data_9GIT # _entry.id 9GIT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.400 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9GIT pdb_00009git 10.2210/pdb9git/pdb WWPDB D_1292140672 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-12-18 2 'Structure model' 1 1 2025-01-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9GIT _pdbx_database_status.recvd_initial_deposition_date 2024-08-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email matthew.cottee@astrazeneca.com _pdbx_contact_author.name_first Matthew _pdbx_contact_author.name_last Cottee _pdbx_contact_author.name_mi A _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3619-3057 # _audit_author.name 'Cottee, M.A.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-3619-3057 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 67 _citation.language ? _citation.page_first 22055 _citation.page_last 22079 _citation.title 'Structure-Based Discovery of a Series of Covalent, Orally Bioavailable, and Selective BFL1 Inhibitors.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.4c01995 _citation.pdbx_database_id_PubMed 39641779 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Palisse, A.' 1 ? primary 'Cheung, T.' 2 ? primary 'Blokhuis, A.' 3 ? primary 'Cogswell, T.' 4 ? primary 'Martins, B.S.' 5 ? primary 'Riemens, R.' 6 ? primary 'Schellekens, R.' 7 ? primary 'Battocchio, G.' 8 ? primary 'Jansen, C.' 9 ? primary 'Cottee, M.A.' 10 ? primary 'Ornell, K.' 11 ? primary 'Sacchetto, C.' 12 ? primary 'Leon, L.' 13 ? primary 'van Hoek-Emmelot, M.' 14 ? primary 'Bostock, M.' 15 ? primary 'Brauer, B.L.' 16 ? primary 'Beaumont, K.' 17 ? primary 'Lucas, S.C.C.' 18 ? primary 'Ahmed, S.' 19 ? primary 'Blackwell, J.H.' 20 ? primary 'Borjesson, U.' 21 ? primary 'Gohlke, A.' 22 ? primary 'Gramatikov, I.M.T.' 23 ? primary 'Hargreaves, D.' 24 ? primary 'van Hoeven, V.' 25 ? primary 'Kantae, V.' 26 ? primary 'Kupcova, L.' 27 ? primary 'Milbradt, A.G.' 28 ? primary 'Seneviratne, U.' 29 ? primary 'Su, N.' 30 ? primary 'Vales, J.' 31 ? primary 'Wang, H.' 32 ? primary 'White, M.J.' 33 ? primary 'Kinzel, O.' 34 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bcl-2-related protein A1' 17442.889 1 ? ? ? ? 2 non-polymer syn ;(3~{S})-3-[[4-[(1~{R},3~{R})-3-[[(3~{R})-1,1-bis(oxidanylidene)thiolan-3-yl]carbamoylamino]cyclopentyl]oxy-3-fluoranyl-phenyl]-propanoyl-amino]-3-(4-chlorophenyl)propanamide ; 609.109 1 ? ? ? ? 3 water nat water 18.015 95 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Bcl-2-like protein 5,Bcl2-L-5,Hemopoietic-specific early response protein,Protein BFL-1,Protein GRS' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEF EDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK ; _entity_poly.pdbx_seq_one_letter_code_can ;GMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEF EDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(3~{S})-3-[[4-[(1~{R},3~{R})-3-[[(3~{R})-1,1-bis(oxidanylidene)thiolan-3-yl]carbamoylamino]cyclopentyl]oxy-3-fluoranyl-phenyl]-propanoyl-amino]-3-(4-chlorophenyl)propanamide ; A1ILW 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 THR n 1 4 ASP n 1 5 CYS n 1 6 GLU n 1 7 PHE n 1 8 GLY n 1 9 TYR n 1 10 ILE n 1 11 TYR n 1 12 ARG n 1 13 LEU n 1 14 ALA n 1 15 GLN n 1 16 ASP n 1 17 TYR n 1 18 LEU n 1 19 GLN n 1 20 CYS n 1 21 VAL n 1 22 LEU n 1 23 GLN n 1 24 ILE n 1 25 PRO n 1 26 GLN n 1 27 PRO n 1 28 GLY n 1 29 SER n 1 30 GLY n 1 31 PRO n 1 32 SER n 1 33 LYS n 1 34 THR n 1 35 SER n 1 36 ARG n 1 37 VAL n 1 38 LEU n 1 39 GLN n 1 40 ASN n 1 41 VAL n 1 42 ALA n 1 43 PHE n 1 44 SER n 1 45 VAL n 1 46 GLN n 1 47 LYS n 1 48 GLU n 1 49 VAL n 1 50 GLU n 1 51 LYS n 1 52 ASN n 1 53 LEU n 1 54 LYS n 1 55 SER n 1 56 CYS n 1 57 LEU n 1 58 ASP n 1 59 ASN n 1 60 VAL n 1 61 ASN n 1 62 VAL n 1 63 VAL n 1 64 SER n 1 65 VAL n 1 66 ASP n 1 67 THR n 1 68 ALA n 1 69 ARG n 1 70 THR n 1 71 LEU n 1 72 PHE n 1 73 ASN n 1 74 GLN n 1 75 VAL n 1 76 MET n 1 77 GLU n 1 78 LYS n 1 79 GLU n 1 80 PHE n 1 81 GLU n 1 82 ASP n 1 83 GLY n 1 84 ILE n 1 85 ILE n 1 86 ASN n 1 87 TRP n 1 88 GLY n 1 89 ARG n 1 90 ILE n 1 91 VAL n 1 92 THR n 1 93 ILE n 1 94 PHE n 1 95 ALA n 1 96 PHE n 1 97 GLU n 1 98 GLY n 1 99 ILE n 1 100 LEU n 1 101 ILE n 1 102 LYS n 1 103 LYS n 1 104 LEU n 1 105 LEU n 1 106 ARG n 1 107 GLN n 1 108 GLN n 1 109 ILE n 1 110 ALA n 1 111 PRO n 1 112 ASP n 1 113 VAL n 1 114 ASP n 1 115 THR n 1 116 TYR n 1 117 LYS n 1 118 GLU n 1 119 ILE n 1 120 SER n 1 121 TYR n 1 122 PHE n 1 123 VAL n 1 124 ALA n 1 125 GLU n 1 126 PHE n 1 127 ILE n 1 128 MET n 1 129 ASN n 1 130 ASN n 1 131 THR n 1 132 GLY n 1 133 GLU n 1 134 TRP n 1 135 ILE n 1 136 ARG n 1 137 GLN n 1 138 ASN n 1 139 GLY n 1 140 GLY n 1 141 TRP n 1 142 GLU n 1 143 ASN n 1 144 GLY n 1 145 PHE n 1 146 VAL n 1 147 LYS n 1 148 LYS n 1 149 PHE n 1 150 GLU n 1 151 PRO n 1 152 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 152 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BCL2A1, BCL2L5, BFL1, GRS, HBPA1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1ILW non-polymer . ;(3~{S})-3-[[4-[(1~{R},3~{R})-3-[[(3~{R})-1,1-bis(oxidanylidene)thiolan-3-yl]carbamoylamino]cyclopentyl]oxy-3-fluoranyl-phenyl]-propanoyl-amino]-3-(4-chlorophenyl)propanamide ; ? 