data_1A2B # _entry.id 1A2B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1A2B pdb_00001a2b 10.2210/pdb1a2b/pdb WWPDB D_1000170305 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1A2B _pdbx_database_status.recvd_initial_deposition_date 1997-12-26 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ihara, K.' 1 'Muraguchi, S.' 2 'Kato, M.' 3 'Shimizu, T.' 4 'Shirakawa, M.' 5 'Kuroda, S.' 6 'Kaibuchi, K.' 7 'Hakoshima, T.' 8 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystal structure of human RhoA in a dominantly active form complexed with a GTP analogue.' J.Biol.Chem. 273 9656 9666 1998 JBCHA3 US 0021-9258 0071 ? 9545299 10.1074/jbc.273.16.9656 1 ;Refined Crystal Structure of the Triphosphate Conformation of H-Ras P21 at 1.35 A Resolution: Implications for the Mechanism of GTP Hydrolysis ; 'Embo J.' 9 2351 ? 1990 EMJODG UK 0261-4189 0897 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ihara, K.' 1 ? primary 'Muraguchi, S.' 2 ? primary 'Kato, M.' 3 ? primary 'Shimizu, T.' 4 ? primary 'Shirakawa, M.' 5 ? primary 'Kuroda, S.' 6 ? primary 'Kaibuchi, K.' 7 ? primary 'Hakoshima, T.' 8 ? 1 'Pai, E.F.' 9 ? 1 'Krengel, U.' 10 ? 1 'Petsko, G.A.' 11 ? 1 'Goody, R.S.' 12 ? 1 'Kabsch, W.' 13 ? 1 'Wittinghofer, A.' 14 ? # _cell.entry_id 1A2B _cell.length_a 62.020 _cell.length_b 74.780 _cell.length_c 50.520 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1A2B _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TRANSFORMING PROTEIN RHOA' 20596.615 1 ? 'G14V, RESIDUES 1 - 181 WERE CLONED, THE N-TERMINUS CONTAINS A HIS-TAG' 'RESIDUES 1 - 181' 'COMPLEXED WITH ONE GTPGAMMAS AND ONE MG ION' 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn "5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE" 539.246 1 ? ? ? ? 4 water nat water 18.015 38 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMAAIRKKLVIVGDVACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDV ILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMEC SAKTKDGVREVFEMATRAALQA ; _entity_poly.pdbx_seq_one_letter_code_can ;SMAAIRKKLVIVGDVACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDV ILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMEC SAKTKDGVREVFEMATRAALQA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 ALA n 1 4 ALA n 1 5 ILE n 1 6 ARG n 1 7 LYS n 1 8 LYS n 1 9 LEU n 1 10 VAL n 1 11 ILE n 1 12 VAL n 1 13 GLY n 1 14 ASP n 1 15 VAL n 1 16 ALA n 1 17 CYS n 1 18 GLY n 1 19 LYS n 1 20 THR n 1 21 CYS n 1 22 LEU n 1 23 LEU n 1 24 ILE n 1 25 VAL n 1 26 PHE n 1 27 SER n 1 28 LYS n 1 29 ASP n 1 30 GLN n 1 31 PHE n 1 32 PRO n 1 33 GLU n 1 34 VAL n 1 35 TYR n 1 36 VAL n 1 37 PRO n 1 38 THR n 1 39 VAL n 1 40 PHE n 1 41 GLU n 1 42 ASN n 1 43 TYR n 1 44 VAL n 1 45 ALA n 1 46 ASP n 1 47 ILE n 1 48 GLU n 1 49 VAL n 1 50 ASP n 1 51 GLY n 1 