data_12IS # _entry.id 12IS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 12IS pdb_000012is 10.2210/pdb12is/pdb WWPDB D_1000306792 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-04-15 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 12IS _pdbx_database_status.recvd_initial_deposition_date 2026-04-07 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 swlovell@ku.edu Scott Lovell ? 'principal investigator/group leader' 0000-0002-3215-4472 3 isabelle.phan@seattlechildrens.org Isabelle Phan ? 'principal investigator/group leader' 0000-0001-6873-3401 4 julie.early@seattlechildrens.org Julie Early ? 'principal investigator/group leader' 0000-0003-1224-2747 5 peter.myler@seattlechildrens.org Peter Myler ? 'principal investigator/group leader' 0000-0002-0056-0513 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Seattle Structural Genomics Center for Infectious Disease' 1 ? 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of a SnoaL-like domain-containing protein from Mycobacterium ulcerans (Zinc Bound)' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, L.' 1 0000-0003-0514-281X primary 'Lovell, S.' 2 0000-0002-3215-4472 primary 'Ung, A.R.' 3 0000-0002-9906-0710 primary 'Buchko, G.W.' 4 0000-0002-3639-1061 primary 'Battaile, K.P.' 5 0000-0003-0833-3259 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SnoaL-like domain-containing protein' 16936.111 1 ? ? S2-Y125 ? 2 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 water nat water 18.015 116 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHMGTLEAQTQGPGSMVSIALLREMFEKMVVAKNAELIGHYYDPDFVMYSDGLRQEFAEFNEGHRKIYASAISY AIEYDEDAWVQAPDRVAGRVWITTSRPGEKPTRIEVILIAAYRDCRIHRIWETTWPSWRNVAALED ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHMGTLEAQTQGPGSMVSIALLREMFEKMVVAKNAELIGHYYDPDFVMYSDGLRQEFAEFNEGHRKIYASAISY AIEYDEDAWVQAPDRVAGRVWITTSRPGEKPTRIEVILIAAYRDCRIHRIWETTWPSWRNVAALED ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DI(HYDROXYETHYL)ETHER' PEG 3 'ZINC ION' ZN 4 'CHLORIDE ION' CL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 GLY n 1 11 THR n 1 12 LEU n 1 13 GLU n 1 14 ALA n 1 15 GLN n 1 16 THR n 1 17 GLN n 1 18 GLY n 1 19 PRO n 1 20 GLY n 1 21 SER n 1 22 MET n 1 23 VAL n 1 24 SER n 1 25 ILE n 1 26 ALA n 1 27 LEU n 1 28 LEU n 1 29 ARG n 1 30 GLU n 1 31 MET n 1 32 PHE n 1 33 GLU n 1 34 LYS n 1 35 MET n 1 36 VAL n 1 37 VAL n 1 38 ALA n 1 39 LYS n 1 40 ASN n 1 41 ALA n 1 42 GLU n 1 43 LEU n 1 44 ILE n 1 45 GLY n 1 46 HIS n 1 47 TYR n 1 48 TYR n 1 49 ASP n 1 50 PRO n 1 51 ASP n 1 52 PHE n 1 53 VAL n 1 54 MET n 1 55 TYR n 1 56 SER n 1 57 ASP n 1 58 GLY n 1 59 LEU n 1 60 ARG n 1 61 GLN n 1 62 GLU n 1 63 PHE n 1 64 ALA n 1 65 GLU n 1 66 PHE n 1 67 ASN n 1 68 GLU n 1 69 GLY n 1 70 HIS n 1 71 ARG n 1 72 LYS n 1 73 ILE n 1 74 TYR n 1 75 ALA n 1 76 SER n 1 77 ALA n 1 78 ILE n 1 79 SER n 1 80 TYR n 1 81 ALA n 1 82 ILE n 1 83 GLU n 1 84 TYR n 1 85 ASP n 1 86 GLU n 1 87 ASP n 1 88 ALA n 1 89 TRP n 1 90 VAL n 1 91 GLN n 1 92 ALA n 1 93 PRO n 1 94 ASP n 1 95 ARG n 1 96 VAL n 1 97 ALA n 1 98 GLY n 1 99 ARG n 1 100 VAL n 1 101 TRP n 1 102 ILE n 1 103 THR n 1 104 THR n 1 105 SER n 1 106 ARG n 1 107 PRO n 1 108 GLY n 1 109 GLU n 1 110 LYS n 1 111 PRO n 1 112 THR n 1 113 ARG n 1 114 ILE n 1 115 GLU n 1 116 VAL n 1 117 ILE n 1 118 LEU n 1 119 ILE n 1 120 ALA n 1 121 ALA n 1 122 TYR n 1 123 ARG n 1 124 ASP n 1 125 CYS n 1 126 ARG n 1 127 ILE n 1 128 HIS n 1 129 ARG n 1 130 ILE n 1 131 TRP n 1 132 GLU n 1 133 THR n 1 134 THR n 1 135 TRP n 1 136 PRO n 1 137 SER n 1 138 TRP n 1 139 ARG n 1 140 ASN n 1 141 VAL n 1 142 ALA n 1 143 ALA n 1 144 LEU n 1 145 GLU n 1 146 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 146 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MUL_2490 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium ulcerans Agy99' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 362242 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name