'C28 H34 Cl F N4 O6 S' 609.109 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 MET 2 1 ? ? ? A . n A 1 3 THR 3 2 ? ? ? A . n A 1 4 ASP 4 3 3 ASP ASP A . n A 1 5 CYS 5 4 4 CYS CYS A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 PHE 7 6 6 PHE PHE A . n A 1 8 GLY 8 7 7 GLY GLY A . n A 1 9 TYR 9 8 8 TYR TYR A . n A 1 10 ILE 10 9 9 ILE ILE A . n A 1 11 TYR 11 10 10 TYR TYR A . n A 1 12 ARG 12 11 11 ARG ARG A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 ALA 14 13 13 ALA ALA A . n A 1 15 GLN 15 14 14 GLN GLN A . n A 1 16 ASP 16 15 15 ASP ASP A . n A 1 17 TYR 17 16 16 TYR TYR A . n A 1 18 LEU 18 17 17 LEU LEU A . n A 1 19 GLN 19 18 18 GLN GLN A . n A 1 20 CYS 20 19 19 CYS CYS A . n A 1 21 VAL 21 20 20 VAL VAL A . n A 1 22 LEU 22 21 21 LEU LEU A . n A 1 23 GLN 23 22 22 GLN GLN A . n A 1 24 ILE 24 23 23 ILE ILE A . n A 1 25 PRO 25 24 24 PRO PRO A . n A 1 26 GLN 26 25 25 GLN GLN A . n A 1 27 PRO 27 26 26 PRO PRO A . n A 1 28 GLY 28 27 27 GLY GLY A . n A 1 29 SER 29 28 ? ? ? A . n A 1 30 GLY 30 29 29 GLY GLY A . n A 1 31 PRO 31 30 30 PRO PRO A . n A 1 32 SER 32 31 31 SER SER A . n A 1 33 LYS 33 32 32 LYS LYS A . n A 1 34 THR 34 33 33 THR THR A . n A 1 35 SER 35 34 34 SER SER A . n A 1 36 ARG 36 35 35 ARG ARG A . n A 1 37 VAL 37 36 36 VAL VAL A . n A 1 38 LEU 38 37 37 LEU LEU A . n A 1 39 GLN 39 38 38 GLN GLN A . n A 1 40 ASN 40 39 39 ASN ASN A . n A 1 41 VAL 41 40 40 VAL VAL A . n A 1 42 ALA 42 41 41 ALA ALA A . n A 1 43 PHE 43 42 42 PHE PHE A . n A 1 44 SER 44 43 43 SER SER A . n A 1 45 VAL 45 44 44 VAL VAL A . n A 1 46 GLN 46 45 45 GLN GLN A . n A 1 47 LYS 47 46 46 LYS LYS A . n A 1 48 GLU 48 47 47 GLU GLU A . n A 1 49 VAL 49 48 48 VAL VAL A . n A 1 50 GLU 50 49 49 GLU GLU A . n A 1 51 LYS 51 50 50 LYS LYS A . n A 1 52 ASN 52 51 51 ASN ASN A . n A 1 53 LEU 53 52 52 LEU LEU A . n A 1 54 LYS 54 53 53 LYS LYS A . n A 1 55 SER 55 54 54 SER SER A . n A 1 56 CYS 56 55 55 CYS CYS A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 ASP 58 57 57 ASP ASP A . n A 1 59 ASN 59 58 58 ASN ASN A . n A 1 60 VAL 60 59 59 VAL VAL A . n A 1 61 ASN 61 60 60 ASN ASN A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 VAL 63 62 62 VAL VAL A . n A 1 64 SER 64 63 63 SER SER A . n A 1 65 VAL 65 64 64 VAL VAL A . n A 1 66 ASP 66 65 65 ASP ASP A . n A 1 67 THR 67 66 66 THR THR A . n A 1 68 ALA 68 67 67 ALA ALA A . n A 1 69 ARG 69 68 68 ARG ARG A . n A 1 70 THR 70 69 69 THR THR A . n A 1 71 LEU 71 70 70 LEU LEU A . n A 1 72 PHE 72 71 71 PHE PHE A . n A 1 73 ASN 73 72 72 ASN ASN A . n A 1 74 GLN 74 73 73 GLN GLN A . n A 1 75 VAL 75 74 74 VAL VAL A . n A 1 76 MET 76 75 75 MET MET A . n A 1 77 GLU 77 76 76 GLU GLU A . n A 1 78 LYS 78 77 77 LYS LYS A . n A 1 79 GLU 79 78 78 GLU GLU A . n A 1 80 PHE 80 79 79 PHE PHE A . n A 1 81 GLU 81 80 80 GLU GLU A . n A 1 82 ASP 82 81 81 ASP ASP A . n A 1 83 GLY 83 82 82 GLY GLY A . n A 1 84 ILE 84 83 83 ILE ILE A . n A 1 85 ILE 85 84 84 ILE ILE A . n A 1 86 ASN 86 85 85 ASN ASN A . n A 1 87 TRP 87 86 86 TRP TRP A . n A 1 88 GLY 88 87 87 GLY GLY A . n A 1 89 ARG 89 88 88 ARG ARG A . n A 1 90 ILE 90 89 89 ILE ILE A . n A 1 91 VAL 91 90 90 VAL VAL A . n A 1 92 THR 92 91 91 THR THR A . n A 1 93 ILE 93 92 92 ILE ILE A . n A 1 94 PHE 94 93 93 PHE PHE A . n A 1 95 ALA 95 94 94 ALA ALA A . n A 1 96 PHE 96 95 95 PHE PHE A . n A 1 97 GLU 97 96 96 GLU GLU A . n A 1 98 GLY 98 97 97 GLY GLY A . n A 1 99 ILE 99 98 98 ILE ILE A . n A 1 100 LEU 100 99 99 LEU LEU A . n A 1 101 ILE 101 100 100 ILE ILE A . n A 1 102 LYS 102 101 101 LYS LYS A . n A 1 103 LYS 103 102 102 LYS LYS A . n A 1 104 LEU 104 103 103 LEU LEU A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 ARG 106 105 105 ARG ARG A . n A 1 107 GLN 107 106 106 GLN GLN A . n A 1 108 GLN 108 107 107 GLN GLN A . n A 1 109 ILE 109 108 108 ILE ILE A . n A 1 110 ALA 110 109 109 ALA ALA A . n A 1 111 PRO 111 110 110 PRO PRO A . n A 1 112 ASP 112 111 111 ASP ASP A . n A 1 113 VAL 113 112 112 VAL VAL A . n A 1 114 ASP 114 113 113 ASP ASP A . n A 1 115 THR 115 114 114 THR THR A . n A 1 116 TYR 116 115 115 TYR TYR A . n A 1 117 LYS 117 116 116 LYS LYS A . n A 1 118 GLU 118 117 117 GLU GLU A . n A 1 119 ILE 119 118 118 ILE ILE A . n A 1 120 SER 120 119 119 SER SER A . n A 1 121 TYR 121 120 120 TYR TYR A . n A 1 122 PHE 122 121 121 PHE PHE A . n A 1 123 VAL 123 122 122 VAL VAL A . n A 1 124 ALA 124 123 123 ALA ALA A . n A 1 125 GLU 125 124 124 GLU GLU A . n A 1 126 PHE 126 125 125 PHE PHE A . n A 1 127 ILE 127 126 126 ILE ILE A . n A 1 128 MET 128 127 127 MET MET A . n A 1 129 ASN 129 128 128 ASN ASN A . n A 1 130 ASN 130 129 129 ASN ASN A . n A 1 131 THR 131 130 130 THR THR A . n A 1 132 GLY 132 131 131 GLY GLY A . n A 1 133 GLU 133 132 132 GLU GLU A . n A 1 134 TRP 134 133 133 TRP TRP A . n A 1 135 ILE 135 134 134 ILE ILE A . n A 1 136 ARG 136 135 135 ARG ARG A . n A 1 137 GLN 137 136 136 GLN GLN A . n A 1 138 ASN 138 137 137 ASN ASN A . n A 1 139 GLY 139 138 138 GLY GLY A . n A 1 140 GLY 140 139 139 GLY GLY A . n A 1 141 TRP 141 140 140 TRP TRP A . n A 1 142 GLU 142 141 141 GLU GLU A . n A 1 143 ASN 143 142 142 ASN ASN A . n A 1 144 GLY 144 143 143 GLY GLY A . n A 1 145 PHE 145 144 144 PHE PHE A . n A 1 146 VAL 146 145 145 VAL VAL A . n A 1 147 LYS 147 146 146 LYS LYS A . n A 1 148 LYS 148 147 147 LYS LYS A . n A 1 149 PHE 149 148 148 PHE PHE A . n A 1 150 GLU 150 