data_8F0V # _entry.id 8F0V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.377 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8F0V pdb_00008f0v 10.2210/pdb8f0v/pdb WWPDB D_1000269818 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'structure without mutation' _pdbx_database_related.db_id 7BKX _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8F0V _pdbx_database_status.recvd_initial_deposition_date 2022-11-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Subramanian, R.' 1 0000-0002-6709-190X 'KanagaVijayan, D.' 2 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary 'Plos One' ? ? 1932-6203 ? ? 18 ? e0280009 e0280009 ;Variability in phenylalanine side chain conformations facilitates broad substrate tolerance of fatty acid binding in cockroach milk proteins. ; 2023 ? 10.1371/journal.pone.0280009 37384723 ? ? ? ? ? ? ? ? ? ? ? ? 1 'Biochim Biophys Acta Gen Subj' ? ? 1872-8006 ? ? 1866 ? 130064 ? 'Structure of recombinantly expressed cockroach Lili-Mip protein in glycosylated and deglycosylated forms.' 2022 ? 10.1016/j.bbagen.2021.130064 ? ? ? ? ? ? ? ? ? ? UK ? ? 2 IUCrJ ? ? 2052-2525 ? ? 3 ? 282 293 ;Structure of a heterogeneous, glycosylated, lipid-bound, in vivo-grown protein crystal at atomic resolution from the viviparous cockroach Diploptera punctata. ; 2016 ? 10.1107/S2052252516008903 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Santhakumari, P.R.' 1 0000-0002-8061-1033 primary 'Dhanabalan, K.' 2 ? primary 'Virani, S.' 3 ? primary 'Hopf-Jannasch, A.S.' 4 ? primary 'Benoit, J.B.' 5 ? primary 'Chopra, G.' 6 ? primary 'Subramanian, R.' 7 0000-0002-6709-190X 1 'KanagaVijayan, D.' 8 ? 1 'Subramanian, R.' 9 ? 1 'Santhakumari, P.R.' 10 ? 1 'Chavas, L.M.G.' 11 ? 1 'Subramanian, R.' 12 ? 1 'Banerjee, S.' 13 ? 2 'Banerjee, S.' 14 ? 2 'Coussens, N.P.' 15 ? 2 'Gallat, F.X.' 16 ? 2 'Sathyanarayanan, N.' 17 ? 2 'Srikanth, J.' 18 ? 2 'Yagi, K.J.' 19 ? 2 'Gray, J.S.' 20 ? 2 'Tobe, S.S.' 21 ? 2 'Stay, B.' 22 ? 2 'Chavas, L.M.' 23 ? 2 'Ramaswamy, S.' 24 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8F0V _cell.details ? _cell.formula_units_Z ? _cell.length_a 39.771 _cell.length_a_esd ? _cell.length_b 52.337 _cell.length_b_esd ? _cell.length_c 136.348 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8F0V _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 2 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Milk protein' 17958.211 1 ? E38A ? ? 2 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 3 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? 4 water nat water 18.015 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KEPCPPENLQLTPRALVGKWYLRTTSPDIFKQVSNITAFYSAHGNDYYGTVTDYSPEYGLEAHRVNLTVSGRTLKFYMND THEYDSEYEILAVDKDYFIFYGHPPAAPSGLALIHYRQSCPKEDIIKRVKKSLKNVCLDYKYFGNDTSVHCRYLE ; _entity_poly.pdbx_seq_one_letter_code_can ;KEPCPPENLQLTPRALVGKWYLRTTSPDIFKQVSNITAFYSAHGNDYYGTVTDYSPEYGLEAHRVNLTVSGRTLKFYMND THEYDSEYEILAVDKDYFIFYGHPPAAPSGLALIHYRQSCPKEDIIKRVKKSLKNVCLDYKYFGNDTSVHCRYLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 GLU n 1 3 PRO n 1 4 CYS n 1 5 PRO n 1 6 PRO n 1 7 GLU n 1 8 ASN n 1 9 LEU n 1 10 GLN n 1 11 LEU n 1 12 THR n 1 13 PRO n 1 14 ARG n 1 15 ALA n 1 16 LEU n 1 17 VAL n 1 18 GLY n 1 19 LYS n 1 20 TRP n 1 21 TYR n 1 22 LEU n 1 23 ARG n 1 24 THR n 1 25 THR n 1 26 SER n 1 27 PRO n 1 28 ASP n 1 29 ILE n 1 30 PHE n 1 31 LYS n 1 32 GLN n 1 33 VAL n 1 34 SER n 1 35 ASN n 1 36 ILE n 1 37 THR n 1 38 ALA n 1 39 PHE n 1 40 TYR n 1 41 SER n 1 42 ALA n 1 43 HIS n 1 44 GLY n 1 45 ASN n 1 46 ASP n 1 47 TYR n 1 48 TYR n 1 49 GLY n 1 50 THR n 1 51 VAL n 1 52 THR n 1 53 ASP n 1 54 TYR n 1 55 SER n 1 56 PRO n 1 57 GLU n 1 58 TYR n 1 59 GLY n 1 60 LEU n 1 61 GLU n 1 62 ALA n 1 63 HIS n 1 64 ARG n 1 65 VAL n 1 66 ASN n 1 67 LEU n 1 68 THR n 1 69 VAL n 1 70 SER n 1 71 GLY n 1 72 ARG n 1 73 THR n 1 74 LEU n 1 75 LYS n 1 76 PHE n 1 77 TYR n 1 78 MET n 1 79 ASN n 