data_1A1W # _entry.id 1A1W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1A1W pdb_00001a1w 10.2210/pdb1a1w/pdb WWPDB D_1000170290 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1A1W _pdbx_database_status.recvd_initial_deposition_date 1997-12-18 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Eberstadt, M.' 1 'Huang, B.' 2 'Chen, Z.' 3 'Meadows, R.P.' 4 'Ng, C.' 5 'Fesik, S.W.' 6 # _citation.id primary _citation.title 'NMR structure and mutagenesis of the FADD (Mort1) death-effector domain.' _citation.journal_abbrev Nature _citation.journal_volume 392 _citation.page_first 941 _citation.page_last 945 _citation.year 1998 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9582077 _citation.pdbx_database_id_DOI 10.1038/31972 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Eberstadt, M.' 1 ? primary 'Huang, B.' 2 ? primary 'Chen, Z.' 3 ? primary 'Meadows, R.P.' 4 ? primary 'Ng, S.C.' 5 ? primary 'Zheng, L.' 6 ? primary 'Lenardo, M.J.' 7 ? primary 'Fesik, S.W.' 8 ? # _cell.entry_id 1A1W _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1A1W _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'FADD PROTEIN' _entity.formula_weight 10651.189 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation F25Y _entity.pdbx_fragment 'DEATH EFFECTOR DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FAS-ASSOCIATING DEATH DOMAIN-CONTAINING PROTEIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDPFLVLLHSVSSSLSSSELTELKYLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVD DFELEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDPFLVLLHSVSSSLSSSELTELKYLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVD DFELEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 PRO n 1 4 PHE n 1 5 LEU n 1 6 VAL n 1 7 LEU n 1 8 LEU n 1 9 HIS n 1 10 SER n 1 11 VAL n 1 12 SER n 1 13 SER n 1 14 SER n 1 15 LEU n 1 16 SER n 1 17 SER n 1 18 SER n 1 19 GLU n 1 20 LEU n 1 21 THR n 1 22 GLU n 1 23 LEU n 1 24 LYS n 1 25 TYR n 1 26 LEU n 1 27 CYS n 1 28 LEU n 1 29 GLY n 1 30 ARG n 1 31 VAL n 1 32 GLY n 1 33 LYS n 1 34 ARG n 1 35 LYS n 1 36 LEU n 1 37 GLU n 1 38 ARG n 1 39 VAL n 1 40 GLN n 1 41 SER n 1 42 GLY n 1 43 LEU n 1 44 ASP n 1 45 LEU n 1 46 PHE n 1 47 SER n 1 48 MET n 1 49 LEU n 1 50 LEU n 1 51 GLU n 1 52 GLN n 1 53 ASN n 1 54 ASP n 1 55 LEU n 1 56 GLU n 1 57 PRO n 1 58 GLY n 1 59 HIS n 1 60 THR n 1 61 GLU n 1 62 LEU n 1 63 LEU n 1 64 ARG n 1 65 GLU n 1 66 LEU n 1 67 LEU n 1 68 ALA n 1 69 SER n 1 70 LEU n 1 71 ARG n 1 72 ARG n 1 73 HIS n 1 74 ASP n 1 75 LEU n 1 76 LEU n 1 77 ARG n 1 78 ARG n 1 79 VAL n 1 80 ASP n 1 81 ASP n 1 82 PHE n 1 83 GLU n 1 84 LEU n 1 85 GLU n 1 86 HIS n 1 87 HIS n 1 88 HIS n 1 89 HIS n 1 90 HIS n 1 91 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'HMS174 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PROKARYOTIC _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'SYNTHETIC GENE' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FADD_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q13158 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVD DFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAH LVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1A1W _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13158 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 83 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 83 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1A1W _struct_ref_seq_dif.mon_id TYR _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 25 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q13158 _struct_ref_seq_dif.db_mon_id PHE _struct_ref_seq_dif.pdbx_seq_db_seq_num 25 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 25 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type 'SEE MANUSCRIPT' _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 4.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 'SEE MANUSCRIPT' Bruker 500 2 'SEE MANUSCRIPT' Bruker 600 3 'SEE MANUSCRIPT' Bruker 750 # _pdbx_nmr_refine.entry_id 1A1W _pdbx_nmr_refine.method 'DISTANCE GEOMETRY/ SIMULATED ANNEALING' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1A1W _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version 3.1 _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1A1W _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1A1W _struct.title 'FADD DEATH EFFECTOR DOMAIN, F25Y MUTANT, NMR MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1A1W _struct_keywords.pdbx_keywords APOPTOSIS _struct_keywords.text 'APOPTOSIS, DEATH EFFECTOR DOMAIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 3 ? SER A 13 ? PRO A 3 SER A 13 1 ? 11 HELX_P HELX_P2 2 SER A 16 ? ARG A 30 ? SER A 16 ARG A 30 1 ? 15 HELX_P HELX_P3 3 ARG A 34 ? ARG A 38 ? ARG A 34 ARG A 38 1 ? 5 HELX_P HELX_P4 4 LEU A 43 ? GLU A 51 ? LEU A 43 GLU A 51 1 ? 9 HELX_P HELX_P5 5 GLU A 61 ? LEU A 70 ? GLU A 61 LEU A 70 1 ? 10 HELX_P HELX_P6 6 ASP A 74 ? ASP A 81 ? ASP A 74 ASP A 81 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1A1W _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1A1W _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LEU 84 84 ? ? ? A . n A 1 85 GLU 85 85 ? ? ? A . n A 1 86 HIS 86 86 ? ? ? A . n A 1 87 HIS 87 87 ? ? ? A . n A 1 88 HIS 88 88 ? ? ? A . n A 1 89 HIS 89 89 ? ? ? A . n A 1 90 HIS 90 90 ? ? ? A . n A 1 91 HIS 91 91 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-12-30 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -175.61 82.45 2 1 SER A 16 ? ? 66.82 173.99 3 1 LEU A 28 ? ? -54.79 97.38 4 1 GLN A 40 ? ? -156.00 -44.99 5 1 GLN A 52 ? ? -171.58 97.68 6 1 ASN A 53 ? ? -176.96 -72.54 7 1 ASP A 54 ? ? -167.41 40.93 8 1 HIS A 59 ? ? -167.71 91.64 9 1 HIS A 73 ? ? -156.38 -46.73 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 30 ? ? 0.273 'SIDE CHAIN' 2 1 ARG A 34 ? ? 0.218 'SIDE CHAIN' 3 1 ARG A 38 ? ? 0.227 'SIDE CHAIN' 4 1 ARG A 64 ? ? 0.253 'SIDE CHAIN' 5 1 ARG A 71 ? ? 0.277 'SIDE CHAIN' 6 1 ARG A 72 ? ? 0.309 'SIDE CHAIN' 7 1 ARG A 77 ? ? 0.315 'SIDE CHAIN' 8 1 ARG A 78 ? ? 0.264 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 84 ? A LEU 84 2 1 Y 1 A GLU 85 ? A GLU 85 3 1 Y 1 A HIS 86 ? A HIS 86 4 1 Y 1 A HIS 87 ? A HIS 87 5 1 Y 1 A HIS 88 ? A HIS 88 6 1 Y 1 A HIS 89 ? A HIS 89 7 1 Y 1 A HIS 90 ? A HIS 90 8 1 Y 1 A HIS 91 ? A HIS 91 #