 NAL LI1 B . n B 2 6 ASP 6 6 1 ASP LI1 B . n B 2 7 PHE 7 7 1 PHE LI1 B . n B 2 8 HIS 8 8 1 HIS LI1 B . n B 2 9 T79 9 9 1 T79 LI1 B . n B 2 10 ASP 10 10 1 ASP LI1 B . n B 2 11 ILE 11 11 1 ILE LI1 B . n B 2 12 NAL 12 12 1 NAL LI1 B . n B 2 13 CYS 13 13 1 CYS LI1 B . n B 2 14 ASP 14 14 1 ASP LI1 B . n B 2 15 VAL 15 15 1 VAL LI1 B . n B 2 16 NAL 16 16 1 NAL LI1 B . n B 2 17 ARG 17 17 1 ARG LI1 B . n B 2 18 GLY 18 18 ? ? ? B . n B 2 19 NH2 19 19 ? ? ? B . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email clemens.scheufler@novartis.com _pdbx_contact_author.name_first Clemens _pdbx_contact_author.name_last Scheufler _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3693-3529 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GOL 1 501 501 GOL GOL A . D 3 GOL 1 502 502 GOL GOL A . E 4 MYR 1 503 344 MYR MYK A . F 5 HOH 1 601 26 HOH HOH A . F 5 HOH 2 602 57 HOH HOH A . F 5 HOH 3 603 39 HOH HOH A . F 5 HOH 4 604 33 HOH HOH A . F 5 HOH 5 605 51 HOH HOH A . F 5 HOH 6 606 25 HOH HOH A . F 5 HOH 7 607 27 HOH HOH A . F 5 HOH 8 608 28 HOH HOH A . F 5 HOH 9 609 48 HOH HOH A . F 5 HOH 10 610 30 HOH HOH A . F 5 HOH 11 611 43 HOH HOH A . F 5 HOH 12 612 18 HOH HOH A . F 5 HOH 13 613 20 HOH HOH A . F 5 HOH 14 614 35 HOH HOH A . F 5 HOH 15 615 4 HOH HOH A . F 5 HOH 16 616 17 HOH HOH A . F 5 HOH 17 617 11 HOH HOH A . F 5 HOH 18 618 50 HOH HOH A . F 5 HOH 19 619 14 HOH HOH A . F 5 HOH 20 620 31 HOH HOH A . F 5 HOH 21 621 3 HOH HOH A . F 5 HOH 22 622 46 HOH HOH A . F 5 HOH 23 623 36 HOH HOH A . F 5 HOH 24 624 19 HOH HOH A . F 5 HOH 25 625 37 HOH HOH A . F 5 HOH 26 626 49 HOH HOH A . F 5 HOH 27 627 23 HOH HOH A . F 5 HOH 28 628 32 HOH HOH A . F 5 HOH 29 629 42 HOH HOH A . F 5 HOH 30 630 12 HOH HOH A . F 5 HOH 31 631 29 HOH HOH A . F 5 HOH 32 632 2 HOH HOH A . F 5 HOH 33 633 7 HOH HOH A . F 5 HOH 34 634 5 HOH HOH A . F 5 HOH 35 635 15 HOH HOH A . F 5 HOH 36 636 6 HOH HOH A . F 5 HOH 37 637 40 HOH HOH A . F 5 HOH 38 638 44 HOH HOH A . F 5 HOH 39 639 13 HOH HOH A . F 5 HOH 40 640 54 HOH HOH A . F 5 HOH 41 641 52 HOH HOH A . F 5 HOH 42 642 41 HOH HOH A . F 5 HOH 43 643 21 HOH HOH A . F 5 HOH 44 644 34 HOH HOH A . F 5 HOH 45 645 24 HOH HOH A . F 5 HOH 46 646 55 HOH HOH A . F 5 HOH 47 647 1 HOH HOH A . F 5 HOH 48 648 45 HOH HOH A . F 5 HOH 49 649 9 HOH HOH A . F 5 HOH 50 650 10 HOH HOH A . F 5 HOH 51 651 38 HOH HOH A . F 5 HOH 52 652 56 HOH HOH A . F 5 HOH 53 653 8 HOH HOH A . F 5 HOH 54 654 53 HOH HOH A . F 5 HOH 55 655 22 HOH HOH A . F 5 HOH 56 656 16 HOH HOH A . G 5 HOH 1 101 47 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F,G 1 2 A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3690 ? 