1 80 ASP n 1 81 THR n 1 82 HIS n 1 83 GLU n 1 84 TYR n 1 85 ASP n 1 86 SER n 1 87 GLU n 1 88 TYR n 1 89 GLU n 1 90 ILE n 1 91 LEU n 1 92 ALA n 1 93 VAL n 1 94 ASP n 1 95 LYS n 1 96 ASP n 1 97 TYR n 1 98 PHE n 1 99 ILE n 1 100 PHE n 1 101 TYR n 1 102 GLY n 1 103 HIS n 1 104 PRO n 1 105 PRO n 1 106 ALA n 1 107 ALA n 1 108 PRO n 1 109 SER n 1 110 GLY n 1 111 LEU n 1 112 ALA n 1 113 LEU n 1 114 ILE n 1 115 HIS n 1 116 TYR n 1 117 ARG n 1 118 GLN n 1 119 SER n 1 120 CYS n 1 121 PRO n 1 122 LYS n 1 123 GLU n 1 124 ASP n 1 125 ILE n 1 126 ILE n 1 127 LYS n 1 128 ARG n 1 129 VAL n 1 130 LYS n 1 131 LYS n 1 132 SER n 1 133 LEU n 1 134 LYS n 1 135 ASN n 1 136 VAL n 1 137 CYS n 1 138 LEU n 1 139 ASP n 1 140 TYR n 1 141 LYS n 1 142 TYR n 1 143 PHE n 1 144 GLY n 1 145 ASN n 1 146 ASP n 1 147 THR n 1 148 SER n 1 149 VAL n 1 150 HIS n 1 151 CYS n 1 152 ARG n 1 153 TYR n 1 154 LEU n 1 155 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 155 _entity_src_gen.gene_src_common_name 'Pacific beetle cockroach' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Diploptera punctata' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6984 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4932 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6SVB5_DIPPU _struct_ref.pdbx_db_accession Q6SVB5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KEPCPPENLQLTPRALVGKWYLRTTSPDIFKQVSNITEFYSAHGNDYYGTVTDYSPEYGLEAHRVNLTVSGRTLKFYMND THEYDSEYEILAVDKDYFIFYGHPPAAPSGLALIHYRQSCPKEDIIKRVKKSLKNVCLDYKYFGNDTSVHCRYLE ; _struct_ref.pdbx_align_begin 10 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8F0V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 155 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6SVB5 _struct_ref_seq.db_align_beg 10 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 164 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 155 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8F0V _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 38 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q6SVB5 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 47 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 38 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8F0V _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.95 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 69 _exptl_crystal.description 'diamond shaped crystals' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0 (0.002 M Zinc sulfate heptahydrate; 0.08 M HEPES pH 7.0; 25 % v/v Jeffamine' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'double crystal' _diffrn_detector.detector CMOS _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RDI CMOS_8M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-05-07 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Rosenbaum-Rock monochromator' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.07 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 4.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.07 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 4.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 76 _reflns.entry_id 8F0V _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.95 _reflns.d_resolution_low 38.18 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6461 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.6 _reflns.pdbx_Rmerge_I_obs 0.129 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.054 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.95 _reflns_shell.d_res_low 3.13 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1021 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.0 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.83 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.58 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 6.649 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 0.700 