52 LYS n 1 53 GLN n 1 54 VAL n 1 55 GLU n 1 56 LEU n 1 57 ALA n 1 58 LEU n 1 59 TRP n 1 60 ASP n 1 61 THR n 1 62 ALA n 1 63 GLY n 1 64 GLN n 1 65 GLU n 1 66 ASP n 1 67 TYR n 1 68 ASP n 1 69 ARG n 1 70 LEU n 1 71 ARG n 1 72 PRO n 1 73 LEU n 1 74 SER n 1 75 TYR n 1 76 PRO n 1 77 ASP n 1 78 THR n 1 79 ASP n 1 80 VAL n 1 81 ILE n 1 82 LEU n 1 83 MET n 1 84 CYS n 1 85 PHE n 1 86 SER n 1 87 ILE n 1 88 ASP n 1 89 SER n 1 90 PRO n 1 91 ASP n 1 92 SER n 1 93 LEU n 1 94 GLU n 1 95 ASN n 1 96 ILE n 1 97 PRO n 1 98 GLU n 1 99 LYS n 1 100 TRP n 1 101 THR n 1 102 PRO n 1 103 GLU n 1 104 VAL n 1 105 LYS n 1 106 HIS n 1 107 PHE n 1 108 CYS n 1 109 PRO n 1 110 ASN n 1 111 VAL n 1 112 PRO n 1 113 ILE n 1 114 ILE n 1 115 LEU n 1 116 VAL n 1 117 GLY n 1 118 ASN n 1 119 LYS n 1 120 LYS n 1 121 ASP n 1 122 LEU n 1 123 ARG n 1 124 ASN n 1 125 ASP n 1 126 GLU n 1 127 HIS n 1 128 THR n 1 129 ARG n 1 130 ARG n 1 131 GLU n 1 132 LEU n 1 133 ALA n 1 134 LYS n 1 135 MET n 1 136 LYS n 1 137 GLN n 1 138 GLU n 1 139 PRO n 1 140 VAL n 1 141 LYS n 1 142 PRO n 1 143 GLU n 1 144 GLU n 1 145 GLY n 1 146 ARG n 1 147 ASP n 1 148 MET n 1 149 ALA n 1 150 ASN n 1 151 ARG n 1 152 ILE n 1 153 GLY n 1 154 ALA n 1 155 PHE n 1 156 GLY n 1 157 TYR n 1 158 MET n 1 159 GLU n 1 160 CYS n 1 161 SER n 1 162 ALA n 1 163 LYS n 1 164 THR n 1 165 LYS n 1 166 ASP n 1 167 GLY n 1 168 VAL n 1 169 ARG n 1 170 GLU n 1 171 VAL n 1 172 PHE n 1 173 GLU n 1 174 MET n 1 175 ALA n 1 176 THR n 1 177 ARG n 1 178 ALA n 1 179 ALA n 1 180 LEU n 1 181 GLN n 1 182 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location CYTOSOL _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PRSET B (INVITROGEN CO.)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RHOA_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P61586 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVI LMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECS AKTKDGVREVFEMATRAALQARRGKKKSGCLVL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1A2B _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 182 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P61586 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 181 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 181 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1A2B _struct_ref_seq_dif.mon_id VAL _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 15 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P61586 _struct_ref_seq_dif.db_mon_id GLY _struct_ref_seq_dif.pdbx_seq_db_seq_num 14 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 14 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GSP non-polymer . "5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE" ? 