1 MORE 12 ? 1 'SSA (A^2)' 11300 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_554 x-y,-y,-z-1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -55.4763333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-03-15 2 'Structure model' 1 1 2023-03-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? ? -25.7875 11.172 -14.2607 0.008 ? 0.0268 ? 0.0108 ? -0.0648 ? 0.0006 ? -0.0832 ? 0.8026 ? 0.717 ? 0.8058 ? 1.3724 ? 0.961 ? 1.5819 ? -0.0938 ? -0.0872 ? -0.1775 ? -0.0872 ? 0.0876 ? -0.0114 ? -0.1775 ? -0.0114 ? 0.0061 ? 2 'X-RAY DIFFRACTION' ? ? -15.8664 29.9963 -15.7044 0.1391 ? -0.1409 ? 0.0281 ? -0.1989 ? 0.056 ? -0.1549 ? 13.5146 ? 2.3893 ? 4.1301 ? 1.2224 ? 4.4316 ? 15.4934 ? -0.4508 ? -0.4334 ? -0.6335 ? -0.4334 ? 0.1584 ? 0.077 ? -0.6335 ? 0.077 ? 0.2924 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 215 ? ? ? A 502 ? ? '{ A|* }' 2 'X-RAY DIFFRACTION' 2 ? ? B 1 ? ? ? B 19 ? ? '{ B|* }' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? '2.11.8 (8-JUN-2022)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? STARANISO ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 8C17 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 B _pdbx_validate_rmsd_angle.auth_comp_id_1 ASP _pdbx_validate_rmsd_angle.auth_seq_id_1 14 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 B _pdbx_validate_rmsd_angle.auth_comp_id_2 ASP _pdbx_validate_rmsd_angle.auth_seq_id_2 14 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 OD1 _pdbx_validate_rmsd_angle.auth_asym_id_3 B _pdbx_validate_rmsd_angle.auth_comp_id_3 ASP _pdbx_validate_rmsd_angle.auth_seq_id_3 14 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 112.88 _pdbx_validate_rmsd_angle.angle_target_value 118.30 _pdbx_validate_rmsd_angle.angle_deviation -5.42 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.90 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 277 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 64.38 _pdbx_validate_torsion.psi -164.88 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 235 ? CG ? A GLN 21 CG 2 1 Y 1 A GLN 235 ? CD ? A GLN 21 CD 3 1 Y 1 A GLN 235 ? OE1 ? A GLN 21 OE1 4 1 Y 1 A GLN 235 ? NE2 ? A GLN 21 NE2 5 1 Y 1 A GLN 237 ? CG ? A GLN 23 CG 6 1 Y 1 A GLN 237 ? CD ? A GLN 23 CD 7 1 Y 1 A GLN 237 ? OE1 ? A GLN 23 OE1 8 1 Y 1 A GLN 237 ? NE2 ? A GLN 23 NE2 9 1 Y 1 A GLN 252 ? CG ? A GLN 38 CG 10 1 Y 1 A GLN 252 ? CD ? A GLN 38 CD 11 1 Y 1 A GLN 252 ? OE1 ? A GLN 38 OE1 12 1 Y 1 A GLN 252 ? NE2 ? A GLN 38 NE2 13 1 Y 1 A SER 253 ? OG ? A SER 39 OG 14 1 Y 1 A LYS 277 ? CG ? A LYS 