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -7.349 _refine.B_iso_max ? _refine.B_iso_mean 98.323 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.934 _refine.correlation_coeff_Fo_to_Fc_free 0.907 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8F0V _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.951 _refine.ls_d_res_low 38.18 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6430 _refine.ls_number_reflns_R_free 323 _refine.ls_number_reflns_R_work 6107 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.798 _refine.ls_percent_reflns_R_free 5.023 _refine.ls_R_factor_all 0.237 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2936 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2345 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7BKX _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.806 _refine.pdbx_overall_ESU_R_Free 0.404 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 22.750 _refine.overall_SU_ML 0.376 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1235 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 45 _refine_hist.number_atoms_solvent 2 _refine_hist.number_atoms_total 1282 _refine_hist.d_res_high 2.951 _refine_hist.d_res_low 38.18 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.012 1329 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.004 0.016 1107 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.361 1.688 1816 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.432 1.566 2584 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.458 5.000 154 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 16.293 5.000 5 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.414 10.000 180 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 13.730 10.000 62 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.054 0.200 201 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 1493 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 270 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.215 0.200 290 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.207 0.200 1169 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.190 0.200 639 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.083 0.200 692 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.173 0.200 38 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.200 1 ? r_symmetry_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.122 0.200 20 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.093 0.200 8 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.033 0.200 2 ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? 7.836 10.196 619 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 7.835 10.197 619 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 12.306 15.255 772 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 12.298 15.254 773 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 7.747 11.045 710 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 7.742 11.051 711 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 11.967 16.321 1044 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 11.962 16.325 1045 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 17.344 129.267 1460 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 17.345 129.303 1461 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.951 3.027 . . 25 444 99.7872 . . . 0.418 . 0.402 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.027 3.109 . . 21 430 100.0000 . . . 0.531 . 0.392 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.109 3.199 . . 17 409 100.0000 . . . 0.251 . 0.379 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.199 3.296 . . 30 413 100.0000 . . . 0.433 . 0.331 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.296 3.404 . . 19 372 100.0000 . . . 0.289 . 0.316 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.404 3.522 . . 17 394 100.0000 . . . 