149 149 GLU GLU A . n A 1 151 PRO 151 150 150 PRO PRO A . n A 1 152 LYS 152 151 151 LYS LYS A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1ILW _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1ILW _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1ILW 1 201 1 A1ILW INH A . C 3 HOH 1 301 100 HOH HOH A . C 3 HOH 2 302 110 HOH HOH A . C 3 HOH 3 303 107 HOH HOH A . C 3 HOH 4 304 96 HOH HOH A . C 3 HOH 5 305 105 HOH HOH A . C 3 HOH 6 306 47 HOH HOH A . C 3 HOH 7 307 73 HOH HOH A . C 3 HOH 8 308 5 HOH HOH A . C 3 HOH 9 309 117 HOH HOH A . C 3 HOH 10 310 28 HOH HOH A . C 3 HOH 11 311 30 HOH HOH A . C 3 HOH 12 312 40 HOH HOH A . C 3 HOH 13 313 116 HOH HOH A . C 3 HOH 14 314 34 HOH HOH A . C 3 HOH 15 315 99 HOH HOH A . C 3 HOH 16 316 2 HOH HOH A . C 3 HOH 17 317 46 HOH HOH A . C 3 HOH 18 318 76 HOH HOH A . C 3 HOH 19 319 21 HOH HOH A . C 3 HOH 20 320 42 HOH HOH A . C 3 HOH 21 321 18 HOH HOH A . C 3 HOH 22 322 79 HOH HOH A . C 3 HOH 23 323 22 HOH HOH A . C 3 HOH 24 324 13 HOH HOH A . C 3 HOH 25 325 36 HOH HOH A . C 3 HOH 26 326 6 HOH HOH A . C 3 HOH 27 327 4 HOH HOH A . C 3 HOH 28 328 27 HOH HOH A . C 3 HOH 29 329 14 HOH HOH A . C 3 HOH 30 330 109 HOH HOH A . C 3 HOH 31 331 38 HOH HOH A . C 3 HOH 32 332 15 HOH HOH A . C 3 HOH 33 333 8 HOH HOH A . C 3 HOH 34 334 77 HOH HOH A . C 3 HOH 35 335 83 HOH HOH A . C 3 HOH 36 336 103 HOH HOH A . C 3 HOH 37 337 32 HOH HOH A . C 3 HOH 38 338 101 HOH HOH A . C 3 HOH 39 339 75 HOH HOH A . C 3 HOH 40 340 87 HOH HOH A . C 3 HOH 41 341 26 HOH HOH A . C 3 HOH 42 342 106 HOH HOH A . C 3 HOH 43 343 68 HOH HOH A . C 3 HOH 44 344 102 HOH HOH A . C 3 HOH 45 345 16 HOH HOH A . C 3 HOH 46 346 112 HOH HOH A . C 3 HOH 47 347 54 HOH HOH A . C 3 HOH 48 348 71 HOH HOH A . C 3 HOH 49 349 98 HOH HOH A . C 3 HOH 50 350 97 HOH HOH A . C 3 HOH 51 351 9 HOH HOH A . C 3 HOH 52 352 24 HOH HOH A . C 3 HOH 53 353 90 HOH HOH A . C 3 HOH 54 354 20 HOH HOH A . C 3 HOH 55 355 72 HOH HOH A . C 3 HOH 56 356 62 HOH HOH A . C 3 HOH 57 357 51 HOH HOH A . C 3 HOH 58 358 118 HOH HOH A . C 3 HOH 59 359 11 HOH HOH A . C 3 HOH 60 360 48 HOH HOH A . C 3 HOH 61 361 93 HOH HOH A . C 3 HOH 62 362 111 HOH HOH A . C 3 HOH 63 363 31 HOH HOH A . C 3 HOH 64 364 60 HOH HOH A . C 3 HOH 65 365 95 HOH HOH A . C 3 HOH 66 366 35 HOH HOH A . C 3 HOH 67 367 104 HOH HOH A . C 3 HOH 68 368 92 HOH HOH A . C 3 HOH 69 369 45 HOH HOH A . C 3 HOH 70 370 19 HOH HOH A . C 3 HOH 71 371 17 HOH HOH A . C 3 HOH 72 372 69 HOH HOH A . C 3 HOH 73 373 82 HOH HOH A . C 3 HOH 74 374 25 HOH HOH A . C 3 HOH 75 375 43 HOH HOH A . C 3 HOH 76 376 55 HOH HOH A . C 3 HOH 77 377 33 HOH HOH A . C 3 HOH 78 378 64 HOH HOH A . C 3 HOH 79 379 41 HOH HOH A . C 3 HOH 80 380 115 HOH HOH A . C 3 HOH 81 381 85 HOH HOH A . C 3 HOH 82 382 113 HOH HOH A . C 3 HOH 83 383 108 HOH HOH A . C 3 HOH 84 384 88 HOH HOH A . C 3 HOH 85 385 53 HOH HOH A . C 3 HOH 86 386 78 HOH HOH A . C 3 HOH 87 387 50 HOH HOH A . C 3 HOH 88 388 57 HOH HOH A . C 3 HOH 89 389 67 HOH HOH A . C 3 HOH 90 390 94 HOH HOH A . C 3 HOH 91 391 29 HOH HOH A . C 3 HOH 92 392 65 HOH HOH A . C 3 HOH 93 393 86 HOH HOH A . C 3 HOH 94 394 114 HOH HOH A . C 3 HOH 95 395 89 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 5 ? CG ? A GLU 6 CG 2 1 Y 1 A GLU 5 ? CD ? A GLU 6 CD 3 1 Y 1 A GLU 5 ? OE1 ? A GLU 6 OE1 4 1 Y 1 A GLU 5 ? OE2 ? A GLU 6 OE2 5 1 Y 1 A GLN 25 ? CG ? A GLN 26 CG 6 1 Y 1 A GLN 25 ? CD ? A GLN 26 CD 7 1 Y 1 A GLN 25 ? OE1 ? A GLN 26 OE1 8 1 Y 1 A GLN 25 ? NE2 ? A GLN 26 NE2 9 1 Y 1 A LYS 32 ? CD ? A LYS 33 CD 10 1 Y 1 A LYS 32 ? CE ? A LYS 33 CE 11 1 Y 1 A LYS 32 ? NZ ? A LYS 33 NZ 12 1 Y 1 A LYS 46 ? CD ? A LYS 47 CD 13 1 Y 1 A LYS 46 ? CE ? A LYS 47 CE 14 1 Y 1 A LYS 46 ? NZ ? A LYS 47 NZ 15 1 Y 1 A LYS 50 ? CE ? A LYS 51 CE 16 1 Y 1 A LYS 50 ? NZ ? A LYS 51 NZ 17 1 Y 1 A LYS 53 ? CE ? A LYS 54 CE 18 1 Y 1 A LYS 53 ? NZ ? A LYS 54 NZ 19 1 Y 1 A LYS 147 ? CE ? A LYS 148 CE 20 1 Y 1 A LYS 147 ? NZ ? A LYS 148 NZ 21 1 Y 1 A LYS 151 ? CG ? A LYS 152 CG 22 1 Y 1 A LYS 151 ? CD ? A LYS 152 CD 23 1 Y 1 A LYS 151 ? CE ? A LYS 152 CE 24 1 Y 1 A LYS 151 ? NZ ? A LYS 152 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.8 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'Jun 30, 2023' 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.13 3 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? '1.0.5 (20230726)' 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? STARANISO ? ? ? '2.3.94 (20230525)' 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 'CCP4 8.0.004' 6 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.9.8.83 7 # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 101.02 _cell.angle_beta_esd ? _cell.angle_gamma 90 _cell.angle_gamma_esd ? _cell.entry_id 9GIT _cell.details ? _cell.formula_units_Z ? _cell.length_a 40.329 _cell.length_a_esd ? _cell.length_b 42.854 _cell.length_b_esd ? _cell.length_c 43.138 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9GIT _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9GIT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.14 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.63 _exptl_crystal.description 'Thick pointed rods/plates' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.14 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Protein:ligand complex at ~4mg/ml in 20 mM HEPES pH 7.5, 150 mM NaCl, 5% glycerol, 2 mM TCEP, 1%DMSO. 150nL mixed with 150nL of well solution, 0.1M PCPT* pH 7.14, Na3 Citrate 0.92 M. *PCPT = Sodium propionate, sodium cacodylate trihydrate, bis-tris propane buffer system. Using STPLabtech Mosquito. ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-09-18 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.95374 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.95374 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9GIT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.145 _reflns.d_resolution_low 32.143 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 39710 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 76.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.046 _reflns.pdbx_Rpim_I_all 0.020 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.041 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.145 _reflns_shell.d_res_low 1.252 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1985 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.5 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.622 _reflns_shell.pdbx_Rpim_I_all 0.370 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.723 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 16.4 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.496 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.2556 _refine.aniso_B[1][2] 0 _refine.aniso_B[1][3] 0.0537 _refine.aniso_B[2][2] -0.0921 _refine.aniso_B[2][3] 0 _refine.aniso_B[3][3] -0.1635 _refine.B_iso_max ? _refine.B_iso_mean 17.72 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.959 _refine.correlation_coeff_Fo_to_Fc_free 0.948 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9GIT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.145 _refine.ls_d_res_low 16.66 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 39691 _refine.ls_number_reflns_R_free 1922 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 76.2 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1916 _refine.ls_R_factor_R_free 0.2116 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1906 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.049 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.049 _refine.pdbx_overall_SU_R_Blow_DPI 0.047 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.047 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 9GIT _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.15 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.145 _refine_hist.d_res_low 16.66 _refine_hist.number_atoms_solvent 95 _refine_hist.number_atoms_total 1315 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1179 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 41 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 ? 1272 ? t_bond_d 2 HARMONIC 'X-RAY DIFFRACTION' ? 1.2 ? 1736 ? t_angle_deg 2 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 451 ? t_dihedral_angle_d 2 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 231 ? t_gen_planes 5 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1272 ? t_it 10 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 164 ? t_chiral_improper_torsion 5 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? 1367 ? t_ideal_dist_contact 4 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 3.96 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 12.69 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.15 _refine_ls_shell.d_res_low 1.22 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 794 _refine_ls_shell.number_reflns_R_free 38 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.percent_reflns_obs 8.82 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs 0.2649 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2656 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.2497 # _struct.entry_id 9GIT _struct.title 'BFL1 covalently bound to inhibitor compound 43' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9GIT _struct_keywords.text 'BFL, BCL, covalent, inhibitor, APOPTOSIS' _struct_keywords.pdbx_keywords APOPTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B2LA1_HUMAN _struct_ref.pdbx_db_accession Q16548 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9GIT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 152 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16548 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 151 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 151 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9GIT _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q16548 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8030 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 6 ? LEU A 22 ? GLU A 5 LEU A 21 1 ? 17 HELX_P HELX_P2 AA2 SER A 32 ? LEU A 53 ? SER A 31 LEU A 52 1 ? 22 HELX_P HELX_P3 AA3 LEU A 53 ? ASP A 58 ? LEU A 52 ASP A 57 1 ? 6 HELX_P HELX_P4 AA4 SER A 64 ? PHE A 80 ? SER A 63 PHE A 79 1 ? 17 HELX_P HELX_P5 AA5 ASN A 86 ? GLN A 108 ? ASN A 85 GLN A 107 1 ? 23 HELX_P HELX_P6 AA6 ASP A 114 ? ASN A 138 ? ASP A 113 ASN A 137 1 ? 25 HELX_P HELX_P7 AA7 GLY A 139 ? GLY A 144 ? GLY A 138 GLY A 143 1 ? 