'C10 H16 N5 O13 P3 S' 539.246 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1A2B _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.77 _exptl_crystal.density_percent_sol 56. _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_pH_range 7.5-8.5 _exptl_crystal_grow.pdbx_details ;CRYSTALS WERE OBTAINED AT 277 K BY THE HANGING-DROP VAPOR DIFFUSION METHOD FROM SOLUTIONS CONTAINING 10 MG/ML(PROTEIN,GTPGAMMAS,MG2+ MIXTURE), 10% PEG 8000,7.5% 14-DIOXANE, 50 MM TRIS-HCL PH 8.5, EQUILIBRATED AGAINST 20% PEG 8000,15% 14-DIOXANE, 100 MM TRIS-HCL PH 8.5, vapor diffusion - hanging drop ; # _diffrn.id 1 _diffrn.ambient_temp 283 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IIC' _diffrn_detector.pdbx_collection_date 1997-03 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GRAPHITE(002)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH3R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1A2B _reflns.observed_criterion_sigma_I 1. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high 2.4 _reflns.number_obs 8683 _reflns.number_all ? _reflns.percent_possible_obs 89.3 _reflns.pdbx_Rmerge_I_obs 0.0875 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 7.91 _reflns.B_iso_Wilson_estimate 31.6 _reflns.pdbx_redundancy ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.4 _reflns_shell.d_res_low 2.5 _reflns_shell.percent_possible_all 74.8 _reflns_shell.Rmerge_I_obs 0.267 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.04 _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1A2B _refine.ls_number_reflns_obs 8382 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1. _refine.pdbx_data_cutoff_high_absF 10000000. _refine.pdbx_data_cutoff_low_absF 0.0001 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 15. _refine.ls_d_res_high 2.4 _refine.ls_percent_reflns_obs 86.7 _refine.ls_R_factor_obs 0.195 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.195 _refine.ls_R_factor_R_free 0.268 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10. _refine.ls_number_reflns_R_free 893 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 43.5 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 5P21' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1417 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 1488 _refine_hist.d_res_high 2.4 _refine_hist.d_res_low 15. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.010 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.314 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 22.36 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.099 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 2.4 _refine_ls_shell.d_res_low 2.51 _refine_ls_shell.number_reflns_R_work 717 _refine_ls_shell.R_factor_R_work 0.306 _refine_ls_shell.percent_reflns_obs 66.4 _refine_ls_shell.R_factor_R_free 0.381 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 9.70 _refine_ls_shell.number_reflns_R_free 77 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 2 ? ? 