0.338 . 0.271 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.522 3.654 . . 23 367 100.0000 . . . 0.205 . 0.242 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.654 3.802 . . 27 334 100.0000 . . . 0.247 . 0.243 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.802 3.969 . . 20 354 100.0000 . . . 0.311 . 0.209 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.969 4.160 . . 13 323 99.7033 . . . 0.473 . 0.183 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.160 4.383 . . 15 329 100.0000 . . . 0.275 . 0.201 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.383 4.645 . . 12 292 100.0000 . . . 0.285 . 0.191 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.645 4.960 . . 17 283 100.0000 . . . 0.201 . 0.162 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.960 5.350 . . 13 263 100.0000 . . . 0.254 . 0.163 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.350 5.849 . . 10 258 100.0000 . . . 0.297 . 0.211 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.849 6.520 . . 14 226 100.0000 . . . 0.202 . 0.234 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.520 7.493 . . 11 195 99.5169 . . . 0.289 . 0.251 . . . . . . . . . . . 'X-RAY DIFFRACTION' 7.493 9.090 . . 8 176 100.0000 . . . 0.366 . 0.200 . . . . . . . . . . . 'X-RAY DIFFRACTION' 9.090 12.506 . . 7 148 99.3590 . . . 0.280 . 0.221 . . . . . . . . . . . 'X-RAY DIFFRACTION' 12.506 38.18 . . 4 97 95.2830 . . . 0.333 . 0.310 . . . . . . . . . . . # _struct.entry_id 8F0V _struct.title 'Lipocalin-like Milk protein-2 - E38A mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8F0V _struct_keywords.text 'Lipocalin, Mutation, cockroach milk, Lili Mip., LIPID BINDING PROTEIN' _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 122 ? ASN A 135 ? LYS A 122 ASN A 135 1 ? 14 HELX_P HELX_P2 AA2 CYS A 151 ? GLU A 155 ? CYS A 151 GLU A 155 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 137 SG ? ? A CYS 4 A CYS 137 1_555 ? ? ? ? ? ? ? 2.049 ? ? disulf2 disulf ? ? A CYS 120 SG ? ? ? 1_555 A CYS 151 SG ? ? A CYS 120 A CYS 151 1_555 ? ? ? ? ? ? ? 2.081 ? ? covale1 covale one ? A ASN 35 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 35 A NAG 202 1_555 ? ? ? ? ? ? ? 1.460 ? N-Glycosylation covale2 covale one ? A ASN 66 ND2 ? ? ? 1_555 D NAG . C1 ? ? A ASN 66 A NAG 203 1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation covale3 covale one ? A ASN 145 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 145 A NAG 201 1_555 ? ? ? ? ? ? ? 1.466 ? N-Glycosylation metalc1 metalc ? ? A GLU 2 OE1 ? ? ? 1_555 F ZN . ZN ? ? A GLU 2 A ZN 205 1_555 ? ? ? ? ? ? ? 2.034 ? ? metalc2 metalc ? ? A GLU 2 OE2 ? ? ? 1_555 F ZN . ZN ? ? A GLU 2 A ZN 205 1_555 ? ? ? ? ? ? ? 2.026 ? ? metalc3 metalc ? ? A HIS 43 ND1 ? ? ? 1_555 F ZN . ZN ? ? A HIS 43 A ZN 205 3_645 ? ? ? ? ? ? ? 2.119 ? ? metalc4 metalc ? ? A ASP 53 OD1 ? ? ? 1_555 E ZN . ZN ? ? A ASP 53 A ZN 204 1_555 ? ? ? ? ? ? ? 2.506 ? ? metalc5 metalc ? ? A ASP 53 OD2 ? ? ? 1_555 E ZN . ZN ? ? A ASP 53 A ZN 204 1_555 ? ? ? ? ? ? ? 2.007 ? ? metalc6 metalc ? ? A GLU 61 OE2 ? ? ? 1_555 E ZN . ZN ? ? A GLU 61 A ZN 204 1_555 ? ? ? ? ? ? ? 2.024 ? ? metalc7 metalc ? ? A HIS 63 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 63 A ZN 204 1_555 ? ? ? ? ? ? ? 2.319 ? ? metalc8 metalc ? ? A HIS 103 NE2 ? ? ? 1_555 F ZN . ZN ? ? A HIS 103 A ZN 205 1_555 ? ? ? ? ? ? ? 1.903 ? ? metalc9 metalc ? ? A HIS 150 NE2 ? ? ? 1_555 G ZN . ZN ? ? A HIS 150 A ZN 206 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc10 metalc ? ? A HIS 150 NE2 ? ? ? 1_555 G ZN . ZN ? ? A HIS 150 A ZN 206 2_555 ? ? ? ? ? ? ? 2.027 ? ? metalc11 metalc ? ? A GLU 155 OE2 ? ? ? 1_555 G ZN . ZN ? ? A GLU 155 A ZN 206 1_555 ? ? ? ? ? ? ? 2.098 ? ? metalc12 metalc ? ? A GLU 155 OE2 ? ? ? 1_555 G ZN . ZN ? ? A GLU 155 A ZN 206 2_555 ? ? ? ? ? ? ? 2.111 ? ? metalc13 metalc ? ? E ZN . ZN ? ? ? 