6 HELX_P HELX_P8 AA8 GLY A 144 ? GLU A 150 ? GLY A 143 GLU A 149 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 56 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id A1ILW _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 55 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id A1ILW _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.809 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id A1ILW _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 56 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id A1ILW _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 55 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C1 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id A1ILW _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # _pdbx_entry_details.entry_id 9GIT _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method ? _pdbx_refine_tls.origin_x 12.1256 _pdbx_refine_tls.origin_y 0.015 _pdbx_refine_tls.origin_z 7.9025 _pdbx_refine_tls.T[1][1] -0.0102 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0139 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0027 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] -0.0184 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0021 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] -0.0222 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.6203 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.3076 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.0276 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.9994 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.0569 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.5905 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0169 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0257 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0252 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0257 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0094 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0259 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.0252 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0259 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0074 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 3 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 151 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|* }' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A MET 1 ? A MET 2 3 1 Y 1 A THR 2 ? A THR 3 4 1 Y 1 A SER 28 ? A SER 29 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1ILW C1 C N N 1 A1ILW C2 C N N 2 A1ILW C3 C N N 3 A1ILW O4 O N N 4 A1ILW C7 C Y N 5 A1ILW C8 C Y N 6 A1ILW C9 C Y N 7 A1ILW C10 C Y N 8 A1ILW C11 C Y N 9 A1ILW C14 C N R 10 A1ILW C15 C N N 11 A1ILW C16 C N N 12 A1ILW C20 C N N 13 A1ILW C24 C N N 14 A1ILW O28 O N N 15 A1ILW C30 C N S 16 A1ILW C31 C N N 17 A1ILW C32 C N N 18 A1ILW C35 C Y N 19 A1ILW N5 N N N 20 A1ILW C6 C Y N 21 A1ILW F12 F N N 22 A1ILW O13 O N N 23 A1ILW C17 C N R 24 A1ILW C18 C N N 25 A1ILW N19 N N N 26 A1ILW O21 O N N 27 A1ILW N22 N N N 28 A1ILW C23 C N R 29 A1ILW C25 C N N 30 A1ILW S26 S N N 31 A1ILW O27 O N N 32 A1ILW C29 C N N 33 A1ILW O33 O N N 34 A1ILW N34 N N N 35 A1ILW C36 C Y N 36 A1ILW C37 C Y N 37 A1ILW C38 C Y N 38 A1ILW C39 C Y N 39 A1ILW C40 C Y N 40 A1ILW CL41 CL N N 41 A1ILW H1B H N N 42 A1ILW H1A H N N 43 A1ILW H1C H N N 44 A1ILW H2A H N N 45 A1ILW H2B H N N 46 A1ILW H7 H N N 47 A1ILW H8 H N N 48 A1ILW H11 H N N 49 A1ILW H14 H N N 50 A1ILW H15B H N N 51 A1ILW H15A H N N 52 A1ILW H16B H N N 53 A1ILW H16A H N N 54 A1ILW H24B H N N 55 A1ILW H24A H N N 56 A1ILW H30 H N N 57 A1ILW H31A H N N 58 A1ILW H31B H N N 59 A1ILW H17 H N N 60 A1ILW H18B H N N 61 A1ILW H18A H N N 62 A1ILW H19 H N N 63 A1ILW H22 H N N 64 A1ILW H23 H N N 65 A1ILW H25B H N N 66 A1ILW H25A H N N 67 A1ILW H29B H N N 68 A1ILW H29A H N N 69 A1ILW H34A H N N 70 A1ILW H34B H N N 71 A1ILW H36 H N N 72 A1ILW H37 H N N 73 A1ILW H39 H N N 74 A1ILW H40 H N N 75 ALA N N N N 76 ALA CA C N S 77 ALA C C N N 78 ALA O O N N 79 ALA CB C N N 80 ALA OXT O N N 81 ALA H H N N 82 ALA H2 H N N 83 ALA HA H N N 84 ALA HB1 H N N 85 ALA HB2 H N N 86 ALA HB3 H N N 87 ALA HXT H N N 88 ARG N N N N 89 ARG CA C N S 90 ARG C C N N 91 ARG O O N N 92 ARG CB C N N 93 ARG CG C N N 94 ARG CD C N N 95 ARG NE N N N 96 ARG CZ C N N 97 ARG NH1 N N N 98 ARG NH2 N N N 99 ARG OXT O N N 100 ARG H H N N 101 ARG H2 H N N 102 ARG HA H N N 103 ARG HB2 H N N 104 ARG HB3 H N N 105 ARG HG2 H N N 106 ARG HG3 H N N 107 ARG HD2 H N N 108 ARG HD3 H N N 109 ARG HE H N N 110 ARG HH11 H N N 111 ARG HH12 H N N 112 ARG HH21 H N N 113 ARG HH22 H N N 114 ARG HXT H N N 115 ASN N N N N 116 ASN CA C N S 117 ASN C C N N 118 ASN O O N N 119 ASN CB C N N 120 ASN CG C N N 121 ASN OD1 O N N 122 ASN ND2 N N N 123 ASN OXT O N N 124 ASN H H N N 125 ASN H2 H N N 126 ASN HA H N N 127 ASN HB2 H N N 128 ASN HB3 H N N 129 ASN HD21 H N N 130 ASN HD22 H N N 131 ASN HXT H N N 132 ASP N N N N 133 ASP CA C N S 134 ASP C C N N 135 ASP O O N N 136 ASP CB C N N 137 ASP CG C N N 138 ASP OD1 O N N 139 ASP OD2 O N N 140 ASP OXT O N N 141 ASP H H N N 142 ASP H2 H N N 143 ASP HA H N N 144 ASP HB2 H N N 145 ASP HB3 H N N 146 ASP HD2 H N N 147 ASP HXT H N N 148 CYS N N N N 149 CYS CA C N R 150 CYS C C N N 151 CYS O O N N 152 CYS CB C N N 153 CYS SG S N N 154 CYS OXT O N N 155 CYS H H N N 156 CYS H2 H N N 157 CYS