data_1A18
# 
_entry.id   1A18 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.375 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1A18         pdb_00001a18 10.2210/pdb1a18/pdb 
WWPDB D_1000170266 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1A18 
_pdbx_database_status.recvd_initial_deposition_date   1997-12-23 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ory, J.'       1 
'Mazhary, A.'   2 
'Kuang, H.'     3 
'Davies, R.'    4 
'Distefano, M.' 5 
'Banaszak, L.'  6 
# 
_citation.id                        primary 
_citation.title                     
'Structural characterization of two synthetic catalysts based on adipocyte lipid-binding protein.' 
_citation.journal_abbrev            'Protein Eng.' 
_citation.journal_volume            11 
_citation.page_first                253 
_citation.page_last                 261 
_citation.year                      1998 
_citation.journal_id_ASTM           PRENE9 
_citation.country                   UK 
_citation.journal_id_ISSN           0269-2139 
_citation.journal_id_CSD            0859 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9680187 
_citation.pdbx_database_id_DOI      10.1093/protein/11.4.253 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ory, J.J.'       1 ? 
primary 'Mazhary, A.'     2 ? 
primary 'Kuang, H.'       3 ? 
primary 'Davies, R.R.'    4 ? 
primary 'Distefano, M.D.' 5 ? 
primary 'Banaszak, L.J.'  6 ? 
# 
_cell.entry_id           1A18 
_cell.length_a           80.020 
_cell.length_b           97.150 
_cell.length_c           49.850 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1A18 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'ADIPOCYTE LIPID BINDING PROTEIN' 14774.931 1  ? ? ? 
'PROTEIN MODIFIED BY REACTION WITH IODOACETAMIDO-1,10-PHENANTHROLINE' 
2 water   nat water                             18.015    38 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ALBP-PHEN 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;CDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDLVTIRSESTFKNTEISFKLGVEFDEITADDRKV
KSIITLDGGALVQVQKWDGKSTTIKRKRDGDKLVVE(NPH)VMKGVTSTRVYERA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;CDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDLVTIRSESTFKNTEISFKLGVEFDEITADDRKV
KSIITLDGGALVQVQKWDGKSTTIKRKRDGDKLVVECVMKGVTSTRVYERA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   CYS n 
1 2   ASP n 
1 3   ALA n 
1 4   PHE n 
1 5   VAL n 
1 6   GLY n 
1 7   THR n 
1 8   TRP n 
1 9   LYS n 
1 10  LEU n 
1 11  VAL n 
1 12  SER n 
1 13  SER n 
1 14  GLU n 
1 15  ASN n 
1 16  PHE n 
1 17  ASP n 
1 18  ASP n 
1 19  TYR n 
1 20  MET n 
1 21  LYS n 
1 22  GLU n 
1 23  VAL n 
1 24  GLY n 
1 25  VAL n 
1 26  GLY n 
1 27  PHE n 
1 28  ALA n 
1 29  THR n 
1 30  ARG n 
1 31  LYS n 
1 32  VAL n 
1 33  ALA n 
1 34  GLY n 
1 35  MET n 
1 36  ALA n 
1 37  LYS n 
1 38  PRO n 
1 39  ASN n 
1 40  MET n 
1 41  ILE n 
1 42  ILE n 
1 43  SER n 
1 44  VAL n 
1 45  ASN n 
1 46  GLY n 
1 47  ASP n 
1 48  LEU n 
1 49  VAL n 
1 50  THR n 
1 51  ILE n 
1 52  ARG n 
1 53  SER n 
1 54  GLU n 
1 55  SER n 
1 56  THR n 
1 57  PHE n 
1 58  LYS n 
1 59  ASN n 
1 60  THR n 
1 61  GLU n 
1 62  ILE n 
1 63  SER n 
1 64  PHE n 
1 65  LYS n 
1 66  LEU n 
1 67  GLY n 
1 68  VAL n 
1 69  GLU n 
1 70  PHE n 
1 71  ASP n 
1 72  GLU n 
1 73  ILE n 
1 74  THR n 
1 75  ALA n 
1 76  ASP n 
1 77  ASP n 
1 78  ARG n 
1 79  LYS n 
1 80  VAL n 
1 81  LYS n 
1 82  SER n 
1 83  ILE n 
1 84  ILE n 
1 85  THR n 
1 86  LEU n 
1 87  ASP n 
1 88  GLY n 
1 89  GLY n 
1 90  ALA n 
1 91  LEU n 
1 92  VAL n 
1 93  GLN n 
1 94  VAL n 
1 95  GLN n 
1 96  LYS n 
1 97  TRP n 
1 98  ASP n 
1 99  GLY n 
1 100 LYS n 
1 101 SER n 
1 102 THR n 
1 103 THR n 
1 104 ILE n 
1 105 LYS n 
1 106 ARG n 
1 107 LYS n 
1 108 ARG n 
1 109 ASP n 
1 110 GLY n 
1 111 ASP n 
1 112 LYS n 
1 113 LEU n 
1 114 VAL n 
1 115 VAL n 
1 116 GLU n 
1 117 NPH n 
1 118 VAL n 
1 119 MET n 
1 120 LYS n 
1 121 GLY n 
1 122 VAL n 
1 123 THR n 
1 124 SER n 
1 125 THR n 
1 126 ARG n 
1 127 VAL n 
1 128 TYR n 
1 129 GLU n 
1 130 ARG n 
1 131 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ADIPOCYTE 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'SEE DAVIES AND DISTEFANO, JACS 119, 11643- 11652 (1977)' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FABPA_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04117 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;CDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDLVTIRSESTFKNTEISFKLGVEFDEITADDRKV
KSIITLDGGALVQVQKWDGKSTTIKRKRDGDKLVVECVMKGVTSTRVYERA