'X-RAY DIFFRACTION' # _struct.entry_id 1A2B _struct.title 'HUMAN RHOA COMPLEXED WITH GTP ANALOGUE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1A2B _struct_keywords.pdbx_keywords 'ONCOGENE PROTEIN' _struct_keywords.text 'SMALL G-PROTEIN, SIGNAL TRANSDUCTION, GTPASE, RAS SUPERFAMILY, ONCOGENE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 19 ? LYS A 28 ? LYS A 18 LYS A 27 1 ? 10 HELX_P HELX_P2 2 GLU A 65 ? LEU A 73 ? GLU A 64 LEU A 72 5 ? 9 HELX_P HELX_P3 3 PRO A 90 ? GLU A 98 ? PRO A 89 GLU A 97 5 ? 9 HELX_P HELX_P4 4 TRP A 100 ? PHE A 107 ? TRP A 99 PHE A 106 1 ? 8 HELX_P HELX_P5 5 LYS A 120 ? ARG A 123 ? LYS A 119 ARG A 122 5 ? 4 HELX_P HELX_P6 6 GLU A 126 ? LYS A 134 ? GLU A 125 LYS A 133 1 ? 9 HELX_P HELX_P7 7 PRO A 142 ? ARG A 151 ? PRO A 141 ARG A 150 1 ? 10 HELX_P HELX_P8 8 VAL A 168 ? LEU A 180 ? VAL A 167 LEU A 179 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A THR 20 OG1 ? ? ? 1_555 B MG . MG ? ? A THR 19 A MG 550 1_555 ? ? ? ? ? ? ? 2.003 ? ? metalc2 metalc ? ? A THR 38 OG1 ? ? ? 1_555 B MG . MG ? ? A THR 37 A MG 550 1_555 ? ? ? ? ? ? ? 2.059 ? ? metalc3 metalc ? ? C GSP . O2G ? ? ? 1_555 B MG . MG ? ? A GSP 538 A MG 550 1_555 ? ? ? ? ? ? ? 2.270 ? ? metalc4 metalc ? ? C GSP . O2B ? ? ? 1_555 B MG . MG ? ? A GSP 538 A MG 550 1_555 ? ? ? ? ? ? ? 2.472 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 550 A HOH 604 1_555 ? ? ? ? ? ? ? 1.949 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 550 A HOH 605 1_555 ? ? ? ? ? ? ? 1.982 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 156 ? GLU A 159 ? GLY A 155 GLU A 158 A 2 PRO A 112 ? ASN A 118 ? PRO A 111 ASN A 117 A 3 VAL A 80 ? SER A 86 ? VAL A 79 SER A 85 A 4 ARG A 6 ? GLY A 13 ? ARG A 5 GLY A 12 A 5 LYS A 52 ? THR A 61 ? LYS A 51 THR A 60 A 6 PHE A 40 ? VAL A 49 ? PHE A 39 VAL A 48 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLY A 156 ? O GLY A 155 N LEU A 115 ? N LEU A 114 A 2 3 O PRO A 112 ? O PRO A 111 N ILE A 81 ? N ILE A 80 A 3 4 O VAL A 80 ? O VAL A 79 N VAL A 10 ? N VAL A 9 A 4 5 O LYS A 7 ? O LYS A 6 N GLU A 55 ? N GLU A 54 A 5 6 O LYS A 52 ? O LYS A 51 N VAL A 49 ? N VAL A 48 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 550 ? 5 'BINDING SITE FOR RESIDUE MG A 550' AC2 Software A GSP 538 ? 21 'BINDING SITE FOR RESIDUE GSP A 538' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 THR A 20 ? THR A 19 . ? 1_555 ? 2 AC1 5 THR A 38 ? THR A 37 . ? 1_555 ? 3 AC1 5 GSP C . ? GSP A 538 . ? 1_555 ? 4 AC1 5 HOH D . ? HOH A 604 . ? 1_555 ? 5 AC1 5 HOH D . ? HOH A 605 . ? 1_555 ? 6 AC2 21 ASP A 14 ? ASP A 13 . ? 1_555 ? 7 AC2 21 ALA A 16 ? ALA A 15 . ? 1_555 ? 8 AC2 21 CYS A 17 ? CYS A 16 . ? 1_555 ? 9 AC2 21 GLY A 18 ? GLY A 17 . ? 