1_555 H HOH . O ? ? A ZN 204 A HOH 302 1_555 ? ? ? ? ? ? ? 2.343 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 26 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 26 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 27 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 27 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.83 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 9 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA2 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 60 ? GLU A 61 ? LEU A 60 GLU A 61 AA1 2 TYR A 47 ? TYR A 54 ? TYR A 47 TYR A 54 AA1 3 SER A 34 ? SER A 41 ? SER A 34 SER A 41 AA1 4 GLY A 18 ? SER A 26 ? GLY A 18 SER A 26 AA1 5 GLY A 144 ? ASN A 145 ? GLY A 144 ASN A 145 AA2 1 LEU A 60 ? GLU A 61 ? LEU A 60 GLU A 61 AA2 2 TYR A 47 ? TYR A 54 ? TYR A 47 TYR A 54 AA2 3 ARG A 64 ? SER A 70 ? ARG A 64 SER A 70 AA2 4 THR A 73 ? ASN A 79 ? THR A 73 ASN A 79 AA2 5 SER A 86 ? VAL A 93 ? SER A 86 VAL A 93 AA2 6 TYR A 97 ? GLY A 102 ? TYR A 97 GLY A 102 AA2 7 LEU A 111 ? TYR A 116 ? LEU A 111 TYR A 116 AA2 8 GLY A 18 ? SER A 26 ? GLY A 18 SER A 26 AA2 9 GLY A 144 ? ASN A 145 ? GLY A 144 ASN A 145 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 61 ? O GLU A 61 N ASP A 53 ? N ASP A 53 AA1 2 3 O TYR A 48 ? O TYR A 48 N SER A 41 ? N SER A 41 AA1 3 4 O TYR A 40 ? O TYR A 40 N GLY A 18 ? N GLY A 18 AA1 4 5 N THR A 25 ? N THR A 25 O GLY A 144 ? O GLY A 144 AA2 1 2 O GLU A 61 ? O GLU A 61 N ASP A 53 ? N ASP A 53 AA2 2 3 N TYR A 47 ? N TYR A 47 O LEU A 67 ? O LEU A 67 AA2 3 4 N ASN A 66 ? N ASN A 66 O TYR A 77 ? O TYR A 77 AA2 4 5 N LEU A 74 ? N LEU A 74 O TYR A 88 ? O TYR A 88 AA2 5 6 N GLU A 89 ? N GLU A 89 O TYR A 101 ? O TYR A 101 AA2 6 7 N GLY A 102 ? N GLY A 102 O LEU A 111 ? O LEU A 111 AA2 7 8 O TYR A 116 ? O TYR A 116 N TYR A 21 ? N TYR A 21 AA2 8 9 N THR A 25 ? N THR A 25 O GLY A 144 ? O GLY A 144 # _atom_sites.entry_id 8F0V _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.025144 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019107 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007334 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.076 ZN 30 30 14.081 3.266 7.035 0.233 5.168 10.316 2.411 58.710 0.562 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 HIS 103 103 103 HIS HIS A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 CYS 120 120 120 CYS CYS A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 CYS 137 137 137 CYS CYS A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 TYR 142 142 142 TYR TYR A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 HIS 150 150 150 HIS HIS A . n A 1 151 CYS 151 151 151 CYS CYS A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 TYR 153 153 153 TYR TYR A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 GLU 155 155 155 GLU GLU A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email subram68@purdue.edu _pdbx_contact_author.name_first Ramaswamy _pdbx_contact_author.name_last Subramanian _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6709-190X # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 201 201 NAG NAG A . C 2 NAG 1 202 202 NAG NAG A . D 2 NAG 1 203 203 NAG NAG A . E 3 ZN 1 204 204 ZN ZN A . F 3 ZN 1 205 205 ZN ZN A . G 3 ZN 1 206 206 ZN ZN A . H 4 HOH 1 301 302 HOH HOH A . H 4 HOH 2 302 301 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id ZN _pdbx_struct_special_symmetry.auth_seq_id 206 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id G _pdbx_struct_special_symmetry.label_comp_id ZN _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 2 ? A GLU 2 ? 1_555 ZN ? F ZN . ? A ZN 205 ? 1_555 OE2 ? A GLU 2 ? A GLU 2 ? 1_555 66.2 ? 2 OE1 ? A GLU 2 ? A GLU 2 ? 1_555 ZN ? F ZN . ? A ZN 205 ? 1_555 ND1 ? A HIS 43 ? A HIS 43 ? 1_555 101.9 ? 3 OE2 ? A GLU 2 ? A GLU 2 ? 1_555 ZN ? F ZN . ? A ZN 205 ? 1_555 ND1 ? A HIS 43 ? A HIS 43 ? 1_555 166.7 ? 4 OE1 ? A GLU 2 ? A GLU 2 ? 