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1A18 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 131 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04117 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  131 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       131 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1A18 
_struct_ref_seq_dif.mon_id                       NPH 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      117 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P04117 
_struct_ref_seq_dif.db_mon_id                    CYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          117 
_struct_ref_seq_dif.details                      'modified residue' 
_struct_ref_seq_dif.pdbx_auth_seq_num            117 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                          ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                         ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                       ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                  ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                         ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                        ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                  ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                          ? 'C2 H5 N O2'      75.067  
HOH non-polymer         . WATER                                            ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                       ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                          ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                           ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                       ? 'C5 H11 N O2 S'   149.211 
NPH 'L-peptide linking' n CYSTEINE-METHYLENE-CARBAMOYL-1,10-PHENANTHROLINE ? 'C17 H16 N4 O3 S' 356.399 
PHE 'L-peptide linking' y PHENYLALANINE                                    ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                          ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                           ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                        ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                       ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                         ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                           ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1A18 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.2 
_exptl_crystal.density_percent_sol   45.6 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 6.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   1996-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1A18 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25. 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   7640 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0780000 
_reflns.pdbx_netI_over_sigmaI        13.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.5 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.37 
_reflns_shell.d_res_low              2.52 
_reflns_shell.percent_possible_all   62.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.3250000 
_reflns_shell.meanI_over_sigI_obs    2.3 
_reflns_shell.pdbx_redundancy        2.0 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1A18 
_refine.ls_number_reflns_obs                     7615 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               1000000. 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25. 
_refine.ls_d_res_high                            2.4 
_refine.ls_percent_reflns_obs                    96.3 
_refine.ls_R_factor_obs                          0.1960000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1960000 
_refine.ls_R_factor_R_free                       0.2730000 
_refine.ls_R_factor_R_free_error                 0.0124 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 6.4 
_refine.ls_number_reflns_R_free                  498 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1LIB' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1035 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             38 
_refine_hist.number_atoms_total               1073 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        25. 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.4 
_refine_ls_shell.d_res_low                        2.51 
_refine_ls_shell.number_reflns_R_work             651 
_refine_ls_shell.R_factor_R_work                  0.3270000 
_refine_ls_shell.percent_reflns_obs               75. 
_refine_ls_shell.R_factor_R_free                  0.4240000 
_refine_ls_shell.R_factor_R_free_error            0.05 
_refine_ls_shell.percent_reflns_R_free            8.6 
_refine_ls_shell.number_reflns_R_free             43 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PHN.PARAM    PHN.TOPPAR   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1A18 
_struct.title                     'PHENANTHROLINE MODIFIED MURINE ADIPOCYTE LIPID BINDING PROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1A18 
_struct_keywords.pdbx_keywords   'FATTY ACID BINDING PROTEIN' 
_struct_keywords.text            'FATTY ACID BINDING PROTEIN, TRANSPORT, PHOSPHORYLATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 2  ? PHE A 4  ? ASP A 2  PHE A 4  5 ? 3 
HELX_P HELX_P2 2 PHE A 16 ? VAL A 23 ? PHE A 16 VAL A 23 1 ? 8 
HELX_P HELX_P3 3 PHE A 27 ? GLY A 34 ? PHE A 27 GLY A 34 1 ? 8 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A GLU 116 C ? ? ? 1_555 A NPH 117 N ? ? A GLU 116 A NPH 117 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale2 covale both ? A NPH 117 C ? ? ? 1_555 A VAL 118 N ? ? A NPH 117 A VAL 118 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   10 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? anti-parallel 
A 2 3  ? anti-parallel 
A 3 4  ? anti-parallel 
A 4 5  ? anti-parallel 
A 5 6  ? anti-parallel 
A 6 7  ? anti-parallel 
A 7 8  ? anti-parallel 
A 8 9  ? anti-parallel 
A 9 10 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  THR A 60  ? PHE A 64  ? THR A 60  PHE A 64  
A 2  LEU A 48  ? GLU A 54  ? LEU A 48  GLU A 54  
A 3  ASN A 39  ? ASN A 45  ? ASN A 39  ASN A 45  
A 4  GLY A 6   ? GLU A 14  ? GLY A 6   GLU A 14  
A 5  VAL A 122 ? ARG A 130 ? VAL A 122 ARG A 130 
A 6  LYS A 112 ? MET A 119 ? LYS A 112 MET A 119 
A 7  LYS A 100 ? ASP A 109 ? LYS A 100 ASP A 109 
A 8  ALA A 90  ? TRP A 97  ? ALA A 90  TRP A 97  
A 9  LYS A 79  ? ASP A 87  ? LYS A 79  ASP A 87  
A 10 PHE A 70  ? ILE A 73  ? PHE A 70  ILE A 73  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  O THR A 60  ? O THR A 60  N SER A 53  ? N SER A 53  
A 2 3  O LEU A 48  ? O LEU A 48  N ASN A 45  ? N ASN A 45  
A 3 4  O MET A 40  ? O MET A 40  N TRP A 8   ? N TRP A 8   
A 4 5  O LYS A 9   ? O LYS A 9   N GLU A 129 ? N GLU A 129 
A 5 6  O VAL A 122 ? O VAL A 122 N MET A 119 ? N MET A 119 
A 6 7  O LYS A 112 ? O LYS A 112 N ASP A 109 ? N ASP A 109 
A 7 8  O LYS A 100 ? O LYS A 100 N TRP A 97  ? N TRP A 97  
A 8 9  O ALA A 90  ? O ALA A 90  N ASP A 87  ? N ASP A 87  
A 9 10 O VAL A 80  ? O VAL A 80  N GLU A 72  ? N GLU A 72  
# 
_database_PDB_matrix.entry_id          1A18 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1A18 
_atom_sites.fract_transf_matrix[1][1]   0.012497 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010293 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020060 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   CYS 1   1   1   CYS CYS A . n 
A 1 2   ASP 2   2   2   ASP ASP A . n 
A 1 3   ALA 3   3   3   ALA ALA A . n 
A 1 4   PHE 4   4   4   PHE PHE A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   GLY 6   6   6   GLY GLY A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   TRP 8   8   8   TRP TRP A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  ASN 15  15  15  ASN ASN A . n 
A 1 16  PHE 16  16  16  PHE PHE A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  TYR 19  19  19  TYR TYR A . n 
A 1 20  MET 20  20  20  MET MET A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  VAL 23  23  23  VAL VAL A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  PHE 27  27  27  PHE PHE A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  ARG 30  30  30  ARG ARG A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  MET 35  35  35  MET MET A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  MET 40  40  40  MET MET A . n 
A 1 41  ILE 41  41  41  ILE ILE A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  ASN 45  45  45  ASN ASN A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  ILE 51  51  51  ILE ILE A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  PHE 57  57  57  PHE PHE A . n 
A 1 58  LYS 58  58  58  LYS LYS A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  PHE 70  70  70  PHE PHE A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  THR 85  85  85  THR THR A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  GLN 93  93  93  GLN GLN A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  TRP 97  97  97  TRP TRP A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 LYS 105 105 105 LYS LYS A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 ASP 109 109 109 ASP ASP A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 ASP 111 111 111 ASP ASP A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 NPH 117 117 117 NPH NPH A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 MET 119 119 119 MET MET A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 THR 125 125 125 THR THR A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 TYR 128 128 128 TYR TYR A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 ARG 130 130 130 ARG ARG A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  1001 1001 HOH HOH A . 