1_555 ? 10 AC2 21 LYS A 19 ? LYS A 18 . ? 1_555 ? 11 AC2 21 THR A 20 ? THR A 19 . ? 1_555 ? 12 AC2 21 CYS A 21 ? CYS A 20 . ? 1_555 ? 13 AC2 21 TYR A 35 ? TYR A 34 . ? 1_555 ? 14 AC2 21 THR A 38 ? THR A 37 . ? 1_555 ? 15 AC2 21 GLY A 63 ? GLY A 62 . ? 1_555 ? 16 AC2 21 LYS A 119 ? LYS A 118 . ? 1_555 ? 17 AC2 21 ASP A 121 ? ASP A 120 . ? 1_555 ? 18 AC2 21 LEU A 122 ? LEU A 121 . ? 1_555 ? 19 AC2 21 SER A 161 ? SER A 160 . ? 1_555 ? 20 AC2 21 ALA A 162 ? ALA A 161 . ? 1_555 ? 21 AC2 21 LYS A 163 ? LYS A 162 . ? 1_555 ? 22 AC2 21 MG B . ? MG A 550 . ? 1_555 ? 23 AC2 21 HOH D . ? HOH A 601 . ? 1_555 ? 24 AC2 21 HOH D . ? HOH A 602 . ? 1_555 ? 25 AC2 21 HOH D . ? HOH A 604 . ? 1_555 ? 26 AC2 21 HOH D . ? HOH A 605 . ? 1_555 ? # _database_PDB_matrix.entry_id 1A2B _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1A2B _atom_sites.fract_transf_matrix[1][1] 0.016124 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013373 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019794 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 0 ? ? ? A . n A 1 2 MET 2 1 ? ? ? A . n A 1 3 ALA 3 2 ? ? ? A . n A 1 4 ALA 4 3 ? ? ? A . n A 1 5 ILE 5 4 4 ILE ILE A . n A 1 6 ARG 6 5 5 ARG ARG A . n A 1 7 LYS 7 6 6 LYS LYS A . n A 1 8 LYS 8 7 7 LYS LYS A . n A 1 9 LEU 9 8 8 LEU LEU A . n A 1 10 VAL 10 9 9 VAL VAL A . n A 1 11 ILE 11 10 10 ILE ILE A . n A 1 12 VAL 12 11 11 VAL VAL A . n A 1 13 GLY 13 12 12 GLY GLY A . n A 1 14 ASP 14 13 13 ASP ASP A . n A 1 15 VAL 15 14 14 VAL VAL A . n A 1 16 ALA 16 15 15 ALA ALA A . n A 1 17 CYS 17 16 16 CYS CYS A . n A 1 18 GLY 18 17 17 GLY GLY A . n A 1 19 LYS 19 18 18 LYS LYS A . n A 1 20 THR 20 19 19 THR THR A . n A 1 21 CYS 21 20 20 CYS CYS A . n A 1 22 LEU 22 21 21 LEU LEU A . n A 1 23 LEU 23 22 22 LEU LEU A . n A 1 24 ILE 24 23 23 ILE ILE A . n A 1 25 VAL 25 24 24 VAL VAL A . n A 1 26 PHE 26 25 25 PHE PHE A . n A 1 27 SER 27 26 26 SER SER A . n A 1 28 LYS 28 27 27 LYS LYS A . n A 1 29 ASP 29 28 28 ASP ASP A . n A 1 30 GLN 30 29 29 GLN GLN A . n A 1 31 PHE 31 30 30 PHE PHE A . n A 1 32 PRO 32 31 31 PRO PRO A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 VAL 34 33 33 VAL VAL A . n A 1 35 TYR 35 34 34 TYR TYR A . n A 1 36 VAL 36 35 35 VAL VAL A . n A 1 37 PRO 37 36 36 PRO PRO A . n A 1 38 THR 38 37 37 THR THR A . n A 1 39 VAL 39 38 38 VAL VAL A . n A 1 40 PHE 40 39 39 PHE PHE A . n A 1 41 GLU 41 40 40 GLU GLU A . n A 1 42 ASN 42 41 41 ASN ASN A . n A 1 43 TYR 43 42 42 TYR TYR A . n A 1 44 VAL 44 43 43 VAL VAL A . n A 1 45 ALA 45 44 44 ALA ALA A . n A 1 46 ASP 46 45 45 ASP ASP A . n A 1 47 ILE 47 46 46 ILE ILE A . n A 1 48 GLU 48 47 47 GLU GLU A . n A 1 49 VAL 49 48 48 VAL VAL A . n A 1 50 ASP 50 49 49 ASP ASP A . n A 1 51 GLY 51 50 50 GLY GLY A . n A 1 52 LYS 52 51 51 LYS LYS A . n A 1 53 GLN 