MyulA.17060.a.A1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -20 ? ? ? A . n A 1 2 ALA 2 -19 ? ? ? A . n A 1 3 HIS 3 -18 ? ? ? A . n A 1 4 HIS 4 -17 ? ? ? A . n A 1 5 HIS 5 -16 ? ? ? A . n A 1 6 HIS 6 -15 ? ? ? A . n A 1 7 HIS 7 -14 ? ? ? A . n A 1 8 HIS 8 -13 ? ? ? A . n A 1 9 MET 9 -12 ? ? ? A . n A 1 10 GLY 10 -11 ? ? ? A . n A 1 11 THR 11 -10 ? ? ? A . n A 1 12 LEU 12 -9 ? ? ? A . n A 1 13 GLU 13 -8 ? ? ? A . n A 1 14 ALA 14 -7 ? ? ? A . n A 1 15 GLN 15 -6 ? ? ? A . n A 1 16 THR 16 -5 ? ? ? A . n A 1 17 GLN 17 -4 ? ? ? A . n A 1 18 GLY 18 -3 ? ? ? A . n A 1 19 PRO 19 -2 ? ? ? A . n A 1 20 GLY 20 -1 ? ? ? A . n A 1 21 SER 21 0 0 SER SER A . n A 1 22 MET 22 1 1 MET MET A . n A 1 23 VAL 23 2 2 VAL VAL A . n A 1 24 SER 24 3 3 SER SER A . n A 1 25 ILE 25 4 4 ILE ILE A . n A 1 26 ALA 26 5 5 ALA ALA A . n A 1 27 LEU 27 6 6 LEU LEU A . n A 1 28 LEU 28 7 7 LEU LEU A . n A 1 29 ARG 29 8 8 ARG ARG A . n A 1 30 GLU 30 9 9 GLU GLU A . n A 1 31 MET 31 10 10 MET MET A . n A 1 32 PHE 32 11 11 PHE PHE A . n A 1 33 GLU 33 12 12 GLU GLU A . n A 1 34 LYS 34 13 13 LYS LYS A . n A 1 35 MET 35 14 14 MET MET A . n A 1 36 VAL 36 15 15 VAL VAL A . n A 1 37 VAL 37 16 16 VAL VAL A . n A 1 38 ALA 38 17 17 ALA ALA A . n A 1 39 LYS 39 18 18 LYS LYS A . n A 1 40 ASN 40 19 19 ASN ASN A . n A 1 41 ALA 41 20 20 ALA ALA A . n A 1 42 GLU 42 21 21 GLU GLU A . n A 1 43 LEU 43 22 22 LEU LEU A . n A 1 44 ILE 44 23 23 ILE ILE A . n A 1 45 GLY 45 24 24 GLY GLY A . n A 1 46 HIS 46 25 25 HIS HIS A . n A 1 47 TYR 47 26 26 TYR TYR A . n A 1 48 TYR 48 27 27 TYR TYR A . n A 1 49 ASP 49 28 28 ASP ASP A . n A 1 50 PRO 50 29 29 PRO PRO A . n A 1 51 ASP 51 30 30 ASP ASP A . n A 1 52 PHE 52 31 31 PHE PHE A . n A 1 53 VAL 53 32 32 VAL VAL A . n A 1 54 MET 54 33 33 MET MET A . n A 1 55 TYR 55 34 34 TYR TYR A . n A 1 56 SER 56 35 35 SER SER A . n A 1 57 ASP 57 36 36 ASP ASP A . n A 1 58 GLY 58 37 37 GLY GLY A . n A 1 59 LEU 59 38 38 LEU LEU A . n A 1 60 ARG 60 39 39 ARG ARG A . n A 1 61 GLN 61 40 40 GLN GLN A . n A 1 62 GLU 62 41 41 GLU GLU A . n A 1 63 PHE 63 42 42 PHE PHE A . n A 1 64 ALA 64 43 43 ALA ALA A . n A 1 65 GLU 65 44 44 GLU GLU A . n A 1 66 PHE 66 45 45 PHE PHE A . n A 1 67 ASN 67 46 46 ASN ASN A . n A 1 68 GLU 68 47 47 GLU GLU A . n A 1 69 GLY 69 48 48 GLY GLY A . n A 1 70 HIS 70 49 49 HIS HIS A . n A 1 71 ARG 71 50 50 ARG ARG A . n A 1 72 LYS 72 51 51 LYS LYS A . n A 1 73 ILE 73 52 52 ILE ILE A . n A 1 74 TYR 74 53 53 TYR TYR A . n A 1 75 ALA 75 54 54 ALA ALA A . n A 1 76 SER 76 55 55 SER SER A . n A 1 77 ALA 77 56 56 ALA ALA A . n A 1 78 ILE 78 57 57 ILE ILE A . n A 1 79 SER 79 58 58 SER SER A . n A 1 80 TYR 80 59 59 TYR TYR A . n A 1 81 ALA 81 60 60 ALA ALA A . n A 1 82 ILE 82 61 61 ILE ILE A . n A 1 83 GLU 83 62 62 GLU GLU A . n A 1 84 TYR 84 63 63 TYR TYR A . n A 1 85 ASP 85 64 64 ASP ASP A . n A 1 86 GLU 86 65 65 GLU GLU A . n A 1 87 ASP 87 66 66 ASP ASP A . n A 1 88 ALA 88 67 67 ALA ALA A . n A 1 89 TRP 89 68 68 TRP TRP A . n A 1 90 VAL 90 69 69 VAL VAL A . n A 1 91 GLN 91 70 70 GLN GLN A . n A 1 92 ALA 92 71 71 ALA ALA A . n A 1 93 PRO 93 72 72 PRO PRO A . n A 1 94 ASP 94 73 73 ASP ASP A . n A 1 95 ARG 95 74 74 ARG ARG A . n A 1 96 VAL 96 75 75 VAL VAL A . n A 1 97 ALA 97 76 76 ALA ALA A . n A 1 98 GLY 98 77 77 GLY GLY A . n A 1 99 ARG 99 78 78 ARG ARG A . n A 1 100 VAL 100 79 79 VAL VAL A . n A 1 101 TRP 101 80 80 TRP TRP A . n A 1 102 ILE 102 81 81 ILE ILE A . n A 1 103 THR 103 82 82 THR THR A . n A 1 104 THR 104 83 83 THR THR A . n A 1 105 SER 105 84 84 SER SER A . n A 1 106 ARG 106 85 85 ARG ARG A . n A 1 107 PRO 107 86 86 PRO PRO A . n A 1 108 GLY 108 87 87 GLY GLY A . n A 1 109 GLU 109 88 88 GLU GLU A . n A 1 110 LYS 110 89 89 LYS LYS A . n A 1 111 PRO 111 90 90 PRO PRO A . n A 1 112 THR 112 91 91 THR THR A . n A 1 113 ARG 113 92 92 ARG ARG A . n A 1 114 ILE 114 93 93 ILE ILE A . n A 1 115 GLU 115 94 94 GLU GLU