1_555 ZN ? F ZN . ? A ZN 205 ? 1_555 NE2 ? A HIS 103 ? A HIS 103 ? 1_555 137.6 ? 5 OE2 ? A GLU 2 ? A GLU 2 ? 1_555 ZN ? F ZN . ? A ZN 205 ? 1_555 NE2 ? A HIS 103 ? A HIS 103 ? 1_555 101.2 ? 6 ND1 ? A HIS 43 ? A HIS 43 ? 1_555 ZN ? F ZN . ? A ZN 205 ? 1_555 NE2 ? A HIS 103 ? A HIS 103 ? 1_555 83.6 ? 7 OD1 ? A ASP 53 ? A ASP 53 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 OD2 ? A ASP 53 ? A ASP 53 ? 1_555 57.1 ? 8 OD1 ? A ASP 53 ? A ASP 53 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 OE2 ? A GLU 61 ? A GLU 61 ? 1_555 90.5 ? 9 OD2 ? A ASP 53 ? A ASP 53 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 OE2 ? A GLU 61 ? A GLU 61 ? 1_555 110.1 ? 10 OD1 ? A ASP 53 ? A ASP 53 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 73.3 ? 11 OD2 ? A ASP 53 ? A ASP 53 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 130.2 ? 12 OE2 ? A GLU 61 ? A GLU 61 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 72.4 ? 13 OD1 ? A ASP 53 ? A ASP 53 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 O ? H HOH . ? A HOH 302 ? 1_555 156.2 ? 14 OD2 ? A ASP 53 ? A ASP 53 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 O ? H HOH . ? A HOH 302 ? 1_555 113.9 ? 15 OE2 ? A GLU 61 ? A GLU 61 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 O ? H HOH . ? A HOH 302 ? 1_555 113.1 ? 16 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 O ? H HOH . ? A HOH 302 ? 1_555 109.4 ? 17 NE2 ? A HIS 150 ? A HIS 150 ? 1_555 ZN ? G ZN . ? A ZN 206 ? 1_555 NE2 ? A HIS 150 ? A HIS 150 ? 1_555 0.0 ? 18 NE2 ? A HIS 150 ? A HIS 150 ? 1_555 ZN ? G ZN . ? A ZN 206 ? 1_555 OE2 ? A GLU 155 ? A GLU 155 ? 1_555 121.4 ? 19 NE2 ? A HIS 150 ? A HIS 150 ? 1_555 ZN ? G ZN . ? A ZN 206 ? 1_555 OE2 ? A GLU 155 ? A GLU 155 ? 1_555 121.4 ? 20 NE2 ? A HIS 150 ? A HIS 150 ? 1_555 ZN ? G ZN . ? A ZN 206 ? 1_555 OE2 ? A GLU 155 ? A GLU 155 ? 1_555 121.4 ? 21 NE2 ? A HIS 150 ? A HIS 150 ? 1_555 ZN ? G ZN . ? A ZN 206 ? 1_555 OE2 ? A GLU 155 ? A GLU 155 ? 1_555 121.4 ? 22 OE2 ? A GLU 155 ? A GLU 155 ? 1_555 ZN ? G ZN . ? A ZN 206 ? 1_555 OE2 ? A GLU 155 ? A GLU 155 ? 1_555 0.0 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-08-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0352 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 8F0V _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 HH22 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 23 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HG _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 119 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.29 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 2 ? ? -170.21 137.72 2 1 PRO A 5 ? ? -56.38 176.23 3 1 ASN A 8 ? ? -137.39 -71.40 4 1 LEU A 9 ? ? 71.81 -51.66 5 1 GLN A 10 ? ? 69.29 -112.21 6 1 LEU A 11 ? ? -172.28 -154.90 7 1 ASP A 53 ? ? -169.46 115.09 8 1 LEU A 60 ? ? -63.71 96.80 9 1 SER A 70 ? ? -168.24 83.97 10 1 ASP A 80 ? ? 176.99 -72.82 11 1 SER A 86 ? ? 179.90 163.71 12 1 PRO A 105 ? ? -29.08 -50.98 13 1 CYS A 137 ? ? 77.78 37.60 14 1 TYR A 140 ? ? -46.68 -15.86 15 1 LEU A 154 ? ? -102.57 44.61 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 117 ? ? 0.149 'SIDE CHAIN' 2 1 ARG A 128 ? ? 0.083 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 1 ? CG ? A LYS 1 CG 2 1 Y 1 A LYS 1 ? CD ? A LYS 1 CD 3 1 Y 1 A LYS 1 ? CE ? A LYS 1 CE 4 1 Y 1 A LYS 1 ? NZ ? A LYS 1 NZ 5 1 Y 1 A ARG 64 ? CG ? A ARG 64 CG 6 1 Y 1 A ARG 64 ? CD ? A ARG 64 CD 7 1 Y 1 A ARG 64 ? NE ? A ARG 64 NE 8 1 Y 1 A ARG 64 ? CZ ? A ARG 64 CZ 9 1 Y 1 A ARG 64 ? NH1 ? A ARG 64 NH1 10 1 Y 1 A ARG 64 ? NH2 ? A ARG 64 NH2 11 1 Y 1 A ARG 72 ? CG ? A ARG 72 CG 12 1 Y 1 A ARG 72 ? CD ? A ARG 72 CD 13 1 Y 1 A ARG 72 ? NE ? A ARG 72 NE 14 1 Y 1 A ARG 72 ? CZ ? A ARG 72 CZ 15 1 Y 1 A ARG 72 ? NH1 ? A ARG 72 NH1 16 1 Y 1 A ARG 72 ? NH2 ? A ARG 72 NH2 17 1 Y 1 A LYS 95 ? CD ? A LYS 95 CD 18 1 Y 1 A LYS 95 ? CE ? A LYS 