data_1A1X # _entry.id 1A1X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1A1X WWPDB D_1000170291 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1A1X _pdbx_database_status.recvd_initial_deposition_date 1997-12-18 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fu, Z.Q.' 1 'Dubois, G.C.' 2 'Song, S.P.' 3 'Kulikovskaya, I.' 4 'Virgilio, L.' 5 'Rothstein, J.' 6 'Croce, C.M.' 7 'Weber, I.T.' 8 'Harrison, R.W.' 9 # _citation.id primary _citation.title 'Crystal structure of MTCP-1: implications for role of TCL-1 and MTCP-1 in T cell malignancies.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 95 _citation.page_first 3413 _citation.page_last 3418 _citation.year 1998 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9520380 _citation.pdbx_database_id_DOI 10.1073/pnas.95.7.3413 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Fu, Z.Q.' 1 primary 'Du Bois, G.C.' 2 primary 'Song, S.P.' 3 primary 'Kulikovskaya, I.' 4 primary 'Virgilio, L.' 5 primary 'Rothstein, J.L.' 6 primary 'Croce, C.M.' 7 primary 'Weber, I.T.' 8 primary 'Harrison, R.W.' 9 # _cell.entry_id 1A1X _cell.length_a 62.665 _cell.length_b 62.665 _cell.length_c 85.962 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1A1X _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man HMTCP-1 12627.200 1 ? ? ? ? 2 water nat water 18.015 24 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMD NNSRLWQIQHHLMVRGVQELLLKLLPDD ; _entity_poly.pdbx_seq_one_letter_code_can ;GSAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMD NNSRLWQIQHHLMVRGVQELLLKLLPDD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 GLY n 1 5 GLU n 1 6 ASP n 1 7 VAL n 1 8 GLY n 1 9 ALA n 1 10 PRO n 1 11 PRO n 1 12 ASP n 1 13 HIS n 1 14 LEU n 1 15 TRP n 1 16 VAL n 1 17 HIS n 1 18 GLN n 1 19 GLU n 1 20 GLY n 1 21 ILE n 1 22 TYR n 1 23 ARG n 1 24 ASP n 1 25 GLU n 1 26 TYR n 1 27 GLN n 1 28 ARG n 1 29 THR n 1 30 TRP n 1 31 VAL n 1 32 ALA n 1 33 VAL n 1 34 VAL n 1 35 GLU n 1 36 GLU n 1 37 GLU n 1 38 THR n 1 39 SER n 1 40 PHE n 1 41 LEU n 1 42 ARG n 1 43 ALA n 1 44 ARG n 1 45 VAL n 1 46 GLN n 1 47 GLN n 1 48 ILE n 1 49 GLN n 1 50 VAL n 1 51 PRO n 1 52 LEU n 1 53 GLY n 1 54 ASP n 1 55 ALA n 1 56 ALA n 1 57 ARG n 1 58 PRO n 1 59 SER n 1 60 HIS n 1 61 LEU n 1 62 LEU n 1 63 THR n 1 64 SER n 1 65 GLN n 1 66 LEU n 1 67 PRO n 1 68 LEU n 1 69 MET n 1 70 TRP n 1 71 GLN n 1 72 LEU n 1 73 TYR n 1 74 PRO n 1 75 GLU n 1 76 GLU n 1 77 ARG n 1 78 TYR n 1 79 MET n 1 80 ASP n 1 81 ASN n 1 82 ASN n 1 83 SER n 1 84 ARG n 1 85 LEU n 1 86 TRP n 1 87 GLN n 1 88 ILE n 1 89 GLN n 1 90 HIS n 1 91 HIS n 1 92 LEU n 1 93 MET n 1 94 VAL n 1 95 ARG n 1 96 GLY n 1 97 VAL n 1 98 GLN n 1 99 GLU n 1 100 LEU n 1 101 LEU n 1 102 LEU n 1 103 LYS n 1 104 LEU n 1 105 LEU n 1 106 PRO n 1 107 ASP n 1 108 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MTCPB_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P56278 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDN NSRLWQIQHHLMVRGVQELLLKLLPDD ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1A1X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P56278 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 107 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 108 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1A1X _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.0 _exptl_crystal.density_percent_sol 37. _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.8 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'PROTEIN WAS CRYSTALLIZED FROM 1.5M AMS WITH TRIZMA BUFFER AT PH 7.8' # _diffrn.id 1 _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type RIGAKU _diffrn_detector.pdbx_collection_date 1997-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'NI FILTER' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1A1X _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 21.0 _reflns.d_resolution_high 2.0 _reflns.number_obs 7194 _reflns.number_all ? _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.0470000 _reflns.pdbx_netI_over_sigmaI 15.1 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 5.9 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 99.3 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.1470000 _reflns_shell.meanI_over_sigI_obs 7.6 _reflns_shell.pdbx_redundancy 5.4 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1A1X _refine.ls_number_reflns_obs 6733 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 1000000.0 _refine.pdbx_data_cutoff_low_absF 0.001 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6.5 _refine.ls_d_res_high 2.0 _refine.ls_percent_reflns_obs 99.7 _refine.ls_R_factor_obs 0.2110000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2110000 _refine.ls_R_factor_R_free 0.2530000 _refine.ls_R_factor_R_free_error 0.01 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 8.6 _refine.ls_number_reflns_R_free 582 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 22.01 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MAD PHASING' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 881 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 905 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 6.5 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.396 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 26.92 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.192 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 2.157 1.50 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 3.319 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 4.210 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 6.231 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 2.00 _refine_ls_shell.d_res_low 2.09 _refine_ls_shell.number_reflns_R_work 739 _refine_ls_shell.R_factor_R_work 0.2550000 _refine_ls_shell.percent_reflns_obs 99.3 _refine_ls_shell.R_factor_R_free 0.2680000 _refine_ls_shell.R_factor_R_free_error 0.031 _refine_ls_shell.percent_reflns_R_free 8.7 _refine_ls_shell.number_reflns_R_free 73 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 2 TIP3P.PARAMETER TIP3P.TOPOLOGY 'X-RAY DIFFRACTION' # _struct.entry_id 1A1X _struct.title 'CRYSTAL STRUCTURE OF MTCP-1 INVOLVED IN T CELL MALIGNANCIES' _struct.pdbx_descriptor HMTCP-1 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1A1X _struct_keywords.pdbx_keywords PROTO-ONCOGENE _struct_keywords.text 'MTCP-1, ONCOGENE INVOLVED IN T CELL MALIGNANCIES, PROTO-ONCOGENE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 58 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id THR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 63 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 58 _struct_conf.end_auth_comp_id THR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 63 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 13 ? TRP A 15 ? HIS A 13 TRP A 15 A 2 MET A 69 ? TYR A 73 ? MET A 69 TYR A 73 A 3 ARG A 77 ? ASP A 80 ? ARG A 77 ASP A 80 A 4 LEU A 85 ? VAL A 94 ? LEU A 85 VAL A 94 A 5 VAL A 97 ? LEU A 104 ? VAL A 97 LEU A 104 A 6 LEU A 41 ? GLN A 46 ? LEU A 41 GLN A 46 A 7 THR A 29 ? GLU A 36 ? THR A 29 GLU A 36 A 8 ILE A 21 ? ASP A 24 ? ILE A 21 ASP A 24 A 9 LEU A 14 ? GLN A 18 ? LEU A 14 GLN A 18 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 14 ? O LEU A 14 N TRP A 70 ? N TRP A 70 A 2 3 O GLN A 71 ? O GLN A 71 N MET A 79 ? N MET A 79 A 3 4 O TYR A 78 ? O TYR A 78 N TRP A 86 ? N TRP A 86 A 4 5 O GLN A 87 ? O GLN A 87 N LYS A 103 ? N LYS A 103 A 5 6 O LEU A 100 ? O LEU A 100 N VAL A 45 ? N VAL A 45 A 6 7 O ARG A 42 ? O ARG A 42 N GLU A 35 ? N GLU A 35 A 7 8 O TRP A 30 ? O TRP A 30 N TYR A 22 ? N TYR A 22 A 8 9 O ILE A 21 ? O ILE A 21 N GLN A 18 ? N GLN A 18 # _database_PDB_matrix.entry_id 1A1X _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1A1X _atom_sites.fract_transf_matrix[1][1] 0.015958 _atom_sites.fract_transf_matrix[1][2] 0.009213 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018427 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011633 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 TRP 15 15 15 TRP TRP A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 TRP 70 70 70 TRP TRP A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 HIS 91 91 91 HIS HIS A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 ASP 108 108 108 ASP ASP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 31.3325000000 0.0000000000 -1.0000000000 0.0000000000 54.2694819282 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-05-27 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MADSYS phasing . ? 1 X-PLOR 'model building' 3.8 ? 2 X-PLOR refinement 3.8 ? 3 DENZO 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 X-PLOR phasing 3.8 ? 6 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 75 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 76.92 _pdbx_validate_torsion.psi 37.60 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A SER 2 ? A SER 2 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 201 HOH HOH A . B 2 HOH 2 202 202 HOH HOH A . B 2 HOH 3 203 203 HOH HOH A . B 2 HOH 4 204 204 HOH HOH A . B 2 HOH 5 205 205 HOH HOH A . B 2 HOH 6 206 206 HOH HOH A . B 2 HOH 7 207 207 HOH HOH A . B 2 HOH 8 208 208 HOH HOH A . B 2 HOH 9 209 209 HOH HOH A . B 2 HOH 10 210 210 HOH HOH A . B 2 HOH 11 211 211 HOH HOH A . B 2 HOH 12 212 212 HOH HOH A . B 2 HOH 13 213 213 HOH HOH A . B 2 HOH 14 214 214 HOH HOH A . B 2 HOH 15 215 215 HOH HOH A . B 2 HOH 16 216 216 HOH HOH A . B 2 HOH 17 217 217 HOH HOH A . B 2 HOH 18 218 218 HOH HOH A . B 2 HOH 19 219 219 HOH HOH A . B 2 HOH 20 220 220 HOH HOH A . B 2 HOH 21 221 221 HOH HOH A . B 2 HOH 22 222 222 HOH HOH A . B 2 HOH 23 223 223 HOH HOH A . B 2 HOH 24 224 224 HOH HOH A . #