HA H N N 158 CYS HB2 H N N 159 CYS HB3 H N N 160 CYS HG H N N 161 CYS HXT H N N 162 GLN N N N N 163 GLN CA C N S 164 GLN C C N N 165 GLN O O N N 166 GLN CB C N N 167 GLN CG C N N 168 GLN CD C N N 169 GLN OE1 O N N 170 GLN NE2 N N N 171 GLN OXT O N N 172 GLN H H N N 173 GLN H2 H N N 174 GLN HA H N N 175 GLN HB2 H N N 176 GLN HB3 H N N 177 GLN HG2 H N N 178 GLN HG3 H N N 179 GLN HE21 H N N 180 GLN HE22 H N N 181 GLN HXT H N N 182 GLU N N N N 183 GLU CA C N S 184 GLU C C N N 185 GLU O O N N 186 GLU CB C N N 187 GLU CG C N N 188 GLU CD C N N 189 GLU OE1 O N N 190 GLU OE2 O N N 191 GLU OXT O N N 192 GLU H H N N 193 GLU H2 H N N 194 GLU HA H N N 195 GLU HB2 H N N 196 GLU HB3 H N N 197 GLU HG2 H N N 198 GLU HG3 H N N 199 GLU HE2 H N N 200 GLU HXT H N N 201 GLY N N N N 202 GLY CA C N N 203 GLY C C N N 204 GLY O O N N 205 GLY OXT O N N 206 GLY H H N N 207 GLY H2 H N N 208 GLY HA2 H N N 209 GLY HA3 H N N 210 GLY HXT H N N 211 HOH O O N N 212 HOH H1 H N N 213 HOH H2 H N N 214 ILE N N N N 215 ILE CA C N S 216 ILE C C N N 217 ILE O O N N 218 ILE CB C N S 219 ILE CG1 C N N 220 ILE CG2 C N N 221 ILE CD1 C N N 222 ILE OXT O N N 223 ILE H H N N 224 ILE H2 H N N 225 ILE HA H N N 226 ILE HB H N N 227 ILE HG12 H N N 228 ILE HG13 H N N 229 ILE HG21 H N N 230 ILE HG22 H N N 231 ILE HG23 H N N 232 ILE HD11 H N N 233 ILE HD12 H N N 234 ILE HD13 H N N 235 ILE HXT H N N 236 LEU N N N N 237 LEU CA C N S 238 LEU C C N N 239 LEU O O N N 240 LEU CB C N N 241 LEU CG C N N 242 LEU CD1 C N N 243 LEU CD2 C N N 244 LEU OXT O N N 245 LEU H H N N 246 LEU H2 H N N 247 LEU HA H N N 248 LEU HB2 H N N 249 LEU HB3 H N N 250 LEU HG H N N 251 LEU HD11 H N N 252 LEU HD12 H N N 253 LEU HD13 H N N 254 LEU HD21 H N N 255 LEU HD22 H N N 256 LEU HD23 H N N 257 LEU HXT H N N 258 LYS N N N N 259 LYS CA C N S 260 LYS C C N N 261 LYS O O N N 262 LYS CB C N N 263 LYS CG C N N 264 LYS CD C N N 265 LYS CE C N N 266 LYS NZ N N N 267 LYS OXT O N N 268 LYS H H N N 269 LYS H2 H N N 270 LYS HA H N N 271 LYS HB2 H N N 272 LYS HB3 H N N 273 LYS HG2 H N N 274 LYS HG3 H N N 275 LYS HD2 H N N 276 LYS HD3 H N N 277 LYS HE2 H N N 278 LYS HE3 H N N 279 LYS HZ1 H N N 280 LYS HZ2 H N N 281 LYS HZ3 H N N 282 LYS HXT H N N 283 MET N N N N 284 MET CA C N S 285 MET C C N N 286 MET O O N N 287 MET CB C N N 288 MET CG C N N 289 MET SD S N N 290 MET CE C N N 291 MET OXT O N N 292 MET H H N N 293 MET H2 H N N 294 MET HA H N N 295 MET HB2 H N N 296 MET HB3 H N N 297 MET HG2 H N N 298 MET HG3 H N N 299 MET HE1 H N N 300 MET HE2 H N N 301 MET HE3 H N N 302 MET HXT H N N 303 PHE N N N N 304 PHE CA C N S 305 PHE C C N N 306 PHE O O N N 307 PHE CB C N N 308 PHE CG C Y N 309 PHE CD1 C Y N 310 PHE CD2 C Y N 311 PHE CE1 C Y N 312 PHE CE2 C Y N 313 PHE CZ C Y N 314 PHE OXT O N N 315 PHE H H N N 316 PHE H2 H N N 317 PHE HA H N N 318 PHE HB2 H N N 319 PHE HB3 H N N 320 PHE HD1 H N N 321 PHE HD2 H N N 322 PHE HE1 H N N 323 PHE HE2 H N N 324 PHE HZ H N N 325 PHE HXT H N N 326 PRO N N N N 327 PRO CA C N S 328 PRO C C N N 329 PRO O O N N 330 PRO CB C N N 331 PRO CG C N N 332 PRO CD C N N 333 PRO OXT O N N 334 PRO H H N N 335 PRO HA H N N 336 PRO HB2 H N N 337 PRO HB3 H N N 338 PRO HG2 H N N 339 PRO HG3 H N N 340 PRO HD2 H N N 341 PRO HD3 H N N 342 PRO HXT H N N 343 SER N N N N 344 SER CA C N S 345 SER C C N N 346 SER O O N N 347 SER CB C N N 348 SER OG O N N 349 SER OXT O N N 350 SER H H N N 351 SER H2 H N N 352 SER HA H N N 353 SER HB2 H N N 354 SER HB3 H N N 355 SER HG H N N 356 SER HXT H N N 357 THR N N N N 358 THR CA C N S 359 THR C C N N 360 THR O O N N 361 THR CB C N R 362 THR OG1 O N N 363 THR CG2 C N N 364 THR OXT O N N 365 THR H H N N 366 THR H2 H N N 367 THR HA H N N 368 THR HB H N N 369 THR HG1 H N N 370 THR HG21 H N N 371 THR HG22 H N N 372 THR HG23 H N N 373 THR HXT H N N 374 TRP N N N N 375 TRP CA C N S 376 TRP C C N N 377 TRP O O N N 378 TRP CB C N N 379 TRP CG C Y N 380 TRP CD1 C Y N 381 TRP CD2 C Y N 382 TRP NE1 N Y N 383 TRP CE2 C Y N 384 TRP CE3 C Y N 385 TRP CZ2 C Y N 386 TRP CZ3 C Y N 387 TRP CH2 C Y N 388 TRP OXT O N N 389 TRP H H N N 390 TRP H2 H N N 391 TRP HA H N N 392 TRP HB2 H N N 393 TRP HB3 H N N 394 TRP HD1 H N N 395 TRP HE1 H N N 396 TRP HE3 H N N 397 TRP HZ2 H N N 398 TRP HZ3 H N N 399 TRP HH2 H N N 400 TRP HXT H N N 401 TYR N N N N 402 TYR CA C N S 403 TYR C C N N 404 TYR O O N N 405 TYR CB C N N 406 TYR CG C Y N 407 TYR CD1 C Y N 408 TYR CD2 C Y N 409 TYR CE1 C Y N 410 TYR CE2 C Y N 411 TYR CZ C Y N 412 TYR OH O N N 413 TYR OXT O N N 414 TYR H H N N 415 TYR H2 H N N 416 TYR HA H N N 417 TYR HB2 H N N 418 TYR HB3 H N N 419 TYR HD1 H N N 420 TYR HD2 H N N 421 TYR HE1 H N N 422 TYR HE2 H N N 423 TYR HH H N N 424 TYR HXT H N N 425 VAL N N N N 426 VAL CA C N S 427 VAL C C N N 428 VAL O O N N 429 VAL CB C N N 430 VAL CG1 C N N 431 VAL CG2 C N N 432 VAL OXT O N N 433 VAL H H N N 434 VAL H2 H N N 435 VAL HA H N N 436 VAL HB H N N 437 VAL HG11 H N N 438 VAL HG12 H N N 439 VAL HG13 H N N 440 VAL HG21 H N N 441 VAL HG22 H N N 442 VAL HG23 H N N 443 VAL HXT H N N 444 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1ILW C1 C2 sing N N 1 A1ILW C2 C3 sing N N 2 A1ILW C3 O4 doub N N 3 A1ILW C3 N5 sing N N 4 A1ILW N5 C6 sing N N 5 A1ILW C6 C7 doub Y N 6 A1ILW C7 C8 sing Y N 7 A1ILW C8 C9 doub Y N 8 A1ILW C9 C10 sing Y N 9 