A . n A 1 116 VAL 116 95 95 VAL VAL A . n A 1 117 ILE 117 96 96 ILE ILE A . n A 1 118 LEU 118 97 97 LEU LEU A . n A 1 119 ILE 119 98 98 ILE ILE A . n A 1 120 ALA 120 99 99 ALA ALA A . n A 1 121 ALA 121 100 100 ALA ALA A . n A 1 122 TYR 122 101 101 TYR TYR A . n A 1 123 ARG 123 102 102 ARG ARG A . n A 1 124 ASP 124 103 103 ASP ASP A . n A 1 125 CYS 125 104 104 CYS CYS A . n A 1 126 ARG 126 105 105 ARG ARG A . n A 1 127 ILE 127 106 106 ILE ILE A . n A 1 128 HIS 128 107 107 HIS HIS A . n A 1 129 ARG 129 108 108 ARG ARG A . n A 1 130 ILE 130 109 109 ILE ILE A . n A 1 131 TRP 131 110 110 TRP TRP A . n A 1 132 GLU 132 111 111 GLU GLU A . n A 1 133 THR 133 112 112 THR THR A . n A 1 134 THR 134 113 113 THR THR A . n A 1 135 TRP 135 114 114 TRP TRP A . n A 1 136 PRO 136 115 115 PRO PRO A . n A 1 137 SER 137 116 116 SER SER A . n A 1 138 TRP 138 117 117 TRP TRP A . n A 1 139 ARG 139 118 118 ARG ARG A . n A 1 140 ASN 140 119 ? ? ? A . n A 1 141 VAL 141 120 ? ? ? A . n A 1 142 ALA 142 121 ? ? ? A . n A 1 143 ALA 143 122 ? ? ? A . n A 1 144 LEU 144 123 ? ? ? A . n A 1 145 GLU 145 124 ? ? ? A . n A 1 146 ASP 146 125 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PEG 1 201 101 PEG PEG A . C 3 ZN 1 202 201 ZN ZN A . D 4 CL 1 203 301 CL CL A . E 5 HOH 1 301 92 HOH HOH A . E 5 HOH 2 302 55 HOH HOH A . E 5 HOH 3 303 48 HOH HOH A . E 5 HOH 4 304 44 HOH HOH A . E 5 HOH 5 305 108 HOH HOH A . E 5 HOH 6 306 41 HOH HOH A . E 5 HOH 7 307 113 HOH HOH A . E 5 HOH 8 308 107 HOH HOH A . E 5 HOH 9 309 24 HOH HOH A . E 5 HOH 10 310 114 HOH HOH A . E 5 HOH 11 311 78 HOH HOH A . E 5 HOH 12 312 106 HOH HOH A . E 5 HOH 13 313 85 HOH HOH A . E 5 HOH 14 314 105 HOH HOH A . E 5 HOH 15 315 97 HOH HOH A . E 5 HOH 16 316 4 HOH HOH A . E 5 HOH 17 317 18 HOH HOH A . E 5 HOH 18 318 65 HOH HOH A . E 5 HOH 19 319 25 HOH HOH A . E 5 HOH 20 320 11 HOH HOH A . E 5 HOH 21 321 33 HOH HOH A . E 5 HOH 22 322 20 HOH HOH A . E 5 HOH 23 323 57 HOH HOH A . E 5 HOH 24 324 47 HOH HOH A . E 5 HOH 25 325 21 HOH HOH A . E 5 HOH 26 326 63 HOH HOH A . E 5 HOH 27 327 28 HOH HOH A . E 5 HOH 28 328 12 HOH HOH A . E 5 HOH 29 329 45 HOH HOH A . E 5 HOH 30 330 80 HOH HOH A . E 5 HOH 31 331 40 HOH HOH A . E 5 HOH 32 332 9 HOH HOH A . E 5 HOH 33 333 8 HOH HOH A . E 5 HOH 34 334 10 HOH HOH A . E 5 HOH 35 335 19 HOH HOH A . E 5 HOH 36 336 70 HOH HOH A . E 5 HOH 37 337 49 HOH HOH A . E 5 HOH 38 338 6 HOH HOH A . E 5 HOH 39 339 77 HOH HOH A . E 5 HOH 40 340 84 HOH HOH A . E 5 HOH 41 341 31 HOH HOH A . E 5 HOH 42 342 16 HOH HOH A . E 5 HOH 43 343 42 HOH HOH A . E 5 HOH 44 344 53 HOH HOH A . E 5 HOH 45 345 36 HOH HOH A . E 5 HOH 46 346 39 HOH HOH A . E 5 HOH 47 347 115 HOH HOH A . E 5 HOH 48 348 50 HOH HOH A . E 5 HOH 49 349 95 HOH HOH A . E 5 HOH 50 350 43 HOH HOH A . E 5 HOH 51 351 5 HOH HOH A . E 5 HOH 52 352 60 HOH HOH A . E 5 HOH 53 353 52 HOH HOH A . E 5 HOH 54 354 7 HOH HOH A . E 5 HOH 55 355 69 HOH HOH A . E 5 HOH 56 356 34 HOH HOH A . E 5 HOH 57 357 30 HOH HOH A . E 5 HOH 58 358 15 HOH HOH A . E 5 HOH 59 359 13 HOH HOH A . E 5 HOH 60 360 32 HOH HOH A . E 5 HOH 61 361 67 HOH HOH A . E 5 HOH 62 362 29 HOH HOH A . E 5 HOH 63 363 79 HOH HOH A . E 5 HOH 64 364 2 HOH HOH A . E 5 HOH 65 365 51 HOH HOH A . E 5 HOH 66 366 38 HOH HOH A . E 5 HOH 67 367 94 HOH HOH A . E 5 HOH 68 368 23 HOH HOH A . E 5 HOH 69 369 109 HOH HOH A . E 5 HOH 70 370 56 HOH HOH A . E 5 HOH 71 371 99 HOH HOH A . E 5 HOH 72 372 74 HOH HOH A . E 5 HOH 73 373 26 HOH HOH A . E 5 HOH 74 374 14 HOH HOH A . E 5 HOH 75 375 1 HOH HOH A . E 5 HOH 76 376 71 HOH HOH A . E 5 HOH 77 377 22 HOH HOH A . E 5 HOH 78 378 98 HOH HOH A . E 5 HOH 79 379 90 HOH HOH A . E 5 HOH 80 380 3 HOH HOH A . E 5 HOH 81 381 83 HOH HOH A . E 5 HOH 82 382 54 HOH HOH A . E 5 HOH 83 383 91 HOH HOH A . E 5 HOH 84 384 103 HOH HOH A . E 5 HOH 85 385 59 HOH HOH A . E 5 HOH 86 386 73 HOH HOH A . E 5 HOH 87 387 111 HOH HOH A . E 5 HOH 88 388 27 HOH HOH A . E 