95 CE 19 1 Y 1 A LYS 95 ? NZ ? A LYS 95 NZ 20 1 Y 1 A LYS 127 ? CE ? A LYS 127 CE 21 1 Y 1 A LYS 127 ? NZ ? A LYS 127 NZ 22 1 Y 1 A LYS 130 ? CG ? A LYS 130 CG 23 1 Y 1 A LYS 130 ? CD ? A LYS 130 CD 24 1 Y 1 A LYS 130 ? CE ? A LYS 130 CE 25 1 Y 1 A LYS 130 ? NZ ? A LYS 130 NZ 26 1 Y 1 A LYS 131 ? CD ? A LYS 131 CD 27 1 Y 1 A LYS 131 ? CE ? A LYS 131 CE 28 1 Y 1 A LYS 131 ? NZ ? A LYS 131 NZ 29 1 Y 1 A LYS 141 ? CG ? A LYS 141 CG 30 1 Y 1 A LYS 141 ? CD ? A LYS 141 CD 31 1 Y 1 A LYS 141 ? CE ? A LYS 141 CE 32 1 Y 1 A LYS 141 ? NZ ? A LYS 141 NZ # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 NAG C1 C N R 250 NAG C2 C N R 251 NAG C3 C N R 252 NAG C4 C N S 253 NAG C5 C N R 254 NAG C6 C N N 255 NAG C7 C N N 256 NAG C8 C N N 257 NAG N2 N N N 258 NAG O1 O N N 259 NAG O3 O N N 260 NAG O4 O N N 261 NAG O5 O N N 262 NAG O6 O N N 263 NAG O7 O N N 264 NAG H1 H N N 265 NAG H2 H N N 266 NAG H3 H N N 267 NAG H4 H N N 268 NAG H5 H N N 269 NAG H61 H N N 270 NAG H62 H N N 271 NAG H81 H N N 272 NAG H82 H N N 273 NAG H83 H N N 274 NAG HN2 H N N 275 NAG HO1 H N N 276 NAG HO3 H N N 277 NAG HO4 H N N 278 NAG HO6 H N N 279 PHE N N N N 280 PHE CA C N S 281 PHE C C N N 282 PHE O O N N 283 PHE CB C N N 284 PHE CG C Y N 285 PHE CD1 C Y N 286 PHE CD2 C Y N 287 PHE CE1 C Y N 288 PHE CE2 C Y N 289 PHE CZ C Y N 290 PHE OXT O N N 291 PHE H H N N 292 PHE H2 H N N 293 PHE HA H N N 294 PHE HB2 H N N 295 PHE HB3 H N N 296 PHE HD1 H N N 297 PHE HD2 H N N 298 PHE HE1 H N N 299 PHE HE2 H N N 300 PHE HZ H N N 301 PHE HXT H N N 302 PRO N N N N 303 PRO CA C N S 304 PRO C C N N 305 PRO O O N N 306 PRO CB C N N 307 PRO CG C N N 308 PRO CD C N N 309 PRO OXT O N N 310 PRO H H N N 311 PRO HA H N N 312 PRO HB2 H N N 313 PRO HB3 H N N 314 PRO HG2 H N N 315 PRO HG3 H N N 316 PRO HD2 H N N 317 PRO HD3 H N N 318 PRO HXT H N N 319 SER N N N N 320 SER CA C N S 321 SER C C N N 322 SER O O N N 323 SER CB C N N 324 SER OG O N N 325 SER OXT O N N 326 SER H H N N 327 SER H2 H N N 328 SER HA H N N 329 SER HB2 H N N 330 SER HB3 H N N 331 SER HG H N N 332 SER HXT H N N 333 THR N N N N 334 THR CA C N S 335 THR C C N N 336 THR O O N N 337 THR CB C N R 338 THR OG1 O N N 339 THR CG2 C N N 340 THR OXT O N N 341 THR H H N N 342 THR H2 H N N 343 THR HA H N N 344 THR HB H N N 345 THR HG1 H N N 346 THR HG21 H N N 347 THR HG22 H N N 348 THR HG23 H N N 349 THR HXT H N N 350 TRP N N N N 351 TRP CA C N S 352 TRP C C N N 353 TRP O O N N 354 TRP CB C N N 355 TRP CG C Y N 356 TRP CD1 C Y N 357 TRP CD2 C Y N 358 TRP NE1 N Y N 359 TRP CE2 C Y N 360 TRP CE3 C Y N 361 TRP CZ2 C Y N 362 TRP CZ3 C Y N 363 TRP CH2 C Y N 364 TRP OXT O N N 365 TRP H H N N 366 TRP H2 H N N 367 TRP HA H N N 368 TRP HB2 H N N 369 TRP HB3 H N N 370 TRP HD1 H N N 371 TRP HE1 H N N 372 TRP HE3 H N N 373 TRP HZ2 H N N 374 TRP HZ3 H N N 375 TRP HH2 H N N 376 TRP HXT H N N 377 TYR N N N N 378 TYR CA C N S 379 TYR C C N N 380 TYR O O N N 381 TYR CB C N N 382 TYR CG C Y N 383 TYR CD1 C Y N 384 TYR CD2 C Y N 385 TYR CE1 C Y N 386 TYR CE2 C Y N 387 TYR CZ C Y N 388 TYR OH O N N 389 TYR OXT O N N 390 TYR H H N N 391 TYR H2 H N N 392 TYR HA H N N 393 TYR HB2 H N N 394 TYR HB3 H N N 395 TYR HD1 H N N 396 TYR HD2 H N N 397 TYR HE1 H N N 398 TYR HE2 H N N 399 TYR HH H N N 400 TYR HXT H N N 401 VAL N N N N 402 VAL CA C N S 403 VAL C C N N 404 VAL O O N N 405 VAL CB C N N 406 VAL CG1 C N N 407 VAL CG2 C N N 408 VAL OXT O N N 409 VAL H H N N 410 VAL H2 H N N 411 VAL HA H N N 412 VAL HB H N N 413 VAL HG11 H N N 414 VAL HG12 H N N 415 VAL HG13 H N N 416 VAL HG21 H N N 417 VAL HG22 H N N 418 VAL HG23 H N N 419 VAL HXT H N N 420 ZN ZN ZN N N 421 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 NAG C1 C2 sing N N 237 NAG C1 O1 sing N N 238 NAG C1 O5 sing N N 239 NAG C1 H1 sing N N 240 NAG C2 C3 sing N N 241 NAG C2 N2 sing N N 242 NAG C2 H2 sing N N 243 NAG C3 C4 sing N N 244 NAG C3 O3 sing N N 245 NAG C3 H3 sing N