B 2 HOH 2  1002 1002 HOH HOH A . 
B 2 HOH 3  1003 1003 HOH HOH A . 
B 2 HOH 4  1004 1004 HOH HOH A . 
B 2 HOH 5  1005 1005 HOH HOH A . 
B 2 HOH 6  1006 1006 HOH HOH A . 
B 2 HOH 7  1007 1007 HOH HOH A . 
B 2 HOH 8  1008 1008 HOH HOH A . 
B 2 HOH 9  1009 1009 HOH HOH A . 
B 2 HOH 10 1010 1010 HOH HOH A . 
B 2 HOH 11 1011 1011 HOH HOH A . 
B 2 HOH 12 1012 1012 HOH HOH A . 
B 2 HOH 13 1013 1013 HOH HOH A . 
B 2 HOH 14 1014 1014 HOH HOH A . 
B 2 HOH 15 1015 1015 HOH HOH A . 
B 2 HOH 16 1016 1016 HOH HOH A . 
B 2 HOH 17 1017 1017 HOH HOH A . 
B 2 HOH 18 1018 1018 HOH HOH A . 
B 2 HOH 19 1019 1019 HOH HOH A . 
B 2 HOH 20 1020 1020 HOH HOH A . 
B 2 HOH 21 1021 1021 HOH HOH A . 
B 2 HOH 22 1022 1022 HOH HOH A . 
B 2 HOH 23 1023 1023 HOH HOH A . 
B 2 HOH 24 1024 1024 HOH HOH A . 
B 2 HOH 25 1026 1026 HOH HOH A . 
B 2 HOH 26 1027 1027 HOH HOH A . 
B 2 HOH 27 1028 1028 HOH HOH A . 
B 2 HOH 28 2001 2001 HOH HOH A . 
B 2 HOH 29 2002 2002 HOH HOH A . 
B 2 HOH 30 2003 2003 HOH HOH A . 
B 2 HOH 31 2004 2004 HOH HOH A . 
B 2 HOH 32 3001 3001 HOH HOH A . 
B 2 HOH 33 3002 3002 HOH HOH A . 
B 2 HOH 34 3003 3003 HOH HOH A . 
B 2 HOH 35 3004 3004 HOH HOH A . 
B 2 HOH 36 3005 3005 HOH HOH A . 
B 2 HOH 37 3006 3006 HOH HOH A . 
B 2 HOH 38 3007 3007 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    NPH 
_pdbx_struct_mod_residue.label_seq_id     117 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     NPH 
_pdbx_struct_mod_residue.auth_seq_id      117 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   CYS 
_pdbx_struct_mod_residue.details          ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_553 x,-y,-z-2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -99.7000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     1023 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   B 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-07-01 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2023-08-02 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Atomic model'              
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' Other                       
7 4 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' atom_site                     
2 4 'Structure model' database_2                    
3 4 'Structure model' pdbx_database_status          
4 4 'Structure model' pdbx_initial_refinement_model 
5 4 'Structure model' struct_conn                   
6 4 'Structure model' struct_ref_seq_dif            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.occupancy'                
2  4 'Structure model' '_database_2.pdbx_DOI'                
3  4 'Structure model' '_database_2.pdbx_database_accession' 
4  4 'Structure model' '_pdbx_database_status.process_site'  
5  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6  4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
7  4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
8  4 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
9  4 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
13 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
14 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
15 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
16 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' .     ? 1 
X-PLOR refinement       3.843 ? 2 
XENGEN 'data reduction' .     ? 3 
XENGEN 'data scaling'   .     ? 4 
X-PLOR phasing          .     ? 5 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   1LIB 
_pdbx_initial_refinement_model.details          'PDB ENTRY 1LIB' 
#