5 HOH 89 389 58 HOH HOH A . E 5 HOH 90 390 82 HOH HOH A . E 5 HOH 91 391 64 HOH HOH A . E 5 HOH 92 392 37 HOH HOH A . E 5 HOH 93 393 112 HOH HOH A . E 5 HOH 94 394 61 HOH HOH A . E 5 HOH 95 395 68 HOH HOH A . E 5 HOH 96 396 116 HOH HOH A . E 5 HOH 97 397 110 HOH HOH A . E 5 HOH 98 398 87 HOH HOH A . E 5 HOH 99 399 89 HOH HOH A . E 5 HOH 100 400 81 HOH HOH A . E 5 HOH 101 401 46 HOH HOH A . E 5 HOH 102 402 101 HOH HOH A . E 5 HOH 103 403 76 HOH HOH A . E 5 HOH 104 404 104 HOH HOH A . E 5 HOH 105 405 17 HOH HOH A . E 5 HOH 106 406 88 HOH HOH A . E 5 HOH 107 407 93 HOH HOH A . E 5 HOH 108 408 86 HOH HOH A . E 5 HOH 109 409 96 HOH HOH A . E 5 HOH 110 410 102 HOH HOH A . E 5 HOH 111 411 35 HOH HOH A . E 5 HOH 112 412 62 HOH HOH A . E 5 HOH 113 413 72 HOH HOH A . E 5 HOH 114 414 75 HOH HOH A . E 5 HOH 115 415 100 HOH HOH A . E 5 HOH 116 416 66 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(2.0_5936: ???)' ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 12IS _cell.details ? _cell.formula_units_Z ? _cell.length_a 62.071 _cell.length_a_esd ? _cell.length_b 71.662 _cell.length_b_esd ? _cell.length_c 56.341 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 12IS _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 12IS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.85 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.50 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;12% 4000, 0.1M sodium acetate pH 4.2, 10mM dihdrogen potassium phosphate. MyulA.17060.a.A1.PB00143 at 15 mg/mL. Liu-S-182 drop CD/4, Puck: PSL-0405, Cryo: 32% PEG 4000, 0.2M sodium acetate pH 4.0 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-05-25 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double Crystal Si 111' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9786 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9786 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 12IS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.31 _reflns.d_resolution_low 46.92 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 53640 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 26.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.97 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.045 _reflns.pdbx_Rpim_I_all 0.012 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.043 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.31 _reflns_shell.d_res_low 1.34 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 10031 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1234 _reflns_shell.percent_possible_obs 56.7 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 8.1 _reflns_shell.pdbx_chi_squared 0.75 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.7 _reflns_shell.pdbx_Rrim_I_all 1.079 _reflns_shell.pdbx_Rpim_I_all 0.367 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.757 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.010 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 12IS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.31 _refine.ls_d_res_low 36.05 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 53640 _refine.ls_number_reflns_R_free 2761 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.90 _refine.ls_percent_reflns_R_free 5.15 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1503 _refine.ls_R_factor_R_free 0.1742 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1491 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.32 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.14 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.31 _refine_hist.d_res_low 36.05 _refine_hist.number_atoms_solvent 116 _refine_hist.number_atoms_total 1113 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 988 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 1146 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.039 ? 1576 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 14.751 ? 461 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.081 ? 163 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.012 ? 205 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.31 1.33 . . 64 1517 55.00 . . . . 0.2933 . . . . . . . . . . . . . . . 0.3216 'X-RAY DIFFRACTION' 1.33 1.36 . . 93 1658 60.00 . . . . 0.2487 . . . . . . . . . . . . . . . 0.2680 'X-RAY DIFFRACTION' 1.36 1.38 . . 112 1880 68.00 . . . . 0.2292 . . . . . . . . . . . . . . . 0.3263 'X-RAY DIFFRACTION' 1.38 1.41 . . 99 2165 78.00 . . . . 0.2132 . . . . . . . . . . . . . . . 0.2608 'X-RAY DIFFRACTION' 1.41 1.44 . . 128 2557 91.00 . . . . 0.2004 . . . . . . . . . . . . . . . 0.2396 'X-RAY DIFFRACTION' 1.44 1.48 . . 156 2629 96.00 . . . . 0.1836 . . . . . . . . . . . . . . . 0.1987 'X-RAY DIFFRACTION' 1.48 1.51 . . 153 2684 97.00 . . . . 0.1814 . . . . . . . . . . . . . . . 0.2743 'X-RAY DIFFRACTION' 1.51 1.55 . . 123 2757 99.00 . . . . 0.1497 . . . . . . . . . . . . . . . 0.1963 'X-RAY DIFFRACTION' 1.55 1.60 . . 162 2730 99.00 . . . . 0.1557 . . . . . . . . . . . . . . . 0.1981 'X-RAY DIFFRACTION' 1.60 1.65 . . 189 2673 99.00 . . . . 0.1331 . . . . . . . . . . . . . . . 0.2114 'X-RAY DIFFRACTION' 1.65 1.71 . . 142 2770 99.00 . . . . 0.1392 . . . . . . . . . . . . . . . 0.1659 'X-RAY DIFFRACTION' 1.71 1.78 . . 152 2731 99.00 . . . . 0.1301 . . . . . . . . . . . . . . . 0.1659 'X-RAY DIFFRACTION' 1.78 1.86 . . 160 2723 99.00 . . . . 0.1541 . . . . . . . . . . . . . . . 0.1819 'X-RAY DIFFRACTION' 1.86 1.96 . . 132 2784 99.00 . . . . 0.1284 . . . . . . . . . . . . . . . 0.1745 'X-RAY DIFFRACTION' 1.96 2.08 . . 150 2771 100.00 . . . . 0.1314 . . . . . . . . . . . . . . . 0.1656 'X-RAY DIFFRACTION' 2.08 2.24 . . 159 2764 100.00 . . . . 0.1254 . . . . . . . . . . . . . . . 0.1291 'X-RAY DIFFRACTION' 2.24 2.47 . . 146 2767 100.00 . . . . 0.1496 . . . . . . . . . . . . . . . 0.1841 'X-RAY DIFFRACTION' 2.47 2.82 . . 158 2759 100.00 . . . . 0.1514 . . . . . . . . . . . . . . . 0.1626 'X-RAY DIFFRACTION' 2.82 3.55 . . 151 2761 100.00 . . . . 0.1558 . . . . . . . . . . . . . . . 0.1711 'X-RAY DIFFRACTION' 3.55 36.05 . . 132 2799 100.00 . . . . 0.1472 . . . . . . . . . . . . . . . 0.1668 # _struct.entry_id 12IS _struct.title 'Crystal structure of a SnoaL-like domain-containing protein from Mycobacterium ulcerans (Zinc Bound)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 12IS _struct_keywords.text ;SSGCID, STRUCTURAL GENOMICS, SEATTLE STRUCTURAL GENOMICS CENTER FOR INFECTIOUS DISEASE, SnoaL-like domain, Mycobacterium ulcerans, ISOMERASE ; _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0PR67_MYCUA _struct_ref.pdbx_db_accession A0PR67 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SIALLREMFEKMVVAKNAELIGHYYDPDFVMYSDGLRQEFAEFNEGHRKIYASAISYAIEYDEDAWVQAPDRVAGRVWIT TSRPGEKPTRIEVILIAAYRDCRIHRIWETTWPSWRNVAALED ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 12IS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 24 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 146 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0PR67 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 124 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 125 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 12IS MET A 1 ? UNP A0PR67 ? ? 'expression tag' -20 1 1 12IS ALA A 2 ? UNP A0PR67 ? ? 'expression tag' -19 2 1 12IS HIS A 3 ? UNP A0PR67 ? ? 'expression tag' -18 3 1 12IS HIS A 4 ? UNP A0PR67 ? ? 'expression tag' -17 4 1 12IS HIS A 5 ? UNP A0PR67 ? ? 'expression tag' -16 5 1 12IS HIS A 6 ? UNP A0PR67 ? ? 'expression tag' -15 6 1 12IS HIS A 7 ? UNP A0PR67 ? ? 'expression tag' -14 7 1 12IS HIS A 8 ? UNP A0PR67 ? ? 'expression tag' -13 8 1 12IS MET A 9 ? UNP A0PR67 ? ? 'expression tag' -12 9 1 12IS GLY A 10 ? UNP A0PR67 ? ? 'expression tag' -11 10 1 12IS THR A 11 ? UNP A0PR67 ? ? 'expression tag' -10 11 1 12IS LEU A 12 ? UNP A0PR67 ? ? 'expression tag' -9 12 1 12IS GLU A 13 ? UNP A0PR67 ? ? 'expression tag' -8 13 1 12IS ALA A 14 ? UNP A0PR67 ? ? 'expression tag' -7 14 1 12IS GLN A 15 ? UNP A0PR67 ? ? 'expression tag' -6 15 1 12IS THR A 16 ? UNP A0PR67 ? ? 'expression tag' -5 16 1 12IS GLN A 17 ? UNP A0PR67 ? ? 'expression tag' -4 17 1 12IS GLY A 18 ? UNP A0PR67 ? ? 'expression tag' -3 18 1 12IS PRO A 19 ? UNP A0PR67 ? ? 'expression tag' -2 19 1 12IS GLY A 20 ? UNP A0PR67 ? ? 'expression tag' -1 20 1 12IS SER A 21 ? UNP A0PR67 ? ? 'expression tag' 0 21 1 12IS MET A 22 ? UNP A0PR67 ? ? 'expression tag' 1 22 1 12IS VAL A 23 ? UNP A0PR67 ? ? 'expression tag' 2 23 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0 0.0 0.0 0.0 0.0 1.0 0.0 0.0 0.0 0.0 1.0 0.0 2 'point symmetry operation' 3_554 -x,y,-z-1/2 -1.0 0.0 0.0 0.0 0.0 1.0 0.0 0.0 0.0 0.0 -1.0 -28.1705 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 22 ? MET A 35 ? MET A 1 MET A 14 1 ? 14 HELX_P HELX_P2 AA2 ASN A 40 ? GLU A 42 ? ASN A 19 GLU A 21 5 ? 3 HELX_P HELX_P3 AA3 LEU A 43 ? TYR A 47 ? LEU A 22 TYR A 26 1 ? 5 HELX_P HELX_P4 AA4 PHE A 63 ? ALA A 75 ? PHE A 42 ALA A 54 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 49 OD1 A ? ? 1_555 C ZN . ZN A ? A ASP 28 A ZN 202 1_555 ? ? ? ? ? ? ? 2.316 ? ? metalc2 metalc ? ? A ASP 51 OD1 A ? ? 1_555 C ZN . ZN A ? A ASP 30 A ZN 202 1_555 ? ? ? ? ? ? ? 1.934 ? ? metalc3 metalc ? ? A HIS 128 ND1 A ? ? 1_555 C ZN . ZN A ? A HIS 107 A ZN 202 1_555 ? ? ? ? ? ? ? 2.274 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 A A ASP 49 ? A ASP 28 ? 1_555 ZN A C ZN . ? A ZN 202 ? 1_555 OD1 A A ASP 51 ? A ASP 30 ? 1_555 59.7 ? 2 OD1 A A ASP 49 ? A ASP 28 ? 1_555 ZN A C ZN . ? A ZN 202 ? 1_555 ND1 A A HIS 128 ? A HIS 107 ? 1_555 147.9 ? 3 OD1 A A ASP 51 ? A ASP 30 ? 1_555 ZN A C ZN . ? A ZN 202 ? 1_555 ND1 A A HIS 128 ? A HIS 107 ? 1_555 105.2 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TRP _struct_mon_prot_cis.label_seq_id 135 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TRP _struct_mon_prot_cis.auth_seq_id 114 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 136 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 115 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -5.28 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 59 ? GLU A 62 ? LEU A 38 GLU A 41 AA1 2 TYR A 48 ? SER A 56 ? TYR A 27 SER A 35 AA1 3 ARG A 126 ? TRP A 135 ? ARG A 105 TRP A 114 AA1 4 THR A 112 ? ARG A 123 ? THR A 91 ARG A 102 AA1 5 ARG A 95 ? SER A 105 ? ARG A 74 SER A 84 AA1 6 SER A 79 ? TYR A 84 ? SER A 58 TYR A 63 AA2 1 LEU A 59 ? GLU A 62 ? LEU A 38 GLU A 41 AA2 2 TYR A 48 ? SER A 56 ? TYR A 27 SER A 35 AA2 3 ARG A 126 ? TRP A 135 ? ARG A 105 TRP A 114 AA2 4 THR A 112 ? ARG A 123 ? THR A 91 ARG A 102 AA2 5 ARG A 95 ? SER A 105 ? ARG A 74 SER A 84 AA2 6 VAL A 90 ? ALA A 92 ? VAL A 69 ALA A 71 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLN A 61 ? O GLN A 40 N MET A 54 ? N MET A 33 AA1 2 3 N ASP A 49 ? N ASP A 28 O ILE A 127 ? O ILE A 106 AA1 3 4 O HIS A 128 ? O HIS A 107 N ALA A 121 ? N ALA A 100 AA1 4 5 O VAL A 116 ? O VAL A 95 N VAL A 100 ? N VAL A 79 AA1 5 6 O THR A 103 ? O THR A 82 N ALA A 81 ? N ALA A 60 AA2 1 2 O GLN A 61 ? O GLN A 40 N MET A 54 ? N MET A 33 AA2 2 3 N ASP A 49 ? N ASP A 28 O ILE A 127 ? O ILE A 106 AA2 3 4 O HIS A 128 ? O HIS A 107 N ALA A 121 ? N ALA A 100 AA2 4 5 O VAL A 116 ? O VAL A 95 N VAL A 100 ? N VAL A 79 AA2 5 6 O ARG A 95 ? O ARG A 74 N ALA A 92 ? N ALA A 71 # _pdbx_entry_details.entry_id 12IS _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id CYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 104 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 79.31 _pdbx_validate_torsion.psi -0.39 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 307 ? E HOH . 