53 52 52 GLN GLN A . n A 1 54 VAL 54 53 53 VAL VAL A . n A 1 55 GLU 55 54 54 GLU GLU A . n A 1 56 LEU 56 55 55 LEU LEU A . n A 1 57 ALA 57 56 56 ALA ALA A . n A 1 58 LEU 58 57 57 LEU LEU A . n A 1 59 TRP 59 58 58 TRP TRP A . n A 1 60 ASP 60 59 59 ASP ASP A . n A 1 61 THR 61 60 60 THR THR A . n A 1 62 ALA 62 61 61 ALA ALA A . n A 1 63 GLY 63 62 62 GLY GLY A . n A 1 64 GLN 64 63 63 GLN GLN A . n A 1 65 GLU 65 64 64 GLU GLU A . n A 1 66 ASP 66 65 65 ASP ASP A . n A 1 67 TYR 67 66 66 TYR TYR A . n A 1 68 ASP 68 67 67 ASP ASP A . n A 1 69 ARG 69 68 68 ARG ARG A . n A 1 70 LEU 70 69 69 LEU LEU A . n A 1 71 ARG 71 70 70 ARG ARG A . n A 1 72 PRO 72 71 71 PRO PRO A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 SER 74 73 73 SER SER A . n A 1 75 TYR 75 74 74 TYR TYR A . n A 1 76 PRO 76 75 75 PRO PRO A . n A 1 77 ASP 77 76 76 ASP ASP A . n A 1 78 THR 78 77 77 THR THR A . n A 1 79 ASP 79 78 78 ASP ASP A . n A 1 80 VAL 80 79 79 VAL VAL A . n A 1 81 ILE 81 80 80 ILE ILE A . n A 1 82 LEU 82 81 81 LEU LEU A . n A 1 83 MET 83 82 82 MET MET A . n A 1 84 CYS 84 83 83 CYS CYS A . n A 1 85 PHE 85 84 84 PHE PHE A . n A 1 86 SER 86 85 85 SER SER A . n A 1 87 ILE 87 86 86 ILE ILE A . n A 1 88 ASP 88 87 87 ASP ASP A . n A 1 89 SER 89 88 88 SER SER A . n A 1 90 PRO 90 89 89 PRO PRO A . n A 1 91 ASP 91 90 90 ASP ASP A . n A 1 92 SER 92 91 91 SER SER A . n A 1 93 LEU 93 92 92 LEU LEU A . n A 1 94 GLU 94 93 93 GLU GLU A . n A 1 95 ASN 95 94 94 ASN ASN A . n A 1 96 ILE 96 95 95 ILE ILE A . n A 1 97 PRO 97 96 96 PRO PRO A . n A 1 98 GLU 98 97 97 GLU GLU A . n A 1 99 LYS 99 98 98 LYS LYS A . n A 1 100 TRP 100 99 99 TRP TRP A . n A 1 101 THR 101 100 100 THR THR A . n A 1 102 PRO 102 101 101 PRO PRO A . n A 1 103 GLU 103 102 102 GLU GLU A . n A 1 104 VAL 104 103 103 VAL VAL A . n A 1 105 LYS 105 104 104 LYS LYS A . n A 1 106 HIS 106 105 105 HIS HIS A . n A 1 107 PHE 107 106 106 PHE PHE A . n A 1 108 CYS 108 107 107 CYS CYS A . n A 1 109 PRO 109 108 108 PRO PRO A . n A 1 110 ASN 110 109 109 ASN ASN A . n A 1 111 VAL 111 110 110 VAL VAL A . n A 1 112 PRO 112 111 111 PRO PRO A . n A 1 113 ILE 113 112 112 ILE ILE A . n A 1 114 ILE 114 113 113 ILE ILE A . n A 1 115 LEU 115 114 114 LEU LEU A . n A 1 116 VAL 116 115 115 VAL VAL A . n A 1 117 GLY 117 116 116 GLY GLY A . n A 1 118 ASN 118 117 117 ASN ASN A . n A 1 119 LYS 119 118 118 LYS LYS A . n A 1 120 LYS 120 119 119 LYS LYS A . n A 1 121 ASP 121 120 120 ASP ASP A . n A 1 122 LEU 122 121 121 LEU LEU A . n A 1 123 ARG 123 122 122 ARG ARG A . n A 1 124 ASN 124 123 123 ASN ASN A . n A 1 125 ASP 125 124 124 ASP ASP A . n A 1 126 GLU 126 125 125 GLU GLU A . n A 1 127 HIS 127 126 126 HIS HIS A . n A 1 128 THR 128 127 127 THR THR A . n A 1 129 ARG 129 128 128 ARG ARG A . n A 1 130 ARG 130 129 129 ARG ARG A . n A 1 131 