A1ILW C10 C11 doub Y N 10 A1ILW C10 F12 sing N N 11 A1ILW C9 O13 sing N N 12 A1ILW O13 C14 sing N N 13 A1ILW C14 C15 sing N N 14 A1ILW C15 C16 sing N N 15 A1ILW C16 C17 sing N N 16 A1ILW C17 C18 sing N N 17 A1ILW C17 N19 sing N N 18 A1ILW N19 C20 sing N N 19 A1ILW C20 O21 doub N N 20 A1ILW C20 N22 sing N N 21 A1ILW N22 C23 sing N N 22 A1ILW C23 C24 sing N N 23 A1ILW C24 C25 sing N N 24 A1ILW C25 S26 sing N N 25 A1ILW S26 O27 doub N N 26 A1ILW S26 O28 doub N N 27 A1ILW S26 C29 sing N N 28 A1ILW N5 C30 sing N N 29 A1ILW C30 C31 sing N N 30 A1ILW C31 C32 sing N N 31 A1ILW C32 O33 doub N N 32 A1ILW C32 N34 sing N N 33 A1ILW C30 C35 sing N N 34 A1ILW C35 C36 doub Y N 35 A1ILW C36 C37 sing Y N 36 A1ILW C37 C38 doub Y N 37 A1ILW C38 C39 sing Y N 38 A1ILW C39 C40 doub Y N 39 A1ILW C38 CL41 sing N N 40 A1ILW C11 C6 sing Y N 41 A1ILW C18 C14 sing N N 42 A1ILW C29 C23 sing N N 43 A1ILW C40 C35 sing Y N 44 A1ILW C1 H1B sing N N 45 A1ILW C1 H1A sing N N 46 A1ILW C1 H1C sing N N 47 A1ILW C2 H2A sing N N 48 A1ILW C2 H2B sing N N 49 A1ILW C7 H7 sing N N 50 A1ILW C8 H8 sing N N 51 A1ILW C11 H11 sing N N 52 A1ILW C14 H14 sing N N 53 A1ILW C15 H15B sing N N 54 A1ILW C15 H15A sing N N 55 A1ILW C16 H16B sing N N 56 A1ILW C16 H16A sing N N 57 A1ILW C24 H24B sing N N 58 A1ILW C24 H24A sing N N 59 A1ILW C30 H30 sing N N 60 A1ILW C31 H31A sing N N 61 A1ILW C31 H31B sing N N 62 A1ILW C17 H17 sing N N 63 A1ILW C18 H18B sing N N 64 A1ILW C18 H18A sing N N 65 A1ILW N19 H19 sing N N 66 A1ILW N22 H22 sing N N 67 A1ILW C23 H23 sing N N 68 A1ILW C25 H25B sing N N 69 A1ILW C25 H25A sing N N 70 A1ILW C29 H29B sing N N 71 A1ILW C29 H29A sing N N 72 A1ILW N34 H34A sing N N 73 A1ILW N34 H34B sing N N 74 A1ILW C36 H36 sing N N 75 A1ILW C37 H37 sing N N 76 A1ILW C39 H39 sing N N 77 A1ILW C40 H40 sing N N 78 ALA N CA sing N N 79 ALA N H sing N N 80 ALA N H2 sing N N 81 ALA CA C sing N N 82 ALA CA CB sing N N 83 ALA CA HA sing N N 84 ALA C O doub N N 85 ALA C OXT sing N N 86 ALA CB HB1 sing N N 87 ALA CB HB2 sing N N 88 ALA CB HB3 sing N N 89 ALA OXT HXT sing N N 90 ARG N CA sing N N 91 ARG N H sing N N 92 ARG N H2 sing N N 93 ARG CA C sing N N 94 ARG CA CB sing N N 95 ARG CA HA sing N N 96 ARG C O doub N N 97 ARG C OXT sing N N 98 ARG CB CG sing N N 99 ARG CB HB2 sing N N 100 ARG CB HB3 sing N N 101 ARG CG CD sing N N 102 ARG CG HG2 sing N N 103 ARG CG HG3 sing N N 104 ARG CD NE sing N N 105 ARG CD HD2 sing N N 106 ARG CD HD3 sing N N 107 ARG NE CZ sing N N 108 ARG NE HE sing N N 109 ARG CZ NH1 sing N N 110 ARG CZ NH2 doub N N 111 ARG NH1 HH11 sing N N 112 ARG NH1 HH12 sing N N 113 ARG NH2 HH21 sing N N 114 ARG NH2 HH22 sing N N 115 ARG OXT HXT sing N N 116 ASN N CA sing N N 117 ASN N H sing N N 118 ASN N H2 sing N N 119 ASN CA C sing N N 120 ASN CA CB sing N N 121 ASN CA HA sing N N 122 ASN C O doub N N 123 ASN C OXT sing N N 124 ASN CB CG sing N N 125 ASN CB HB2 sing N N 126 ASN CB HB3 sing N N 127 ASN CG OD1 doub N N 128 ASN CG ND2 sing N N 129 ASN ND2 HD21 sing N N 130 ASN ND2 HD22 sing N N 131 ASN OXT HXT sing N N 132 ASP N CA sing N N 133 ASP N H sing N N 134 ASP N H2 sing N N 135 ASP CA C sing N N 136 ASP CA CB sing N N 137 ASP CA HA sing N N 138 ASP C O doub N N 139 ASP C OXT sing N N 140 ASP CB CG sing N N 141 ASP CB HB2 sing N N 142 ASP CB HB3 sing N N 143 ASP CG OD1 doub N N 144 ASP CG OD2 sing N N 145 ASP OD2 HD2 sing N N 146 ASP OXT HXT sing N N 147 CYS N CA sing N N 148 CYS N H sing N N 149 CYS N H2 sing N N 150 CYS CA C sing N N 151 CYS CA CB sing N N 152 CYS CA HA sing N N 153 CYS C O doub N N 154 CYS C OXT sing N N 155 CYS CB SG sing N N 156 CYS CB HB2 sing N N 157 CYS CB HB3 sing N N 158 CYS SG HG sing N N 159 CYS OXT HXT sing N N 160 GLN N CA sing N N 161 GLN N H sing N N 162 GLN N H2 sing N N 163 GLN CA C sing N N 164 GLN CA CB sing N N 165 GLN CA HA sing N N 166 GLN C O doub N N 167 GLN C OXT sing N N 168 GLN CB CG sing N N 169 GLN CB HB2 sing N N 170 GLN CB HB3 sing N N 171 GLN CG CD sing N N 172 GLN CG HG2 sing N N 173 GLN CG HG3 sing N N 174 GLN CD OE1 doub N N 175 GLN CD NE2 sing N N 176 GLN NE2 HE21 sing N N 177 GLN NE2 HE22 sing N N 178 GLN OXT HXT sing N N 179 GLU N CA sing N N 180 GLU N H sing N N 181 GLU N H2 sing N N 182 GLU CA C sing N N 183 GLU CA CB sing N N 184 GLU CA HA sing N N 185 GLU C O doub N N 186 GLU C OXT sing N N 187 GLU CB CG sing N N 188 GLU CB HB2 sing N N 189 GLU CB HB3 sing N N 190 GLU CG CD sing N N 191 GLU CG HG2 sing N N 192 GLU CG HG3 sing N N 193 GLU CD OE1 doub N N 194 GLU CD OE2 sing N N 195 GLU OE2 HE2 sing N N 196 GLU OXT HXT sing N N 197 GLY N CA sing N N 198 GLY N H sing N N 199 GLY N H2 sing N N 200 GLY CA C sing N N 201 GLY CA HA2 sing N N 202 GLY CA HA3 sing N N 203 GLY C O doub N N 204 GLY C OXT sing N N 205 GLY OXT HXT sing N N 206 HOH O H1 sing N N 207 HOH O H2 sing N N 208 ILE N CA sing N N 209 ILE N H sing N N 210 ILE N H2 sing N N 211 ILE CA C sing N N 212 ILE CA CB sing N N 213 ILE CA HA sing N N 214 ILE C O doub N N 215 ILE C OXT sing N N 216 ILE CB CG1 sing N N 217 ILE CB CG2 sing N N 218 ILE CB HB sing N N 219 ILE CG1 CD1 sing N N 220 ILE CG1 HG12 sing N N 221 ILE CG1 HG13 sing N N 222 ILE CG2 HG21 sing N N 223 ILE CG2 HG22 sing N N 224 ILE CG2 HG23 sing N N 225 ILE CD1 HD11 sing N N 226 ILE CD1 HD12 sing N N 227 ILE CD1 HD13 sing N N 228 ILE OXT HXT sing N N 229 LEU N CA sing N N 230 LEU N H sing N N 231 LEU N H2 sing N N 232 LEU CA C sing N N 233 LEU CA CB sing N N 234 LEU CA HA sing N N 235 LEU C O doub N N 236 LEU C OXT sing N N 237 LEU CB CG sing N N 238 LEU CB HB2 sing N N 239 LEU CB HB3 sing N N 240 LEU CG CD1 sing N N 241 LEU CG CD2 sing N N 242 LEU CG HG sing N N 243 LEU CD1 HD11 sing N N 244 LEU CD1 HD12 sing N N 245 LEU CD1 HD13 sing N N 246 LEU CD2 HD21 sing N N 247 LEU CD2 HD22 sing N N 248 LEU CD2 HD23 sing N N 249 LEU OXT HXT sing N N 250 LYS N CA sing N N 251 LYS N H sing N N 252 LYS N H2 sing N N 253 LYS CA C sing N N 254 LYS CA CB sing N N 255 LYS CA HA sing N N 256 LYS C O doub N N 257 LYS C OXT sing N N 258 LYS CB CG sing N N 259 LYS CB HB2 sing N N 260 LYS CB HB3 sing N N 261 LYS CG CD sing N N 262 LYS CG HG2 sing N N 263 LYS CG HG3 sing N N 264 LYS CD CE sing N N 265 LYS CD HD2 sing N N 266 LYS CD HD3 sing N N 267 LYS CE NZ sing N N 268 LYS CE HE2 sing N N 269 LYS CE HE3 sing N N 270 LYS NZ HZ1 sing N N 271 LYS NZ HZ2 sing N N 272 LYS NZ HZ3 sing N N 273 LYS OXT HXT sing N N 274 MET N CA sing N N 275 MET N H sing N N 276 MET N H2 sing N N 277 MET CA C sing N N 278 MET CA CB sing N N 279 MET CA HA sing N N 280 MET C O doub N N 281 MET C OXT sing N N 282 MET CB CG sing N N 283 MET CB HB2 sing N N 284 MET CB HB3 sing N N 285 MET CG SD sing N N 286 MET CG HG2 sing N N 287 MET CG HG3 sing N N 288 MET SD CE sing N N 289 MET CE HE1 sing N N 290 MET CE HE2 sing N N 291 MET CE HE3 sing N N 292 MET OXT HXT sing N N 293 PHE N CA sing N N 294 PHE N H sing N N 295 PHE N H2 sing N N 296 PHE CA C sing N N 297 PHE CA CB sing N N 298 PHE CA HA sing N N 299 PHE C O doub N N 300 PHE C OXT sing N N 301 PHE CB CG sing N N 302 PHE CB HB2 sing N N 303 PHE CB HB3 sing N N 304 PHE CG CD1 doub Y N 305 PHE CG CD2 sing Y N 306 PHE CD1 CE1 sing Y N 307 PHE CD1 HD1 sing N N 308 PHE CD2 CE2 doub Y N 309 PHE CD2 HD2 sing N N 310 PHE CE1 CZ doub Y N 311 PHE CE1 HE1 sing N N 312 PHE CE2 CZ sing Y N 313 PHE CE2 HE2 sing N N 314 PHE CZ HZ sing N N 315 PHE OXT HXT sing N N 316 PRO N CA sing N N 317 PRO N CD sing N N 318 PRO N H sing N N 319 PRO CA C sing N N 320 PRO CA CB sing N N 321 PRO CA HA sing N N 322 PRO C O doub N N 323 PRO C OXT sing N N 324 PRO CB CG sing N N 325 PRO CB HB2 sing N N 326 PRO CB HB3 sing N N 327 PRO CG CD sing N N 328 PRO CG HG2 sing N N 329 PRO CG HG3 sing N N 330 PRO CD HD2 sing N N 331 PRO CD HD3 sing N N 332 PRO OXT HXT sing N N 333 SER N CA sing N N 334 SER N H sing N N 335 SER N H2 sing N N 336 SER CA C sing N N 337 SER CA CB sing N N 338 SER CA HA sing N N 339 SER C O doub N N 340 SER C OXT sing N N 341 SER CB OG sing N N 342 SER CB HB2 sing N N 343 SER CB HB3 sing N N 344 SER OG HG sing N N 345 SER OXT HXT sing N N 346 THR N CA sing N N 347 THR N H sing N N 348 THR N H2 sing N N 349 THR CA C sing N N 350 THR CA CB sing N N 351 THR CA HA sing N N 352 THR C O doub N N 353 THR C OXT sing N N 354 THR CB OG1 sing N N 355 THR CB CG2 sing N N 356 THR CB HB sing N N 357 THR OG1 HG1 sing N N 358 THR CG2 HG21 sing N N 359 THR CG2 HG22 sing N N 360 THR CG2 HG23 sing N N 361 THR OXT HXT sing N N 362 TRP N CA sing N N 363 TRP N H sing N N 364 TRP N H2 sing N N 365 TRP CA C sing N N 366 TRP CA CB sing N N 367 TRP CA HA sing N N 368 TRP C O doub N N 369 TRP C OXT sing N N 370 TRP CB CG sing N N 371 TRP CB HB2 sing N N 372 TRP CB HB3 sing N N 373 TRP CG CD1 doub Y N 374 TRP CG CD2 sing Y N 375 TRP CD1 NE1 sing Y N 376 TRP CD1 HD1 sing N N 377 TRP CD2 CE2 doub Y N 378 TRP CD2 CE3 sing Y N 379 TRP NE1 CE2 sing Y N 380 TRP NE1 HE1 sing N N 381 TRP CE2 CZ2 sing Y N 382 TRP CE3 CZ3 doub Y N 383 TRP CE3 HE3 sing N N 384 TRP CZ2 CH2 doub Y N 385 TRP CZ2 HZ2 sing N N 386 TRP CZ3 CH2 sing Y N 387 TRP CZ3 HZ3 sing N N 388 TRP CH2 HH2 sing N N 389 TRP OXT HXT sing N N 390 TYR N CA sing N N 391 TYR N H sing N N 392 TYR N H2 sing N N 393 TYR CA C sing N N 394 TYR CA CB sing N N 395 TYR CA HA sing N N 396 TYR C O doub N N 397 TYR C OXT sing N N 398 TYR CB CG sing N N 399 TYR CB HB2 sing N N 400 TYR CB HB3 sing N N 401 TYR CG CD1 doub Y N 402 TYR CG CD2 sing Y N 403 TYR CD1 CE1 sing Y N 404 TYR CD1 HD1 sing N N 405 TYR CD2 CE2 doub Y N 406 TYR CD2 HD2 sing N N 407 TYR CE1 CZ doub Y N 408 TYR CE1 HE1 sing N N 409 TYR CE2 CZ sing Y N 410 TYR CE2 HE2 sing N N 411 TYR CZ OH sing N N 412 TYR OH HH sing N N 413 TYR OXT HXT sing N N 414 VAL N CA sing N N 415 VAL N H sing N N 416 VAL N H2 sing N N 417 VAL CA C sing N N 418 VAL CA CB sing N N 419 VAL CA HA sing N N 420 VAL C O doub N N 421 VAL C OXT sing N N 422 VAL CB CG1 sing N N 423 VAL CB CG2 sing N N 424 VAL CB HB sing N N 425 VAL CG1 HG11 sing N N 426 VAL CG1 HG12 sing N N 427 VAL CG1 HG13 sing N N 428 VAL CG2 HG21 sing N N 429 VAL CG2 HG22 sing N N 430 VAL CG2 HG23 sing N N 431 VAL OXT HXT sing N N 432 # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 8RPO _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9GIT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.024796 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004829 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023335 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023617 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL F N O S # loop_ # loop_ #