2 1 A HOH 356 ? E HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -20 ? A MET 1 2 1 Y 1 A ALA -19 ? A ALA 2 3 1 Y 1 A HIS -18 ? A HIS 3 4 1 Y 1 A HIS -17 ? A HIS 4 5 1 Y 1 A HIS -16 ? A HIS 5 6 1 Y 1 A HIS -15 ? A HIS 6 7 1 Y 1 A HIS -14 ? A HIS 7 8 1 Y 1 A HIS -13 ? A HIS 8 9 1 Y 1 A MET -12 ? A MET 9 10 1 Y 1 A GLY -11 ? A GLY 10 11 1 Y 1 A THR -10 ? A THR 11 12 1 Y 1 A LEU -9 ? A LEU 12 13 1 Y 1 A GLU -8 ? A GLU 13 14 1 Y 1 A ALA -7 ? A ALA 14 15 1 Y 1 A GLN -6 ? A GLN 15 16 1 Y 1 A THR -5 ? A THR 16 17 1 Y 1 A GLN -4 ? A GLN 17 18 1 Y 1 A GLY -3 ? A GLY 18 19 1 Y 1 A PRO -2 ? A PRO 19 20 1 Y 1 A GLY -1 ? A GLY 20 21 1 Y 1 A ASN 119 ? A ASN 140 22 1 Y 1 A VAL 120 ? A VAL 141 23 1 Y 1 A ALA 121 ? A ALA 142 24 1 Y 1 A ALA 122 ? A ALA 143 25 1 Y 1 A LEU 123 ? A LEU 144 26 1 Y 1 A GLU 124 ? A GLU 145 27 1 Y 1 A ASP 125 ? A ASP 146 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PEG C1 C N N 251 PEG O1 O N N 252 PEG C2 C N N 253 PEG O2 O N N 254 PEG C3 C N N 255 PEG C4 C N N 256 PEG O4 O N N 257 PEG H11 H N N 258 PEG H12 H N N 259 PEG HO1 H N N 260 PEG H21 H N N 261 PEG H22 H N N 262 PEG H31 H N N 263 PEG H32 H N N 264 PEG H41 H N N 265 PEG H42 H N N 266 PEG HO4 H N N 267 PHE N N N N 268 PHE CA C N S 269 PHE C C N N 270 PHE O O N N 271 PHE CB C N N 272 PHE CG C Y N 273 PHE CD1 C Y N 274 PHE CD2 C Y N 275 PHE CE1 C Y N 276 PHE CE2 C Y N 277 PHE CZ C Y N 278 PHE OXT O N N 279 PHE H H N N 280 PHE H2 H N N 281 PHE HA H N N 282 PHE HB2 H N N 283 PHE HB3 H N N 284 PHE HD1 H N N 285 PHE HD2 H N N 286 PHE HE1 H N N 287 PHE HE2 H N N 288 PHE HZ H N N 289 PHE HXT H N N 290 PRO N N N N 291 PRO CA C N S 292 PRO C C N N 293 PRO O O N N 294 PRO CB C N N 295 PRO CG C N N 296 PRO CD C N N 297 PRO OXT O N N 298 PRO H H N N 299 PRO HA H N N 300 PRO HB2 H N N 301 PRO HB3 H N N 302 PRO HG2 H N N 303 PRO HG3 H N N 304 PRO HD2 H N N 305 PRO HD3 H N N 306 PRO HXT H N N 307 SER N N N N 308 SER CA C N S 309 SER C C N N 310 SER O O N N 311 SER CB C N N 312 SER OG O N N 313 SER OXT O N N 314 SER H H N N 315 SER H2 H N N 316 SER HA H N N 317 SER HB2 H N N 318 SER HB3 H N N 319 SER HG H N N 320 SER HXT H N N 321 THR N N N N 322 THR CA C N S 323 THR C C N N 324 THR O O N N 325 THR CB C N R 326 THR OG1 O N N 327 THR CG2 C N N 328 THR OXT O N N 329 THR H H N N 330 THR H2 H N N 331 THR HA H N N 332 THR HB H N N 333 THR HG1 H N N 334 THR HG21 H N N 335 THR HG22 H N N 336 THR HG23 H N N 337 THR HXT H N N 338 TRP N N N N 339 TRP CA C N S 340 TRP C C N N 341 TRP O O N N 342 TRP CB C N N 343 TRP CG C Y N 344 TRP CD1 C Y N 345 TRP CD2 C Y N 346 TRP NE1 N Y N 347 TRP CE2 C Y N 348 TRP CE3 C Y N 349 TRP CZ2 C Y N 350 TRP CZ3 C Y N 351 TRP CH2 C Y N 352 TRP OXT O N N 353 TRP H H N N 354 TRP H2 H N N 355 TRP HA H N N 356 TRP HB2 H N N 357 TRP HB3 H N N 358 TRP HD1 H N N 359 TRP HE1 H N N 360 TRP HE3 H N N 361 TRP HZ2 H N N 362 TRP HZ3 H N N 363 TRP HH2 H N N 364 TRP HXT H N N 365 TYR N N N N 366 TYR CA C N S 367 TYR C C N N 368 TYR O O N N 369 TYR CB C N N 370 TYR CG C Y N 371 TYR CD1 C Y N 372 TYR CD2 C Y N 373 TYR CE1 C Y N 374 TYR CE2 C Y N 375 TYR CZ C Y N 376 TYR OH O N N 377 TYR OXT O N N 378 TYR H H N N 379 TYR H2 H N N 380 TYR HA H N N 381 TYR HB2 H N N 382 TYR HB3 H N N 383 TYR HD1 H N N 384 TYR HD2 H N N 385 TYR HE1 H N N 386 TYR HE2 H N N 387 TYR HH H N N 388 TYR HXT H N N 389 VAL N N N N 390 VAL CA C N S 391 VAL C C N N 392 VAL O O N N 393 VAL CB C N N 394 VAL CG1 C N N 395 VAL CG2 C N N 396 VAL OXT O N N 397 VAL H H N N 398 VAL H2 H N N 399 VAL HA H N N 400 VAL HB H N N 401 VAL HG11 H N N 402 VAL HG12 H N N 403 VAL HG13 H N N 404 VAL HG21 H N N 405 VAL HG22 H N N 406 VAL HG23 H N N 407 VAL HXT H N N 408 ZN ZN ZN N N 409 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PEG C1 O1 sing N N 237 PEG C1 C2 sing N N 238 PEG C1 H11 sing N N 239 PEG C1 H12 sing N N 240 PEG O1 HO1 sing N N 241 PEG C2 O2 sing N N 242 PEG C2 H21 sing N N 243 PEG C2 H22 sing N N 244 PEG O2 C3 sing N N 245 PEG C3 C4 sing N N 246 PEG C3 H31 sing N N 247 PEG C3 H32 sing N N 248 PEG C4 O4 sing N N 249 PEG C4 H41 sing N N 250 PEG C4 H42 sing N N 251 PEG O4 HO4 sing N N 252 PHE N CA sing N N 253 PHE N H sing N N 254 PHE N H2 sing N N 255 PHE CA C sing N N 256 PHE CA CB sing N N 257 PHE CA HA sing N N 258 PHE C O doub N N 259 PHE C OXT sing N N 260 PHE CB CG sing N N 261 PHE CB HB2 sing N N 262 PHE CB HB3 sing N N 263 PHE CG CD1 doub Y N 264 PHE CG CD2 sing Y N 265 PHE CD1 CE1 sing Y N 266 PHE CD1 HD1 sing N N 267 PHE CD2 CE2 doub Y N 268 PHE CD2 HD2 sing N N 269 PHE CE1 CZ doub Y N 270 PHE CE1 HE1 sing N N 271 PHE CE2 CZ sing Y N 272 PHE CE2 HE2 sing N N 273 PHE CZ HZ sing N N 274 PHE OXT HXT sing N N 275 PRO N CA sing N N 276 PRO N CD sing N N 277 PRO N H sing N N 278 PRO CA C sing N N 279 PRO CA CB sing N N 280 PRO CA HA sing N N 281 PRO C O doub N N 282 PRO C OXT sing N N 283 PRO CB CG sing N N 284 PRO CB HB2 sing N N 285 PRO CB HB3 sing N N 286 PRO CG CD sing N N 287 PRO CG HG2 sing N N 288 PRO CG HG3 sing N N 289 PRO CD HD2 sing N N 290 PRO CD HD3 sing N N 291 PRO OXT HXT sing N N 292 SER N CA sing N N 293 SER N H sing N N 294 SER N H2 sing N N 295 SER CA C sing N N 296 SER CA CB sing N N 297 SER CA HA sing N N 298 SER C O doub N N 299 SER C OXT sing N N 300 SER CB OG sing N N 301 SER CB HB2 sing N N 302 SER CB HB3 sing N N 303 SER OG HG sing N N 304 SER OXT HXT sing N N 305 THR N CA sing N N 306 THR N H sing N N 307 THR N H2 sing N N 308 THR CA C sing N N 309 THR CA CB sing N N 310 THR CA HA sing N N 311 THR C O doub N N 312 THR C OXT sing N N 313 THR CB OG1 sing N N 314 THR CB CG2 sing N N 315 THR CB HB sing N N 316 THR OG1 HG1 sing N N 317 THR CG2 HG21 sing N N 318 THR CG2 HG22 sing N N 319 THR CG2 HG23 sing N N 320 THR OXT HXT sing N N 321 TRP N CA sing N N 322 TRP N H sing N N 323 TRP N H2 sing N N 324 TRP CA C sing N N 325 TRP CA CB sing N N 326 TRP CA HA sing N N 327 TRP C O doub N N 328 TRP C OXT sing N N 329 TRP CB CG sing N N 330 TRP CB HB2 sing N N 331 TRP CB HB3 sing N N 332 TRP CG CD1 doub Y N 333 TRP CG CD2 sing Y N 334 TRP CD1 NE1 sing Y N 335 TRP CD1 HD1 sing N N 336 TRP CD2 CE2 doub Y N 337 TRP CD2 CE3 sing Y N 338 TRP NE1 CE2 sing Y N 339 TRP NE1 HE1 sing N N 340 TRP CE2 CZ2 sing Y N 341 TRP CE3 CZ3 doub Y N 342 TRP CE3 HE3 sing N N 343 TRP CZ2 CH2 doub Y N 344 TRP CZ2 HZ2 sing N N 345 TRP CZ3 CH2 sing Y N 346 TRP CZ3 HZ3 sing N N 347 TRP CH2 HH2 sing N N 348 TRP OXT HXT sing N N 349 TYR N CA sing N N 350 TYR N H sing N N 351 TYR N H2 sing N N 352 TYR CA C sing N N 353 TYR CA CB sing N N 354 TYR CA HA sing N N 355 TYR C O doub N N 356 TYR C OXT sing N N 357 TYR CB CG sing N N 358 TYR CB HB2 sing N N 359 TYR CB HB3 sing N N 360 TYR CG CD1 doub Y N 361 TYR CG CD2 sing Y N 362 TYR CD1 CE1 sing Y N 363 TYR CD1 HD1 sing N N 364 TYR CD2 CE2 doub Y N 365 TYR CD2 HD2 sing N N 366 TYR CE1 CZ doub Y N 367 TYR CE1 HE1 sing N N 368 TYR CE2 CZ sing Y N 369 TYR CE2 HE2 sing N N 370 TYR CZ OH sing N N 371 TYR OH HH sing N N 372 TYR OXT HXT sing N N 373 VAL N CA sing N N 374 VAL N H sing N N 375 VAL N H2 sing N N 376 VAL CA C sing N N 377 VAL CA CB sing N N 378 VAL CA HA sing N N 379 VAL C O doub N N 380 VAL C OXT sing N N 381 VAL CB CG1 sing N N 382 VAL CB CG2 sing N N 383 VAL CB HB sing N N 384 VAL CG1 HG11 sing N N 385 VAL CG1 HG12 sing N N 386 VAL CG1 HG13 sing N N 387 VAL CG2 HG21 sing N N 388 VAL CG2 HG22 sing N N 389 VAL CG2 HG23 sing N N 390 VAL OXT HXT sing N N 391 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 75N93022C00036 1 'National Institutes of Health/Office of the Director' 'United States' S10OD030394 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 9PL2 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 12IS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.016111 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013954 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017749 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O S ZN # loop_ # loop_ #