N 246 NAG C4 C5 sing N N 247 NAG C4 O4 sing N N 248 NAG C4 H4 sing N N 249 NAG C5 C6 sing N N 250 NAG C5 O5 sing N N 251 NAG C5 H5 sing N N 252 NAG C6 O6 sing N N 253 NAG C6 H61 sing N N 254 NAG C6 H62 sing N N 255 NAG C7 C8 sing N N 256 NAG C7 N2 sing N N 257 NAG C7 O7 doub N N 258 NAG C8 H81 sing N N 259 NAG C8 H82 sing N N 260 NAG C8 H83 sing N N 261 NAG N2 HN2 sing N N 262 NAG O1 HO1 sing N N 263 NAG O3 HO3 sing N N 264 NAG O4 HO4 sing N N 265 NAG O6 HO6 sing N N 266 PHE N CA sing N N 267 PHE N H sing N N 268 PHE N H2 sing N N 269 PHE CA C sing N N 270 PHE CA CB sing N N 271 PHE CA HA sing N N 272 PHE C O doub N N 273 PHE C OXT sing N N 274 PHE CB CG sing N N 275 PHE CB HB2 sing N N 276 PHE CB HB3 sing N N 277 PHE CG CD1 doub Y N 278 PHE CG CD2 sing Y N 279 PHE CD1 CE1 sing Y N 280 PHE CD1 HD1 sing N N 281 PHE CD2 CE2 doub Y N 282 PHE CD2 HD2 sing N N 283 PHE CE1 CZ doub Y N 284 PHE CE1 HE1 sing N N 285 PHE CE2 CZ sing Y N 286 PHE CE2 HE2 sing N N 287 PHE CZ HZ sing N N 288 PHE OXT HXT sing N N 289 PRO N CA sing N N 290 PRO N CD sing N N 291 PRO N H sing N N 292 PRO CA C sing N N 293 PRO CA CB sing N N 294 PRO CA HA sing N N 295 PRO C O doub N N 296 PRO C OXT sing N N 297 PRO CB CG sing N N 298 PRO CB HB2 sing N N 299 PRO CB HB3 sing N N 300 PRO CG CD sing N N 301 PRO CG HG2 sing N N 302 PRO CG HG3 sing N N 303 PRO CD HD2 sing N N 304 PRO CD HD3 sing N N 305 PRO OXT HXT sing N N 306 SER N CA sing N N 307 SER N H sing N N 308 SER N H2 sing N N 309 SER CA C sing N N 310 SER CA CB sing N N 311 SER CA HA sing N N 312 SER C O doub N N 313 SER C OXT sing N N 314 SER CB OG sing N N 315 SER CB HB2 sing N N 316 SER CB HB3 sing N N 317 SER OG HG sing N N 318 SER OXT HXT sing N N 319 THR N CA sing N N 320 THR N H sing N N 321 THR N H2 sing N N 322 THR CA C sing N N 323 THR CA CB sing N N 324 THR CA HA sing N N 325 THR C O doub N N 326 THR C OXT sing N N 327 THR CB OG1 sing N N 328 THR CB CG2 sing N N 329 THR CB HB sing N N 330 THR OG1 HG1 sing N N 331 THR CG2 HG21 sing N N 332 THR CG2 HG22 sing N N 333 THR CG2 HG23 sing N N 334 THR OXT HXT sing N N 335 TRP N CA sing N N 336 TRP N H sing N N 337 TRP N H2 sing N N 338 TRP CA C sing N N 339 TRP CA CB sing N N 340 TRP CA HA sing N N 341 TRP C O doub N N 342 TRP C OXT sing N N 343 TRP CB CG sing N N 344 TRP CB HB2 sing N N 345 TRP CB HB3 sing N N 346 TRP CG CD1 doub Y N 347 TRP CG CD2 sing Y N 348 TRP CD1 NE1 sing Y N 349 TRP CD1 HD1 sing N N 350 TRP CD2 CE2 doub Y N 351 TRP CD2 CE3 sing Y N 352 TRP NE1 CE2 sing Y N 353 TRP NE1 HE1 sing N N 354 TRP CE2 CZ2 sing Y N 355 TRP CE3 CZ3 doub Y N 356 TRP CE3 HE3 sing N N 357 TRP CZ2 CH2 doub Y N 358 TRP CZ2 HZ2 sing N N 359 TRP CZ3 CH2 sing Y N 360 TRP CZ3 HZ3 sing N N 361 TRP CH2 HH2 sing N N 362 TRP OXT HXT sing N N 363 TYR N CA sing N N 364 TYR N H sing N N 365 TYR N H2 sing N N 366 TYR CA C sing N N 367 TYR CA CB sing N N 368 TYR CA HA sing N N 369 TYR C O doub N N 370 TYR C OXT sing N N 371 TYR CB CG sing N N 372 TYR CB HB2 sing N N 373 TYR CB HB3 sing N N 374 TYR CG CD1 doub Y N 375 TYR CG CD2 sing Y N 376 TYR CD1 CE1 sing Y N 377 TYR CD1 HD1 sing N N 378 TYR CD2 CE2 doub Y N 379 TYR CD2 HD2 sing N N 380 TYR CE1 CZ doub Y N 381 TYR CE1 HE1 sing N N 382 TYR CE2 CZ sing Y N 383 TYR CE2 HE2 sing N N 384 TYR CZ OH sing N N 385 TYR OH HH sing N N 386 TYR OXT HXT sing N N 387 VAL N CA sing N N 388 VAL N H sing N N 389 VAL N H2 sing N N 390 VAL CA C sing N N 391 VAL CA CB sing N N 392 VAL CA HA sing N N 393 VAL C O doub N N 394 VAL C OXT sing N N 395 VAL CB CG1 sing N N 396 VAL CB CG2 sing N N 397 VAL CB HB sing N N 398 VAL CG1 HG11 sing N N 399 VAL CG1 HG12 sing N N 400 VAL CG1 HG13 sing N N 401 VAL CG2 HG21 sing N N 402 VAL CG2 HG22 sing N N 403 VAL CG2 HG23 sing N N 404 VAL OXT HXT sing N N 405 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 3 'ZINC ION' ZN 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #