data_11CI # _entry.id 11CI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.414 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 11CI pdb_000011ci 10.2210/pdb11ci/pdb WWPDB D_1000305254 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-05-06 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 11CI _pdbx_database_status.recvd_initial_deposition_date 2026-02-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 gavinpalowitch@gmail.com Gavin Palowitch M 'principal investigator/group leader' 0000-0003-0283-7894 3 charlie.dulberger@gmail.com Charles Dulberger ? 'principal investigator/group leader' 0000-0002-1334-5468 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Miller, H.A.' 1 0009-0008-9087-7864 'Palowitch, G.M.' 2 0000-0003-0283-7894 'Dulberger, C.L.' 3 0000-0002-1334-5468 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biorxiv _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2692-8205 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Multi-dimensional optimization of a lysin towards a ribolysin against life-threatening S. aureus infections: Fc-LysM-CHAP and its strong synergy with standard of care antibiotics ; _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.64898/2026.04.27.720530 _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Badarau, A.' 1 ? primary 'Bauer, B.' 2 ? primary 'Visram, Z.' 3 ? primary 'Qiao, R.' 4 ? primary 'Majoros-Hashempour, A.' 5 ? primary 'Sollner, J.' 6 ? primary 'Durica-Mitic, S.' 7 ? primary 'Dunne, O.M.' 8 ? primary 'Kluj, R.' 9 ? primary 'Kestemont, D.' 10 ? primary 'Kieninger, A.K.' 11 ? primary 'Kulig, M.' 12 ? primary 'Berdaguer, R.' 13 ? primary 'Schwebs, T.' 14 ? primary 'Zerbs, M.' 15 ? primary 'Czermak, P.' 16 ? primary 'von Freyberg, M.' 17 ? primary 'Schmidt, J.' 18 ? primary 'Schmidberger, L.' 19 ? primary 'Mayer, D.' 20 ? primary 'Protano, M.' 21 ? primary 'Miller, H.A.' 22 ? primary 'Palowitch, G.M.' 23 ? primary 'Dulberger, C.L.' 24 ? primary 'Massaro, M.' 25 ? primary 'Ivanisenko, N.' 26 ? primary 'Jacomet, H.' 27 ? primary 'Ngatcha Bakoue, D.' 28 ? primary 'Oteri, F.' 29 ? primary 'Sela, G.' 30 ? primary 'Corsini, L.' 31 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Probable cell wall hydrolase LytN' 24122.004 1 3.-.-.- ? ? ? 2 non-polymer syn ;N~2~-acetyl-N~6~-{(4M)-3-carboxy-4-[(10aR)-6-hydroxy-3-oxo-4,10a-dihydro-3H-xanthen-9-yl]benzene-1-carbonyl}-D-lysyl-L-alanyl-D-alpha-glutaminyl-N-[(2R)-3-oxobutan-2-yl]-L-lysinamide ; 943.009 1 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 water nat water 18.015 4 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;REAPKTQIYTVKKGDTLSAIALKYKTTVSNIQNTNNIANPNLIFIGQKLKVPMTPLVEPKPETVSGNEKSNSGSSTLNYL KSLEGKGWDFDGSFGWQCFDLVNVYWNHLYGHGLKGYYAKDIPYANNFNSEAKIYHNTPTFKAEPGDLVVFSGRYGGGYG HTAIVLNGNYDGNLQKFQSLDQNWNGGGERKQEVAHKVVHNYENDMIFIRPFKKA ; _entity_poly.pdbx_seq_one_letter_code_can ;REAPKTQIYTVKKGDTLSAIALKYKTTVSNIQNTNNIANPNLIFIGQKLKVPMTPLVEPKPETVSGNEKSNSGSSTLNYL KSLEGKGWDFDGSFGWQCFDLVNVYWNHLYGHGLKGYYAKDIPYANNFNSEAKIYHNTPTFKAEPGDLVVFSGRYGGGYG HTAIVLNGNYDGNLQKFQSLDQNWNGGGERKQEVAHKVVHNYENDMIFIRPFKKA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;N~2~-acetyl-N~6~-{(4M)-3-carboxy-4-[(10aR)-6-hydroxy-3-oxo-4,10a-dihydro-3H-xanthen-9-yl]benzene-1-carbonyl}-D-lysyl-L-alanyl-D-alpha-glutaminyl-N-[(2R)-3-oxobutan-2-yl]-L-lysinamide ; A1DEZ 3 'SODIUM ION' NA 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 GLU n 1 3 ALA n 1 4 PRO n 1 5 LYS n 1 6 THR n 1 7 GLN n 1 8 ILE n 1 9 TYR n 1 10 THR n 1 11 VAL n 1 12 LYS n 1 13 LYS n 1 14 GLY n 1 15 ASP n 1 16 THR n 1 17 LEU n 1 18 SER n 1 19 ALA n 1 20 ILE n 1 21 ALA n 1 22 LEU n 1 23 LYS n 1 24 TYR n 1 25 LYS n 1 26 THR n 1 27 THR n 1 28 VAL n 1 29 SER n 1 30 ASN n 1 31 ILE n 1 32 GLN n 1 33 ASN n 1 34 THR n 1 35 ASN n 1 36 ASN n 1 37 ILE n 1 38 ALA n 1 39 ASN n 1 40 PRO n 1 41 ASN n 1 42 LEU n 1 43 ILE n 1 44 PHE n 1 45 ILE n 1 46 GLY n 1 47 GLN n 1 48 LYS n 1 49 LEU n 1 50 LYS n 1 51 VAL n 1 52 PRO n 1 53 MET n 1 54 THR n 1 55 PRO n 1 56 LEU n 1 57 VAL n 1 58 GLU n 1 59 PRO n 1 60 LYS n 1 61 PRO n 1 62 GLU n 1 63 THR n 1 64 VAL n 1 65 SER n 1 66 GLY n 1 67 ASN n 1 68 GLU n 1 69 LYS n 1 70 SER n 1 71 ASN n 1 72 SER n 1 73 GLY n 1 74 SER n 1 75 SER n 1 76 THR n 1 77 LEU n 1 78 ASN n 1 79 TYR n 1 80 LEU n 1 81 LYS n 1 82 SER n 1 83 LEU n 1 84 GLU n 1 85 GLY n 1 86 LYS n 1 87 GLY n 1 88 TRP n 1 89 ASP n 1 90 PHE n 1 91 ASP n 1 92 GLY n 1 93 SER n 1 94 PHE n 1 95 GLY n 1 96 TRP n 1 97 GLN n 1 98 CYS n 1 99 PHE n 1 100 ASP n 1 101 LEU n 1 102 VAL n 1 103 ASN n 1 104 VAL n 1 105 TYR n 1 106 TRP n 1 107 ASN n 1 108 HIS n 1 109 LEU n 1 110 TYR n 1 111 GLY n 1 112 HIS n 1 113 GLY n 1 114 LEU n 1 115 LYS n 1 116 GLY n 1 117 TYR n 1 118 TYR n 1 119 ALA n 1 120 LYS n 1 121 ASP n 1 122 ILE n 1 123 PRO n 1 124 TYR n 1 125 ALA n 1 126 ASN n 1 127 ASN n 1 128 PHE n 1 129 ASN n 1 130 SER n 1 131 GLU n 1 132 ALA n 1 133 LYS n 1 134 ILE n 1 135 TYR n 1 136 HIS n 1 137 ASN n 1 138 THR n 1 139 PRO n 1 140 THR n 1 141 PHE n 1 142 LYS n 1 143 ALA n 1 144 GLU n 1 145 PRO n 1 146 GLY n 1 147 ASP n 1 148 LEU n 1 149 VAL n 1 150 VAL n 1 151 PHE n 1 152 SER n 1 153 GLY n 1 154 ARG n 1 155 TYR n 1 156 GLY n 1 157 GLY n 1 158 GLY n 1 159 TYR n 1 160 GLY n 1 161 HIS n 1 162 THR n 1 163 ALA n 1 164 ILE n 1 165 VAL n 1 166 LEU n 1 167 ASN n 1 168 GLY n 1 169 ASN n 1 170 TYR n 1 171 ASP n 1 172 GLY n 1 173 ASN n 1 174 LEU n 1 175 GLN n 1 176 LYS n 1 177 PHE n 1 178 GLN n 1 179 SER n 1 180 LEU n 1 181 ASP n 1 182 GLN n 1 183 ASN n 1 184 TRP n 1 185 ASN n 1 186 GLY n 1 187 GLY n 1 188 GLY n 1 189 GLU n 1 190 ARG n 1 191 LYS n 1 192 GLN n 1 193 GLU n 1 194 VAL n 1 195 ALA n 1 196 HIS n 1 197 LYS n 1 198 VAL n 1 199 VAL n 1 200 HIS n 1 201 ASN n 1 202 TYR n 1 203 GLU n 1 204 ASN n 1 205 ASP n 1 206 MET n 1 207 ILE n 1 208 PHE n 1 209 ILE n 1 210 ARG n 1 211 PRO n 1 212 PHE n 1 213 LYS n 1 214 LYS n 1 215 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 215 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'lytN, SAS1181' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1DEZ non-polymer . ;N~2~-acetyl-N~6~-{(4M)-3-carboxy-4-[(10aR)-6-hydroxy-3-oxo-4,10a-dihydro-3H-xanthen-9-yl]benzene-1-carbonyl}-D-lysyl-L-alanyl-D-alpha-glutaminyl-N-[(2R)-3-oxobutan-2-yl]-L-lysinamide ; ? 'C47 H58 N8 O13' 943.009 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 MET 53 53 ? ? ? A . n A 1 54 THR 54 54 ? ? ? A . n A 1 55 PRO 55 55 ? ? ? A . n A 1 56 LEU 56 56 ? ? ? A . n A 1 57 VAL 57 57 ? ? ? A . n A 1 58 GLU 58 58 ? ? ? A . n A 1 59 PRO 59 59 ? ? ? A . n A 1 60 LYS 60 60 ? ? ? A . n A 1 61 PRO 61 61 ? ? ? A . n A 1 62 GLU 62 62 ? ? ? A . n A 1 63 THR 63 63 ? ? ? A . n A 1 64 VAL 64 64 ? ? ? A . n A 1 65 SER 65 65 ? ? ? A . n A 1 66 GLY 66 66 ? ? ? A . n A 1 67 ASN 67 67 ? ? ? A . n A 1 68 GLU 68 68 ? ? ? A . n A 1 69 LYS 69 69 ? ? ? A . n A 1 70 SER 70 70 ? ? ? A . n A 1 71 ASN 71 71 ? ? ? A . n A 1 72 SER 72 72 ? ? ? A . n A 1 73 GLY 73 73 ? ? ? A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 TRP 88 88 88 TRP TRP A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 TRP 106 106 106 TRP TRP A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 TYR 135 135 135 TYR TYR A . n A 1 136 HIS 136 136 136 HIS HIS A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 TYR 155 155 155 TYR TYR A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 TYR 159 159 159 TYR TYR A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 HIS 161 161 161 HIS HIS A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 ASN 167 167 167 ASN ASN A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 ASN 169 169 169 ASN ASN A . n A 1 170 TYR 170 170 170 TYR TYR A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 GLN 175 175 175 GLN GLN A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 PHE 177 177 177 PHE PHE A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 GLN 182 182 182 GLN GLN A . n A 1 183 ASN 183 183 183 ASN ASN A . n A 1 184 TRP 184 184 184 TRP TRP A . n A 1 185 ASN 185 185 185 ASN ASN A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 GLY 188 188 188 GLY GLY A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 GLN 192 192 192 GLN GLN A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 HIS 196 196 196 HIS HIS A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 HIS 200 200 200 HIS HIS A . n A 1 201 ASN 201 201 201 ASN ASN A . n A 1 202 TYR 202 202 202 TYR TYR A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 ASN 204 204 204 ASN ASN A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 MET 206 206 206 MET MET A . n A 1 207 ILE 207 207 207 ILE ILE A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 ILE 209 209 209 ILE ILE A . n A 1 210 ARG 210 210 210 ARG ARG A . n A 1 211 PRO 211 211 211 PRO PRO A . n A 1 212 PHE 212 212 212 PHE PHE A . n A 1 213 LYS 213 213 213 LYS LYS A . n A 1 214 LYS 214 214 214 LYS LYS A . n A 1 215 ALA 215 215 215 ALA ALA A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1DEZ _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1DEZ _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1DEZ 1 301 270 A1DEZ LIG A . C 3 NA 1 302 1 NA NA A . D 4 HOH 1 401 3 HOH HOH A . D 4 HOH 2 402 2 HOH HOH A . D 4 HOH 3 403 4 HOH HOH A . D 4 HOH 4 404 1 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 12 ? CG ? A LYS 12 CG 2 1 Y 1 A LYS 12 ? CD ? A LYS 12 CD 3 1 Y 1 A LYS 12 ? CE ? A LYS 12 CE 4 1 Y 1 A LYS 12 ? NZ ? A LYS 12 NZ 5 1 Y 1 A LYS 23 ? CG ? A LYS 23 CG 6 1 Y 1 A LYS 23 ? CD ? A LYS 23 CD 7 1 Y 1 A LYS 23 ? CE ? A LYS 23 CE 8 1 Y 1 A LYS 23 ? NZ ? A LYS 23 NZ 9 1 Y 1 A LYS 25 ? CG ? A LYS 25 CG 10 1 Y 1 A LYS 25 ? CD ? A LYS 25 CD 11 1 Y 1 A LYS 25 ? CE ? A LYS 25 CE 12 1 Y 1 A LYS 25 ? NZ ? A LYS 25 NZ 13 1 Y 1 A SER 29 ? OG ? A SER 29 OG 14 1 Y 1 A ASN 36 ? CG ? A ASN 36 CG 15 1 Y 1 A ASN 36 ? OD1 ? A ASN 36 OD1 16 1 Y 1 A ASN 36 ? ND2 ? A ASN 36 ND2 17 1 Y 1 A LEU 42 ? CG ? A LEU 42 CG 18 1 Y 1 A LEU 42 ? CD1 ? A LEU 42 CD1 19 1 Y 1 A LEU 42 ? CD2 ? A LEU 42 CD2 20 1 Y 1 A LYS 48 ? CG ? A LYS 48 CG 21 1 Y 1 A LYS 48 ? CD ? A LYS 48 CD 22 1 Y 1 A LYS 48 ? CE ? A LYS 48 CE 23 1 Y 1 A LYS 48 ? NZ ? A LYS 48 NZ 24 1 Y 1 A LYS 50 ? CG ? A LYS 50 CG 25 1 Y 1 A LYS 50 ? CD ? A LYS 50 CD 26 1 Y 1 A LYS 50 ? CE ? A LYS 50 CE 27 1 Y 1 A LYS 50 ? NZ ? A LYS 50 NZ 28 1 Y 1 A LYS 214 ? CG ? A LYS 214 CG 29 1 Y 1 A LYS 214 ? CD ? A LYS 214 CD 30 1 Y 1 A LYS 214 ? CE ? A LYS 214 CE 31 1 Y 1 A LYS 214 ? NZ ? A LYS 214 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0430 ? 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . ? 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 11CI _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.994 _cell.length_a_esd ? _cell.length_b 135.046 _cell.length_b_esd ? _cell.length_c 57.626 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 11CI _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 11CI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% PEG MME 5000, 0.1 M TRIS pH 8.5, 0.2 M lithium sulfate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-12-09 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97625 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P13 (MX1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97625 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P13 (MX1)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 11CI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.83 _reflns.d_resolution_low 30.03 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6204 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.194 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.971 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.335 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.83 _reflns_shell.d_res_low 2.90 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 481 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 1.755 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.571 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.517 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -3.82 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 6.65 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -2.83 _refine.B_iso_max ? _refine.B_iso_mean 35.236 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.893 _refine.correlation_coeff_Fo_to_Fc_free 0.860 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 11CI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.83 _refine.ls_d_res_low 30.01 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6204 _refine.ls_number_reflns_R_free 310 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.40 _refine.ls_percent_reflns_R_free 4.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.25698 _refine.ls_R_factor_R_free 0.27763 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.25592 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.400 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 23.121 _refine.overall_SU_ML 0.405 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.83 _refine_hist.d_res_low 30.01 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 1555 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1550 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 0.012 1595 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 1410 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 0.711 1.797 2168 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.279 1.757 3219 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 5.348 5.000 187 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 33.509 11.000 15 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 10.185 10.000 223 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_dihedral_angle_4_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.032 0.200 219 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1938 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 405 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? ? 'X-RAY DIFFRACTION' ? 0.336 3.667 754 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 0.336 3.667 754 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 0.634 6.590 939 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 0.634 6.589 940 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 0.434 3.767 841 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 0.434 3.767 842 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 0.805 6.970 1230 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 2.144 37.50 1772 ? r_long_range_B_refined ? ? ? 'X-RAY DIFFRACTION' ? 2.143 37.54 1773 ? r_long_range_B_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.83 _refine_ls_shell.d_res_low 2.901 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 19 _refine_ls_shell.number_reflns_R_work 450 _refine_ls_shell.percent_reflns_obs 98.32 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.385 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.correlation_coeff_Fo_to_Fc ? _refine_ls_shell.correlation_coeff_Fo_to_Fc_free ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.288 # _struct.entry_id 11CI _struct.title 'Staphylococcus aureus-specific lysin L1-3 (LysM-CHAP) covalently complexed to Pep1a-CMK substrate mimic' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 11CI _struct_keywords.text 'lysin, CHAP, enzyme, peptidoglycan, bacteria, phage, LysM, endopeptidase, inhibitor, substrate, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LYTN_STAAS _struct_ref.pdbx_db_accession Q6G9W6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;REAPKTQIYTVKKGDTLSAIALKYKTTVSNIQNTNNIANPNLIFIGQKLKVPMTPLVEPKPKTVSSNNKSNSNSSTLNYL KTLENRGWDFDGSYGWQCFDLVNVYWNHLYGHGLKGYGAKDIPYANNFNSEAKIYHNTPTFKAEPGDLVVFSGRFGGGYG HTAIVLNGDYDGKLMKFQSLDQNWNNGGWRKAEVAHKVVHNYENDMIFIRPFKKA ; _struct_ref.pdbx_align_begin 169 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 11CI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 215 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6G9W6 _struct_ref_seq.db_align_beg 169 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 383 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 215 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 11CI GLU A 62 ? UNP Q6G9W6 LYS 230 conflict 62 1 1 11CI GLY A 66 ? UNP Q6G9W6 SER 234 conflict 66 2 1 11CI GLU A 68 ? UNP Q6G9W6 ASN 236 conflict 68 3 1 11CI GLY A 73 ? UNP Q6G9W6 ASN 241 conflict 73 4 1 11CI SER A 82 ? UNP Q6G9W6 THR 250 conflict 82 5 1 11CI GLY A 85 ? UNP Q6G9W6 ASN 253 conflict 85 6 1 11CI LYS A 86 ? UNP Q6G9W6 ARG 254 conflict 86 7 1 11CI PHE A 94 ? UNP Q6G9W6 TYR 262 conflict 94 8 1 11CI TYR A 118 ? UNP Q6G9W6 GLY 286 conflict 118 9 1 11CI TYR A 155 ? UNP Q6G9W6 PHE 323 conflict 155 10 1 11CI ASN A 169 ? UNP Q6G9W6 ASP 337 conflict 169 11 1 11CI ASN A 173 ? UNP Q6G9W6 LYS 341 conflict 173 12 1 11CI GLN A 175 ? UNP Q6G9W6 MET 343 conflict 175 13 1 11CI GLY A 186 ? UNP Q6G9W6 ASN 354 conflict 186 14 1 11CI GLU A 189 ? UNP Q6G9W6 TRP 357 conflict 189 15 1 11CI GLN A 192 ? UNP Q6G9W6 ALA 360 conflict 192 16 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 16 ? TYR A 24 ? THR A 16 TYR A 24 1 ? 9 HELX_P HELX_P2 AA2 THR A 27 ? ASN A 35 ? THR A 27 ASN A 35 1 ? 9 HELX_P HELX_P3 AA3 SER A 75 ? GLU A 84 ? SER A 75 GLU A 84 1 ? 10 HELX_P HELX_P4 AA4 GLN A 97 ? GLY A 111 ? GLN A 97 GLY A 111 1 ? 15 HELX_P HELX_P5 AA5 TYR A 118 ? ILE A 122 ? TYR A 118 ILE A 122 5 ? 5 HELX_P HELX_P6 AA6 TYR A 155 ? TYR A 159 ? TYR A 155 TYR A 159 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 98 SG ? ? ? 1_555 B A1DEZ . C47 ? ? A CYS 98 A A1DEZ 301 1_555 ? ? ? ? ? ? ? 1.781 ? ? metalc1 metalc ? ? A ASP 89 OD1 ? ? ? 1_555 C NA . NA ? ? A ASP 89 A NA 302 1_555 ? ? ? ? ? ? ? 2.930 ? ? metalc2 metalc ? ? A ASP 91 OD1 ? ? ? 1_555 C NA . NA ? ? A ASP 91 A NA 302 1_555 ? ? ? ? ? ? ? 2.723 ? ? metalc3 metalc ? ? A SER 93 O ? ? ? 1_555 C NA . NA ? ? A SER 93 A NA 302 1_555 ? ? ? ? ? ? ? 2.117 ? ? metalc4 metalc ? ? A GLY 95 O ? ? ? 1_555 C NA . NA ? ? A GLY 95 A NA 302 1_555 ? ? ? ? ? ? ? 2.916 ? ? metalc5 metalc ? ? A ASP 100 OD1 ? ? ? 1_555 C NA . NA ? ? A ASP 100 A NA 302 1_555 ? ? ? ? ? ? ? 2.601 ? ? metalc6 metalc ? ? A ASP 100 OD2 ? ? ? 1_555 C NA . NA ? ? A ASP 100 A NA 302 1_555 ? ? ? ? ? ? ? 2.383 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 67.6 ? 2 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 O ? A SER 93 ? A SER 93 ? 1_555 81.9 ? 3 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 O ? A SER 93 ? A SER 93 ? 1_555 76.2 ? 4 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 O ? A GLY 95 ? A GLY 95 ? 1_555 63.2 ? 5 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 O ? A GLY 95 ? A GLY 95 ? 1_555 129.1 ? 6 O ? A SER 93 ? A SER 93 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 O ? A GLY 95 ? A GLY 95 ? 1_555 84.5 ? 7 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 OD1 ? A ASP 100 ? A ASP 100 ? 1_555 73.9 ? 8 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 OD1 ? A ASP 100 ? A ASP 100 ? 1_555 75.1 ? 9 O ? A SER 93 ? A SER 93 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 OD1 ? A ASP 100 ? A ASP 100 ? 1_555 147.8 ? 10 O ? A GLY 95 ? A GLY 95 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 OD1 ? A ASP 100 ? A ASP 100 ? 1_555 102.6 ? 11 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 OD2 ? A ASP 100 ? A ASP 100 ? 1_555 92.2 ? 12 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 OD2 ? A ASP 100 ? A ASP 100 ? 1_555 127.3 ? 13 O ? A SER 93 ? A SER 93 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 OD2 ? A ASP 100 ? A ASP 100 ? 1_555 151.4 ? 14 O ? A GLY 95 ? A GLY 95 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 OD2 ? A ASP 100 ? A ASP 100 ? 1_555 68.0 ? 15 OD1 ? A ASP 100 ? A ASP 100 ? 1_555 NA ? C NA . ? A NA 302 ? 1_555 OD2 ? A ASP 100 ? A ASP 100 ? 1_555 52.3 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id A1DEZ _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 98 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id A1DEZ _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 301 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 98 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C47 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id A1DEZ _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 7 ? THR A 10 ? GLN A 7 THR A 10 AA1 2 LYS A 48 ? VAL A 51 ? LYS A 48 VAL A 51 AA2 1 ALA A 132 ? HIS A 136 ? ALA A 132 HIS A 136 AA2 2 ILE A 207 ? PRO A 211 ? ILE A 207 PRO A 211 AA2 3 LEU A 148 ? VAL A 150 ? LEU A 148 VAL A 150 AA2 4 THR A 162 ? ASN A 167 ? THR A 162 ASN A 167 AA2 5 LYS A 176 ? ASP A 181 ? LYS A 176 ASP A 181 AA2 6 HIS A 196 ? ASN A 201 ? HIS A 196 ASN A 201 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 9 ? N TYR A 9 O LEU A 49 ? O LEU A 49 AA2 1 2 N TYR A 135 ? N TYR A 135 O PHE A 208 ? O PHE A 208 AA2 2 3 O ILE A 209 ? O ILE A 209 N LEU A 148 ? N LEU A 148 AA2 3 4 N VAL A 149 ? N VAL A 149 O ALA A 163 ? O ALA A 163 AA2 4 5 N ILE A 164 ? N ILE A 164 O LEU A 180 ? O LEU A 180 AA2 5 6 N PHE A 177 ? N PHE A 177 O HIS A 200 ? O HIS A 200 # _pdbx_entry_details.entry_id 11CI _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 41 ? ? -100.99 40.29 2 1 PHE A 128 ? ? -106.76 50.02 3 1 ASN A 169 ? ? -153.54 71.94 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 1 ? A ARG 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A MET 53 ? A MET 53 7 1 Y 1 A THR 54 ? A THR 54 8 1 Y 1 A PRO 55 ? A PRO 55 9 1 Y 1 A LEU 56 ? A LEU 56 10 1 Y 1 A VAL 57 ? A VAL 57 11 1 Y 1 A GLU 58 ? A GLU 58 12 1 Y 1 A PRO 59 ? A PRO 59 13 1 Y 1 A LYS 60 ? A LYS 60 14 1 Y 1 A PRO 61 ? A PRO 61 15 1 Y 1 A GLU 62 ? A GLU 62 16 1 Y 1 A THR 63 ? A THR 63 17 1 Y 1 A VAL 64 ? A VAL 64 18 1 Y 1 A SER 65 ? A SER 65 19 1 Y 1 A GLY 66 ? A GLY 66 20 1 Y 1 A ASN 67 ? A ASN 67 21 1 Y 1 A GLU 68 ? A GLU 68 22 1 Y 1 A LYS 69 ? A LYS 69 23 1 Y 1 A SER 70 ? A SER 70 24 1 Y 1 A ASN 71 ? A ASN 71 25 1 Y 1 A SER 72 ? A SER 72 26 1 Y 1 A GLY 73 ? A GLY 73 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1DEZ N1 N N N 1 A1DEZ N3 N N N 2 A1DEZ C4 C N S 3 A1DEZ C5 C N N 4 A1DEZ C6 C N N 5 A1DEZ C7 C N N 6 A1DEZ C8 C N N 7 A1DEZ C10 C N N 8 A1DEZ C13 C N N 9 A1DEZ C15 C N N 10 A1DEZ C17 C N R 11 A1DEZ C20 C N N 12 A1DEZ C21 C N N 13 A1DEZ C22 C N N 14 A1DEZ C24 C Y N 15 A1DEZ C26 C Y N 16 A1DEZ C28 C Y N 17 A1DEZ C1 C N N 18 A1DEZ C2 C N R 19 A1DEZ C3 C N N 20 A1DEZ O1 O N N 21 A1DEZ N2 N N N 22 A1DEZ C9 C N N 23 A1DEZ O2 O N N 24 A1DEZ C11 C N N 25 A1DEZ C12 C N R 26 A1DEZ N4 N N N 27 A1DEZ O3 O N N 28 A1DEZ C14 C N S 29 A1DEZ N5 N N N 30 A1DEZ C16 C N N 31 A1DEZ O4 O N N 32 A1DEZ C18 C N N 33 A1DEZ C19 C N N 34 A1DEZ N6 N N N 35 A1DEZ O5 O N N 36 A1DEZ C23 C Y N 37 A1DEZ C25 C Y N 38 A1DEZ C27 C Y N 39 A1DEZ C29 C N N 40 A1DEZ O6 O N N 41 A1DEZ O7 O N N 42 A1DEZ C30 C N N 43 A1DEZ C31 C N N 44 A1DEZ C32 C N N 45 A1DEZ C33 C N N 46 A1DEZ C34 C N N 47 A1DEZ O8 O N N 48 A1DEZ C35 C N N 49 A1DEZ C36 C N N 50 A1DEZ O9 O N N 51 A1DEZ C37 C Y N 52 A1DEZ C38 C Y N 53 A1DEZ C39 C Y N 54 A1DEZ C40 C Y N 55 A1DEZ C41 C Y N 56 A1DEZ O10 O N N 57 A1DEZ C42 C Y N 58 A1DEZ N7 N N N 59 A1DEZ C43 C N N 60 A1DEZ C44 C N N 61 A1DEZ O11 O N N 62 A1DEZ C45 C N N 63 A1DEZ N8 N N N 64 A1DEZ O12 O N N 65 A1DEZ C46 C N N 66 A1DEZ C47 C N N 67 A1DEZ O13 O N N 68 A1DEZ H1 H N N 69 A1DEZ H2 H N N 70 A1DEZ H3 H N N 71 A1DEZ H4 H N N 72 A1DEZ H5 H N N 73 A1DEZ H6 H N N 74 A1DEZ H7 H N N 75 A1DEZ H8 H N N 76 A1DEZ H9 H N N 77 A1DEZ H10 H N N 78 A1DEZ H11 H N N 79 A1DEZ H12 H N N 80 A1DEZ H13 H N N 81 A1DEZ H14 H N N 82 A1DEZ H15 H N N 83 A1DEZ H16 H N N 84 A1DEZ H17 H N N 85 A1DEZ H18 H N N 86 A1DEZ H19 H N N 87 A1DEZ H20 H N N 88 A1DEZ H21 H N N 89 A1DEZ H22 H N N 90 A1DEZ H23 H N N 91 A1DEZ H24 H N N 92 A1DEZ H25 H N N 93 A1DEZ H26 H N N 94 A1DEZ H27 H N N 95 A1DEZ H28 H N N 96 A1DEZ H29 H N N 97 A1DEZ H31 H N N 98 A1DEZ H32 H N N 99 A1DEZ H33 H N N 100 A1DEZ H34 H N N 101 A1DEZ H35 H N N 102 A1DEZ H36 H N N 103 A1DEZ H37 H N N 104 A1DEZ H38 H N N 105 A1DEZ H39 H N N 106 A1DEZ H40 H N N 107 A1DEZ H41 H N N 108 A1DEZ H42 H N N 109 A1DEZ H43 H N N 110 A1DEZ H44 H N N 111 A1DEZ H45 H N N 112 A1DEZ H46 H N N 113 A1DEZ H48 H N N 114 A1DEZ H49 H N N 115 A1DEZ H50 H N N 116 A1DEZ H51 H N N 117 A1DEZ H52 H N N 118 A1DEZ H53 H N N 119 A1DEZ H54 H N N 120 A1DEZ H55 H N N 121 A1DEZ H56 H N N 122 A1DEZ H57 H N N 123 A1DEZ H58 H N N 124 A1DEZ H59 H N N 125 A1DEZ H60 H N N 126 ALA N N N N 127 ALA CA C N S 128 ALA C C N N 129 ALA O O N N 130 ALA CB C N N 131 ALA OXT O N N 132 ALA H H N N 133 ALA H2 H N N 134 ALA HA H N N 135 ALA HB1 H N N 136 ALA HB2 H N N 137 ALA HB3 H N N 138 ALA HXT H N N 139 ARG N N N N 140 ARG CA C N S 141 ARG C C N N 142 ARG O O N N 143 ARG CB C N N 144 ARG CG C N N 145 ARG CD C N N 146 ARG NE N N N 147 ARG CZ C N N 148 ARG NH1 N N N 149 ARG NH2 N N N 150 ARG OXT O N N 151 ARG H H N N 152 ARG H2 H N N 153 ARG HA H N N 154 ARG HB2 H N N 155 ARG HB3 H N N 156 ARG HG2 H N N 157 ARG HG3 H N N 158 ARG HD2 H N N 159 ARG HD3 H N N 160 ARG HE H N N 161 ARG HH11 H N N 162 ARG HH12 H N N 163 ARG HH21 H N N 164 ARG HH22 H N N 165 ARG HXT H N N 166 ASN N N N N 167 ASN CA C N S 168 ASN C C N N 169 ASN O O N N 170 ASN CB C N N 171 ASN CG C N N 172 ASN OD1 O N N 173 ASN ND2 N N N 174 ASN OXT O N N 175 ASN H H N N 176 ASN H2 H N N 177 ASN HA H N N 178 ASN HB2 H N N 179 ASN HB3 H N N 180 ASN HD21 H N N 181 ASN HD22 H N N 182 ASN HXT H N N 183 ASP N N N N 184 ASP CA C N S 185 ASP C C N N 186 ASP O O N N 187 ASP CB C N N 188 ASP CG C N N 189 ASP OD1 O N N 190 ASP OD2 O N N 191 ASP OXT O N N 192 ASP H H N N 193 ASP H2 H N N 194 ASP HA H N N 195 ASP HB2 H N N 196 ASP HB3 H N N 197 ASP HD2 H N N 198 ASP HXT H N N 199 CYS N N N N 200 CYS CA C N R 201 CYS C C N N 202 CYS O O N N 203 CYS CB C N N 204 CYS SG S N N 205 CYS OXT O N N 206 CYS H H N N 207 CYS H2 H N N 208 CYS HA H N N 209 CYS HB2 H N N 210 CYS HB3 H N N 211 CYS HG H N N 212 CYS HXT H N N 213 GLN N N N N 214 GLN CA C N S 215 GLN C C N N 216 GLN O O N N 217 GLN CB C N N 218 GLN CG C N N 219 GLN CD C N N 220 GLN OE1 O N N 221 GLN NE2 N N N 222 GLN OXT O N N 223 GLN H H N N 224 GLN H2 H N N 225 GLN HA H N N 226 GLN HB2 H N N 227 GLN HB3 H N N 228 GLN HG2 H N N 229 GLN HG3 H N N 230 GLN HE21 H N N 231 GLN HE22 H N N 232 GLN HXT H N N 233 GLU N N N N 234 GLU CA C N S 235 GLU C C N N 236 GLU O O N N 237 GLU CB C N N 238 GLU CG C N N 239 GLU CD C N N 240 GLU OE1 O N N 241 GLU OE2 O N N 242 GLU OXT O N N 243 GLU H H N N 244 GLU H2 H N N 245 GLU HA H N N 246 GLU HB2 H N N 247 GLU HB3 H N N 248 GLU HG2 H N N 249 GLU HG3 H N N 250 GLU HE2 H N N 251 GLU HXT H N N 252 GLY N N N N 253 GLY CA C N N 254 GLY C C N N 255 GLY O O N N 256 GLY OXT O N N 257 GLY H H N N 258 GLY H2 H N N 259 GLY HA2 H N N 260 GLY HA3 H N N 261 GLY HXT H N N 262 HIS N N N N 263 HIS CA C N S 264 HIS C C N N 265 HIS O O N N 266 HIS CB C N N 267 HIS CG C Y N 268 HIS ND1 N Y N 269 HIS CD2 C Y N 270 HIS CE1 C Y N 271 HIS NE2 N Y N 272 HIS OXT O N N 273 HIS H H N N 274 HIS H2 H N N 275 HIS HA H N N 276 HIS HB2 H N N 277 HIS HB3 H N N 278 HIS HD1 H N N 279 HIS HD2 H N N 280 HIS HE1 H N N 281 HIS HE2 H N N 282 HIS HXT H N N 283 HOH O O N N 284 HOH H1 H N N 285 HOH H2 H N N 286 ILE N N N N 287 ILE CA C N S 288 ILE C C N N 289 ILE O O N N 290 ILE CB C N S 291 ILE CG1 C N N 292 ILE CG2 C N N 293 ILE CD1 C N N 294 ILE OXT O N N 295 ILE H H N N 296 ILE H2 H N N 297 ILE HA H N N 298 ILE HB H N N 299 ILE HG12 H N N 300 ILE HG13 H N N 301 ILE HG21 H N N 302 ILE HG22 H N N 303 ILE HG23 H N N 304 ILE HD11 H N N 305 ILE HD12 H N N 306 ILE HD13 H N N 307 ILE HXT H N N 308 LEU N N N N 309 LEU CA C N S 310 LEU C C N N 311 LEU O O N N 312 LEU CB C N N 313 LEU CG C N N 314 LEU CD1 C N N 315 LEU CD2 C N N 316 LEU OXT O N N 317 LEU H H N N 318 LEU H2 H N N 319 LEU HA H N N 320 LEU HB2 H N N 321 LEU HB3 H N N 322 LEU HG H N N 323 LEU HD11 H N N 324 LEU HD12 H N N 325 LEU HD13 H N N 326 LEU HD21 H N N 327 LEU HD22 H N N 328 LEU HD23 H N N 329 LEU HXT H N N 330 LYS N N N N 331 LYS CA C N S 332 LYS C C N N 333 LYS O O N N 334 LYS CB C N N 335 LYS CG C N N 336 LYS CD C N N 337 LYS CE C N N 338 LYS NZ N N N 339 LYS OXT O N N 340 LYS H H N N 341 LYS H2 H N N 342 LYS HA H N N 343 LYS HB2 H N N 344 LYS HB3 H N N 345 LYS HG2 H N N 346 LYS HG3 H N N 347 LYS HD2 H N N 348 LYS HD3 H N N 349 LYS HE2 H N N 350 LYS HE3 H N N 351 LYS HZ1 H N N 352 LYS HZ2 H N N 353 LYS HZ3 H N N 354 LYS HXT H N N 355 MET N N N N 356 MET CA C N S 357 MET C C N N 358 MET O O N N 359 MET CB C N N 360 MET CG C N N 361 MET SD S N N 362 MET CE C N N 363 MET OXT O N N 364 MET H H N N 365 MET H2 H N N 366 MET HA H N N 367 MET HB2 H N N 368 MET HB3 H N N 369 MET HG2 H N N 370 MET HG3 H N N 371 MET HE1 H N N 372 MET HE2 H N N 373 MET HE3 H N N 374 MET HXT H N N 375 NA NA NA N N 376 PHE N N N N 377 PHE CA C N S 378 PHE C C N N 379 PHE O O N N 380 PHE CB C N N 381 PHE CG C Y N 382 PHE CD1 C Y N 383 PHE CD2 C Y N 384 PHE CE1 C Y N 385 PHE CE2 C Y N 386 PHE CZ C Y N 387 PHE OXT O N N 388 PHE H H N N 389 PHE H2 H N N 390 PHE HA H N N 391 PHE HB2 H N N 392 PHE HB3 H N N 393 PHE HD1 H N N 394 PHE HD2 H N N 395 PHE HE1 H N N 396 PHE HE2 H N N 397 PHE HZ H N N 398 PHE HXT H N N 399 PRO N N N N 400 PRO CA C N S 401 PRO C C N N 402 PRO O O N N 403 PRO CB C N N 404 PRO CG C N N 405 PRO CD C N N 406 PRO OXT O N N 407 PRO H H N N 408 PRO HA H N N 409 PRO HB2 H N N 410 PRO HB3 H N N 411 PRO HG2 H N N 412 PRO HG3 H N N 413 PRO HD2 H N N 414 PRO HD3 H N N 415 PRO HXT H N N 416 SER N N N N 417 SER CA C N S 418 SER C C N N 419 SER O O N N 420 SER CB C N N 421 SER OG O N N 422 SER OXT O N N 423 SER H H N N 424 SER H2 H N N 425 SER HA H N N 426 SER HB2 H N N 427 SER HB3 H N N 428 SER HG H N N 429 SER HXT H N N 430 THR N N N N 431 THR CA C N S 432 THR C C N N 433 THR O O N N 434 THR CB C N R 435 THR OG1 O N N 436 THR CG2 C N N 437 THR OXT O N N 438 THR H H N N 439 THR H2 H N N 440 THR HA H N N 441 THR HB H N N 442 THR HG1 H N N 443 THR HG21 H N N 444 THR HG22 H N N 445 THR HG23 H N N 446 THR HXT H N N 447 TRP N N N N 448 TRP CA C N S 449 TRP C C N N 450 TRP O O N N 451 TRP CB C N N 452 TRP CG C Y N 453 TRP CD1 C Y N 454 TRP CD2 C Y N 455 TRP NE1 N Y N 456 TRP CE2 C Y N 457 TRP CE3 C Y N 458 TRP CZ2 C Y N 459 TRP CZ3 C Y N 460 TRP CH2 C Y N 461 TRP OXT O N N 462 TRP H H N N 463 TRP H2 H N N 464 TRP HA H N N 465 TRP HB2 H N N 466 TRP HB3 H N N 467 TRP HD1 H N N 468 TRP HE1 H N N 469 TRP HE3 H N N 470 TRP HZ2 H N N 471 TRP HZ3 H N N 472 TRP HH2 H N N 473 TRP HXT H N N 474 TYR N N N N 475 TYR CA C N S 476 TYR C C N N 477 TYR O O N N 478 TYR CB C N N 479 TYR CG C Y N 480 TYR CD1 C Y N 481 TYR CD2 C Y N 482 TYR CE1 C Y N 483 TYR CE2 C Y N 484 TYR CZ C Y N 485 TYR OH O N N 486 TYR OXT O N N 487 TYR H H N N 488 TYR H2 H N N 489 TYR HA H N N 490 TYR HB2 H N N 491 TYR HB3 H N N 492 TYR HD1 H N N 493 TYR HD2 H N N 494 TYR HE1 H N N 495 TYR HE2 H N N 496 TYR HH H N N 497 TYR HXT H N N 498 VAL N N N N 499 VAL CA C N S 500 VAL C C N N 501 VAL O O N N 502 VAL CB C N N 503 VAL CG1 C N N 504 VAL CG2 C N N 505 VAL OXT O N N 506 VAL H H N N 507 VAL H2 H N N 508 VAL HA H N N 509 VAL HB H N N 510 VAL HG11 H N N 511 VAL HG12 H N N 512 VAL HG13 H N N 513 VAL HG21 H N N 514 VAL HG22 H N N 515 VAL HG23 H N N 516 VAL HXT H N N 517 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1DEZ O11 C43 doub N N 1 A1DEZ C43 N7 sing N N 2 A1DEZ C43 C44 sing N N 3 A1DEZ C17 N7 sing N N 4 A1DEZ C17 C18 sing N N 5 A1DEZ C17 C16 sing N N 6 A1DEZ C18 C19 sing N N 7 A1DEZ N5 C16 sing N N 8 A1DEZ N5 C14 sing N N 9 A1DEZ C16 O4 doub N N 10 A1DEZ C15 C14 sing N N 11 A1DEZ C14 C13 sing N N 12 A1DEZ C19 C20 sing N N 13 A1DEZ O5 C22 doub N N 14 A1DEZ N6 C22 sing N N 15 A1DEZ N6 C21 sing N N 16 A1DEZ C22 C23 sing N N 17 A1DEZ N2 C8 sing N N 18 A1DEZ C20 C21 sing N N 19 A1DEZ C13 O3 doub N N 20 A1DEZ C13 N4 sing N N 21 A1DEZ C8 C7 sing N N 22 A1DEZ N4 C12 sing N N 23 A1DEZ C23 C28 doub Y N 24 A1DEZ C23 C24 sing Y N 25 A1DEZ C28 C27 sing Y N 26 A1DEZ O6 C29 doub N N 27 A1DEZ C7 C6 sing N N 28 A1DEZ C29 C27 sing N N 29 A1DEZ C29 O7 sing N N 30 A1DEZ C27 C26 doub Y N 31 A1DEZ C24 C25 doub Y N 32 A1DEZ C12 C45 sing N N 33 A1DEZ C12 C11 sing N N 34 A1DEZ C6 C5 sing N N 35 A1DEZ O12 C45 doub N N 36 A1DEZ C45 N8 sing N N 37 A1DEZ C10 C11 sing N N 38 A1DEZ C10 C9 sing N N 39 A1DEZ O2 C9 doub N N 40 A1DEZ C25 C26 sing Y N 41 A1DEZ C26 C30 sing N N 42 A1DEZ C9 N3 sing N N 43 A1DEZ C5 C4 sing N N 44 A1DEZ N3 C4 sing N N 45 A1DEZ C4 C3 sing N N 46 A1DEZ C30 C38 sing N N 47 A1DEZ C30 C31 doub N N 48 A1DEZ C39 C38 sing Y N 49 A1DEZ C39 C40 doub Y N 50 A1DEZ C32 C31 sing N N 51 A1DEZ C32 C33 doub N N 52 A1DEZ C38 C37 doub Y N 53 A1DEZ C40 C41 sing Y N 54 A1DEZ C31 C36 sing N N 55 A1DEZ C33 C34 sing N N 56 A1DEZ C3 N1 sing N N 57 A1DEZ C3 O1 doub N N 58 A1DEZ N1 C2 sing N N 59 A1DEZ C37 C42 sing Y N 60 A1DEZ C37 O9 sing N N 61 A1DEZ C41 O10 sing N N 62 A1DEZ C41 C42 doub Y N 63 A1DEZ C36 O9 sing N N 64 A1DEZ C36 C35 doub N N 65 A1DEZ C34 C35 sing N N 66 A1DEZ C34 O8 doub N N 67 A1DEZ O13 C46 doub N N 68 A1DEZ C2 C1 sing N N 69 A1DEZ C2 C46 sing N N 70 A1DEZ C46 C47 sing N N 71 A1DEZ N1 H1 sing N N 72 A1DEZ N3 H2 sing N N 73 A1DEZ C4 H3 sing N N 74 A1DEZ C5 H4 sing N N 75 A1DEZ C5 H5 sing N N 76 A1DEZ C6 H6 sing N N 77 A1DEZ C6 H7 sing N N 78 A1DEZ C7 H8 sing N N 79 A1DEZ C7 H9 sing N N 80 A1DEZ C8 H10 sing N N 81 A1DEZ C8 H11 sing N N 82 A1DEZ C10 H12 sing N N 83 A1DEZ C10 H13 sing N N 84 A1DEZ C15 H14 sing N N 85 A1DEZ C15 H15 sing N N 86 A1DEZ C15 H16 sing N N 87 A1DEZ C17 H17 sing N N 88 A1DEZ C20 H18 sing N N 89 A1DEZ C20 H19 sing N N 90 A1DEZ C21 H20 sing N N 91 A1DEZ C21 H21 sing N N 92 A1DEZ C24 H22 sing N N 93 A1DEZ C28 H23 sing N N 94 A1DEZ C1 H24 sing N N 95 A1DEZ C1 H25 sing N N 96 A1DEZ C1 H26 sing N N 97 A1DEZ C2 H27 sing N N 98 A1DEZ N2 H28 sing N N 99 A1DEZ N2 H29 sing N N 100 A1DEZ C11 H31 sing N N 101 A1DEZ C11 H32 sing N N 102 A1DEZ C12 H33 sing N N 103 A1DEZ N4 H34 sing N N 104 A1DEZ C14 H35 sing N N 105 A1DEZ N5 H36 sing N N 106 A1DEZ C18 H37 sing N N 107 A1DEZ C18 H38 sing N N 108 A1DEZ C19 H39 sing N N 109 A1DEZ C19 H40 sing N N 110 A1DEZ N6 H41 sing N N 111 A1DEZ C25 H42 sing N N 112 A1DEZ O7 H43 sing N N 113 A1DEZ C32 H44 sing N N 114 A1DEZ C33 H45 sing N N 115 A1DEZ C35 H46 sing N N 116 A1DEZ C39 H48 sing N N 117 A1DEZ C40 H49 sing N N 118 A1DEZ O10 H50 sing N N 119 A1DEZ C42 H51 sing N N 120 A1DEZ N7 H52 sing N N 121 A1DEZ C44 H53 sing N N 122 A1DEZ C44 H54 sing N N 123 A1DEZ C44 H55 sing N N 124 A1DEZ N8 H56 sing N N 125 A1DEZ N8 H57 sing N N 126 A1DEZ C47 H58 sing N N 127 A1DEZ C47 H59 sing N N 128 A1DEZ C47 H60 sing N N 129 ALA N CA sing N N 130 ALA N H sing N N 131 ALA N H2 sing N N 132 ALA CA C sing N N 133 ALA CA CB sing N N 134 ALA CA HA sing N N 135 ALA C O doub N N 136 ALA C OXT sing N N 137 ALA CB HB1 sing N N 138 ALA CB HB2 sing N N 139 ALA CB HB3 sing N N 140 ALA OXT HXT sing N N 141 ARG N CA sing N N 142 ARG N H sing N N 143 ARG N H2 sing N N 144 ARG CA C sing N N 145 ARG CA CB sing N N 146 ARG CA HA sing N N 147 ARG C O doub N N 148 ARG C OXT sing N N 149 ARG CB CG sing N N 150 ARG CB HB2 sing N N 151 ARG CB HB3 sing N N 152 ARG CG CD sing N N 153 ARG CG HG2 sing N N 154 ARG CG HG3 sing N N 155 ARG CD NE sing N N 156 ARG CD HD2 sing N N 157 ARG CD HD3 sing N N 158 ARG NE CZ sing N N 159 ARG NE HE sing N N 160 ARG CZ NH1 sing N N 161 ARG CZ NH2 doub N N 162 ARG NH1 HH11 sing N N 163 ARG NH1 HH12 sing N N 164 ARG NH2 HH21 sing N N 165 ARG NH2 HH22 sing N N 166 ARG OXT HXT sing N N 167 ASN N CA sing N N 168 ASN N H sing N N 169 ASN N H2 sing N N 170 ASN CA C sing N N 171 ASN CA CB sing N N 172 ASN CA HA sing N N 173 ASN C O doub N N 174 ASN C OXT sing N N 175 ASN CB CG sing N N 176 ASN CB HB2 sing N N 177 ASN CB HB3 sing N N 178 ASN CG OD1 doub N N 179 ASN CG ND2 sing N N 180 ASN ND2 HD21 sing N N 181 ASN ND2 HD22 sing N N 182 ASN OXT HXT sing N N 183 ASP N CA sing N N 184 ASP N H sing N N 185 ASP N H2 sing N N 186 ASP CA C sing N N 187 ASP CA CB sing N N 188 ASP CA HA sing N N 189 ASP C O doub N N 190 ASP C OXT sing N N 191 ASP CB CG sing N N 192 ASP CB HB2 sing N N 193 ASP CB HB3 sing N N 194 ASP CG OD1 doub N N 195 ASP CG OD2 sing N N 196 ASP OD2 HD2 sing N N 197 ASP OXT HXT sing N N 198 CYS N CA sing N N 199 CYS N H sing N N 200 CYS N H2 sing N N 201 CYS CA C sing N N 202 CYS CA CB sing N N 203 CYS CA HA sing N N 204 CYS C O doub N N 205 CYS C OXT sing N N 206 CYS CB SG sing N N 207 CYS CB HB2 sing N N 208 CYS CB HB3 sing N N 209 CYS SG HG sing N N 210 CYS OXT HXT sing N N 211 GLN N CA sing N N 212 GLN N H sing N N 213 GLN N H2 sing N N 214 GLN CA C sing N N 215 GLN CA CB sing N N 216 GLN CA HA sing N N 217 GLN C O doub N N 218 GLN C OXT sing N N 219 GLN CB CG sing N N 220 GLN CB HB2 sing N N 221 GLN CB HB3 sing N N 222 GLN CG CD sing N N 223 GLN CG HG2 sing N N 224 GLN CG HG3 sing N N 225 GLN CD OE1 doub N N 226 GLN CD NE2 sing N N 227 GLN NE2 HE21 sing N N 228 GLN NE2 HE22 sing N N 229 GLN OXT HXT sing N N 230 GLU N CA sing N N 231 GLU N H sing N N 232 GLU N H2 sing N N 233 GLU CA C sing N N 234 GLU CA CB sing N N 235 GLU CA HA sing N N 236 GLU C O doub N N 237 GLU C OXT sing N N 238 GLU CB CG sing N N 239 GLU CB HB2 sing N N 240 GLU CB HB3 sing N N 241 GLU CG CD sing N N 242 GLU CG HG2 sing N N 243 GLU CG HG3 sing N N 244 GLU CD OE1 doub N N 245 GLU CD OE2 sing N N 246 GLU OE2 HE2 sing N N 247 GLU OXT HXT sing N N 248 GLY N CA sing N N 249 GLY N H sing N N 250 GLY N H2 sing N N 251 GLY CA C sing N N 252 GLY CA HA2 sing N N 253 GLY CA HA3 sing N N 254 GLY C O doub N N 255 GLY C OXT sing N N 256 GLY OXT HXT sing N N 257 HIS N CA sing N N 258 HIS N H sing N N 259 HIS N H2 sing N N 260 HIS CA C sing N N 261 HIS CA CB sing N N 262 HIS CA HA sing N N 263 HIS C O doub N N 264 HIS C OXT sing N N 265 HIS CB CG sing N N 266 HIS CB HB2 sing N N 267 HIS CB HB3 sing N N 268 HIS CG ND1 sing Y N 269 HIS CG CD2 doub Y N 270 HIS ND1 CE1 doub Y N 271 HIS ND1 HD1 sing N N 272 HIS CD2 NE2 sing Y N 273 HIS CD2 HD2 sing N N 274 HIS CE1 NE2 sing Y N 275 HIS CE1 HE1 sing N N 276 HIS NE2 HE2 sing N N 277 HIS OXT HXT sing N N 278 HOH O H1 sing N N 279 HOH O H2 sing N N 280 ILE N CA sing N N 281 ILE N H sing N N 282 ILE N H2 sing N N 283 ILE CA C sing N N 284 ILE CA CB sing N N 285 ILE CA HA sing N N 286 ILE C O doub N N 287 ILE C OXT sing N N 288 ILE CB CG1 sing N N 289 ILE CB CG2 sing N N 290 ILE CB HB sing N N 291 ILE CG1 CD1 sing N N 292 ILE CG1 HG12 sing N N 293 ILE CG1 HG13 sing N N 294 ILE CG2 HG21 sing N N 295 ILE CG2 HG22 sing N N 296 ILE CG2 HG23 sing N N 297 ILE CD1 HD11 sing N N 298 ILE CD1 HD12 sing N N 299 ILE CD1 HD13 sing N N 300 ILE OXT HXT sing N N 301 LEU N CA sing N N 302 LEU N H sing N N 303 LEU N H2 sing N N 304 LEU CA C sing N N 305 LEU CA CB sing N N 306 LEU CA HA sing N N 307 LEU C O doub N N 308 LEU C OXT sing N N 309 LEU CB CG sing N N 310 LEU CB HB2 sing N N 311 LEU CB HB3 sing N N 312 LEU CG CD1 sing N N 313 LEU CG CD2 sing N N 314 LEU CG HG sing N N 315 LEU CD1 HD11 sing N N 316 LEU CD1 HD12 sing N N 317 LEU CD1 HD13 sing N N 318 LEU CD2 HD21 sing N N 319 LEU CD2 HD22 sing N N 320 LEU CD2 HD23 sing N N 321 LEU OXT HXT sing N N 322 LYS N CA sing N N 323 LYS N H sing N N 324 LYS N H2 sing N N 325 LYS CA C sing N N 326 LYS CA CB sing N N 327 LYS CA HA sing N N 328 LYS C O doub N N 329 LYS C OXT sing N N 330 LYS CB CG sing N N 331 LYS CB HB2 sing N N 332 LYS CB HB3 sing N N 333 LYS CG CD sing N N 334 LYS CG HG2 sing N N 335 LYS CG HG3 sing N N 336 LYS CD CE sing N N 337 LYS CD HD2 sing N N 338 LYS CD HD3 sing N N 339 LYS CE NZ sing N N 340 LYS CE HE2 sing N N 341 LYS CE HE3 sing N N 342 LYS NZ HZ1 sing N N 343 LYS NZ HZ2 sing N N 344 LYS NZ HZ3 sing N N 345 LYS OXT HXT sing N N 346 MET N CA sing N N 347 MET N H sing N N 348 MET N H2 sing N N 349 MET CA C sing N N 350 MET CA CB sing N N 351 MET CA HA sing N N 352 MET C O doub N N 353 MET C OXT sing N N 354 MET CB CG sing N N 355 MET CB HB2 sing N N 356 MET CB HB3 sing N N 357 MET CG SD sing N N 358 MET CG HG2 sing N N 359 MET CG HG3 sing N N 360 MET SD CE sing N N 361 MET CE HE1 sing N N 362 MET CE HE2 sing N N 363 MET CE HE3 sing N N 364 MET OXT HXT sing N N 365 PHE N CA sing N N 366 PHE N H sing N N 367 PHE N H2 sing N N 368 PHE CA C sing N N 369 PHE CA CB sing N N 370 PHE CA HA sing N N 371 PHE C O doub N N 372 PHE C OXT sing N N 373 PHE CB CG sing N N 374 PHE CB HB2 sing N N 375 PHE CB HB3 sing N N 376 PHE CG CD1 doub Y N 377 PHE CG CD2 sing Y N 378 PHE CD1 CE1 sing Y N 379 PHE CD1 HD1 sing N N 380 PHE CD2 CE2 doub Y N 381 PHE CD2 HD2 sing N N 382 PHE CE1 CZ doub Y N 383 PHE CE1 HE1 sing N N 384 PHE CE2 CZ sing Y N 385 PHE CE2 HE2 sing N N 386 PHE CZ HZ sing N N 387 PHE OXT HXT sing N N 388 PRO N CA sing N N 389 PRO N CD sing N N 390 PRO N H sing N N 391 PRO CA C sing N N 392 PRO CA CB sing N N 393 PRO CA HA sing N N 394 PRO C O doub N N 395 PRO C OXT sing N N 396 PRO CB CG sing N N 397 PRO CB HB2 sing N N 398 PRO CB HB3 sing N N 399 PRO CG CD sing N N 400 PRO CG HG2 sing N N 401 PRO CG HG3 sing N N 402 PRO CD HD2 sing N N 403 PRO CD HD3 sing N N 404 PRO OXT HXT sing N N 405 SER N CA sing N N 406 SER N H sing N N 407 SER N H2 sing N N 408 SER CA C sing N N 409 SER CA CB sing N N 410 SER CA HA sing N N 411 SER C O doub N N 412 SER C OXT sing N N 413 SER CB OG sing N N 414 SER CB HB2 sing N N 415 SER CB HB3 sing N N 416 SER OG HG sing N N 417 SER OXT HXT sing N N 418 THR N CA sing N N 419 THR N H sing N N 420 THR N H2 sing N N 421 THR CA C sing N N 422 THR CA CB sing N N 423 THR CA HA sing N N 424 THR C O doub N N 425 THR C OXT sing N N 426 THR CB OG1 sing N N 427 THR CB CG2 sing N N 428 THR CB HB sing N N 429 THR OG1 HG1 sing N N 430 THR CG2 HG21 sing N N 431 THR CG2 HG22 sing N N 432 THR CG2 HG23 sing N N 433 THR OXT HXT sing N N 434 TRP N CA sing N N 435 TRP N H sing N N 436 TRP N H2 sing N N 437 TRP CA C sing N N 438 TRP CA CB sing N N 439 TRP CA HA sing N N 440 TRP C O doub N N 441 TRP C OXT sing N N 442 TRP CB CG sing N N 443 TRP CB HB2 sing N N 444 TRP CB HB3 sing N N 445 TRP CG CD1 doub Y N 446 TRP CG CD2 sing Y N 447 TRP CD1 NE1 sing Y N 448 TRP CD1 HD1 sing N N 449 TRP CD2 CE2 doub Y N 450 TRP CD2 CE3 sing Y N 451 TRP NE1 CE2 sing Y N 452 TRP NE1 HE1 sing N N 453 TRP CE2 CZ2 sing Y N 454 TRP CE3 CZ3 doub Y N 455 TRP CE3 HE3 sing N N 456 TRP CZ2 CH2 doub Y N 457 TRP CZ2 HZ2 sing N N 458 TRP CZ3 CH2 sing Y N 459 TRP CZ3 HZ3 sing N N 460 TRP CH2 HH2 sing N N 461 TRP OXT HXT sing N N 462 TYR N CA sing N N 463 TYR N H sing N N 464 TYR N H2 sing N N 465 TYR CA C sing N N 466 TYR CA CB sing N N 467 TYR CA HA sing N N 468 TYR C O doub N N 469 TYR C OXT sing N N 470 TYR CB CG sing N N 471 TYR CB HB2 sing N N 472 TYR CB HB3 sing N N 473 TYR CG CD1 doub Y N 474 TYR CG CD2 sing Y N 475 TYR CD1 CE1 sing Y N 476 TYR CD1 HD1 sing N N 477 TYR CD2 CE2 doub Y N 478 TYR CD2 HD2 sing N N 479 TYR CE1 CZ doub Y N 480 TYR CE1 HE1 sing N N 481 TYR CE2 CZ sing Y N 482 TYR CE2 HE2 sing N N 483 TYR CZ OH sing N N 484 TYR OH HH sing N N 485 TYR OXT HXT sing N N 486 VAL N CA sing N N 487 VAL N H sing N N 488 VAL N H2 sing N N 489 VAL CA C sing N N 490 VAL CA CB sing N N 491 VAL CA HA sing N N 492 VAL C O doub N N 493 VAL C OXT sing N N 494 VAL CB CG1 sing N N 495 VAL CB CG2 sing N N 496 VAL CB HB sing N N 497 VAL CG1 HG11 sing N N 498 VAL CG1 HG12 sing N N 499 VAL CG1 HG13 sing N N 500 VAL CG2 HG21 sing N N 501 VAL CG2 HG22 sing N N 502 VAL CG2 HG23 sing N N 503 VAL OXT HXT sing N N 504 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_initial_refinement_model.id _pdbx_initial_refinement_model.entity_id_list _pdbx_initial_refinement_model.type _pdbx_initial_refinement_model.source_name _pdbx_initial_refinement_model.accession_code _pdbx_initial_refinement_model.details 1 ? 'experimental model' PDB 4CSH ? 2 ? 'in silico model' AlphaFold ? ? # _atom_sites.entry_id 11CI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.014927 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007405 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017353 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N NA O S # loop_ #