63 CG 15 1 Y 1 A LYS 277 ? CD ? A LYS 63 CD 16 1 Y 1 A LYS 277 ? CE ? A LYS 63 CE 17 1 Y 1 A LYS 277 ? NZ ? A LYS 63 NZ 18 1 Y 1 A LYS 278 ? CG ? A LYS 64 CG 19 1 Y 1 A LYS 278 ? CD ? A LYS 64 CD 20 1 Y 1 A LYS 278 ? CE ? A LYS 64 CE 21 1 Y 1 A LYS 278 ? NZ ? A LYS 64 NZ 22 1 Y 1 A LYS 282 ? CG ? A LYS 68 CG 23 1 Y 1 A LYS 282 ? CD ? A LYS 68 CD 24 1 Y 1 A LYS 282 ? CE ? A LYS 68 CE 25 1 Y 1 A LYS 282 ? NZ ? A LYS 68 NZ 26 1 Y 1 A ILE 306 ? CG1 ? A ILE 92 CG1 27 1 Y 1 A ILE 306 ? CG2 ? A ILE 92 CG2 28 1 Y 1 A ILE 306 ? CD1 ? A ILE 92 CD1 29 1 Y 1 A GLU 307 ? CG ? A GLU 93 CG 30 1 Y 1 A GLU 307 ? CD ? A GLU 93 CD 31 1 Y 1 A GLU 307 ? OE1 ? A GLU 93 OE1 32 1 Y 1 A GLU 307 ? OE2 ? A GLU 93 OE2 33 1 Y 1 A ASP 308 ? CG ? A ASP 94 CG 34 1 Y 1 A ASP 308 ? OD1 ? A ASP 94 OD1 35 1 Y 1 A ASP 308 ? OD2 ? A ASP 94 OD2 36 1 Y 1 A GLU 309 ? CG ? A GLU 95 CG 37 1 Y 1 A GLU 309 ? CD ? A GLU 95 CD 38 1 Y 1 A GLU 309 ? OE1 ? A GLU 95 OE1 39 1 Y 1 A GLU 309 ? OE2 ? A GLU 95 OE2 40 1 Y 1 A LYS 339 ? CG ? A LYS 125 CG 41 1 Y 1 A LYS 339 ? CD ? A LYS 125 CD 42 1 Y 1 A LYS 339 ? CE ? A LYS 125 CE 43 1 Y 1 A LYS 339 ? NZ ? A LYS 125 NZ 44 1 Y 1 A GLU 368 ? CG ? A GLU 154 CG 45 1 Y 1 A GLU 368 ? CD ? A GLU 154 CD 46 1 Y 1 A GLU 368 ? OE1 ? A GLU 154 OE1 47 1 Y 1 A GLU 368 ? OE2 ? A GLU 154 OE2 48 1 Y 1 A SER 420 ? OG ? A SER 206 OG 49 1 Y 1 A GLU 421 ? CG ? A GLU 207 CG 50 1 Y 1 A GLU 421 ? CD ? A GLU 207 CD 51 1 Y 1 A GLU 421 ? OE1 ? A GLU 207 OE1 52 1 Y 1 A GLU 421 ? OE2 ? A GLU 207 OE2 53 1 Y 1 A HIS 422 ? CG ? A HIS 208 CG 54 1 Y 1 A HIS 422 ? ND1 ? A HIS 208 ND1 55 1 Y 1 A HIS 422 ? CD2 ? A HIS 208 CD2 56 1 Y 1 A HIS 422 ? CE1 ? A HIS 208 CE1 57 1 Y 1 A HIS 422 ? NE2 ? A HIS 208 NE2 58 1 Y 1 B ARG 17 ? CG ? B ARG 17 CG 59 1 Y 1 B ARG 17 ? CD ? B ARG 17 CD 60 1 Y 1 B ARG 17 ? NE ? B ARG 17 NE 61 1 Y 1 B ARG 17 ? CZ ? B ARG 17 CZ 62 1 Y 1 B ARG 17 ? NH1 ? B ARG 17 NH1 63 1 Y 1 B ARG 17 ? NH2 ? B ARG 17 NH2 64 1 N 1 A GOL 501 ? C1 ? C GOL 1 C1 65 1 N 1 A GOL 501 ? C2 ? C GOL 1 C2 66 1 N 1 A GOL 501 ? O2 ? C GOL 1 O2 67 1 N 1 A GOL 501 ? C3 ? C GOL 1 C3 68 1 N 1 A GOL 501 ? O3 ? C GOL 1 O3 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B GLY 18 ? B GLY 18 2 1 Y 1 B NH2 19 ? B NH2 19 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 NAL ? ? NAL ? ? 'SUBJECT OF INVESTIGATION' ? 2 T79 ? ? T79 ? ? 'SUBJECT OF INVESTIGATION' ? 3 ACY ? ? ACY ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GLYCEROL GOL 4 'MYRISTIC ACID' MYR 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'surface plasmon resonance' _pdbx_struct_assembly_auth_evidence.details ? #