GLU 131 130 130 GLU GLU A . n A 1 132 LEU 132 131 131 LEU LEU A . n A 1 133 ALA 133 132 132 ALA ALA A . n A 1 134 LYS 134 133 133 LYS LYS A . n A 1 135 MET 135 134 134 MET MET A . n A 1 136 LYS 136 135 135 LYS LYS A . n A 1 137 GLN 137 136 136 GLN GLN A . n A 1 138 GLU 138 137 137 GLU GLU A . n A 1 139 PRO 139 138 138 PRO PRO A . n A 1 140 VAL 140 139 139 VAL VAL A . n A 1 141 LYS 141 140 140 LYS LYS A . n A 1 142 PRO 142 141 141 PRO PRO A . n A 1 143 GLU 143 142 142 GLU GLU A . n A 1 144 GLU 144 143 143 GLU GLU A . n A 1 145 GLY 145 144 144 GLY GLY A . n A 1 146 ARG 146 145 145 ARG ARG A . n A 1 147 ASP 147 146 146 ASP ASP A . n A 1 148 MET 148 147 147 MET MET A . n A 1 149 ALA 149 148 148 ALA ALA A . n A 1 150 ASN 150 149 149 ASN ASN A . n A 1 151 ARG 151 150 150 ARG ARG A . n A 1 152 ILE 152 151 151 ILE ILE A . n A 1 153 GLY 153 152 152 GLY GLY A . n A 1 154 ALA 154 153 153 ALA ALA A . n A 1 155 PHE 155 154 154 PHE PHE A . n A 1 156 GLY 156 155 155 GLY GLY A . n A 1 157 TYR 157 156 156 TYR TYR A . n A 1 158 MET 158 157 157 MET MET A . n A 1 159 GLU 159 158 158 GLU GLU A . n A 1 160 CYS 160 159 159 CYS CYS A . n A 1 161 SER 161 160 160 SER SER A . n A 1 162 ALA 162 161 161 ALA ALA A . n A 1 163 LYS 163 162 162 LYS LYS A . n A 1 164 THR 164 163 163 THR THR A . n A 1 165 LYS 165 164 164 LYS LYS A . n A 1 166 ASP 166 165 165 ASP ASP A . n A 1 167 GLY 167 166 166 GLY GLY A . n A 1 168 VAL 168 167 167 VAL VAL A . n A 1 169 ARG 169 168 168 ARG ARG A . n A 1 170 GLU 170 169 169 GLU GLU A . n A 1 171 VAL 171 170 170 VAL VAL A . n A 1 172 PHE 172 171 171 PHE PHE A . n A 1 173 GLU 173 172 172 GLU GLU A . n A 1 174 MET 174 173 173 MET MET A . n A 1 175 ALA 175 174 174 ALA ALA A . n A 1 176 THR 176 175 175 THR THR A . n A 1 177 ARG 177 176 176 ARG ARG A . n A 1 178 ALA 178 177 177 ALA ALA A . n A 1 179 ALA 179 178 178 ALA ALA A . n A 1 180 LEU 180 179 179 LEU LEU A . n A 1 181 GLN 181 180 180 GLN GLN A . n A 1 182 ALA 182 181 181 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 550 550 MG MG A . C 3 GSP 1 538 538 GSP GSP A . D 4 HOH 1 601 601 HOH HOH A . D 4 HOH 2 602 602 HOH HOH A . D 4 HOH 3 603 603 HOH HOH A . D 4 HOH 4 604 604 HOH HOH A . D 4 HOH 5 605 605 HOH HOH A . D 4 HOH 6 606 606 HOH HOH A . D 4 HOH 7 607 607 HOH HOH A . D 4 HOH 8 608 608 HOH HOH A . D 4 HOH 9 609 609 HOH HOH A . D 4 HOH 10 610 610 HOH HOH A . D 4 HOH 11 611 611 HOH HOH A . D 4 HOH 12 612 612 HOH HOH A . D 4 HOH 13 613 613 HOH HOH A . D 4 HOH 14 614 614 HOH HOH A . D 4 HOH 15 615 615 HOH HOH A . D 4 HOH 16 616 616 HOH HOH A . D 4 HOH 17 617 617 HOH HOH A . D 4 HOH 18 618 618 HOH HOH A . D 4 HOH 19 619 619 HOH HOH A . D 4 HOH 20 620 620 HOH HOH A . D 4 HOH 21 621 621 HOH HOH A . D 4 HOH 22 622 622 HOH HOH A . D 4 HOH 23 623 623 HOH HOH A . D 4 HOH 24 624 624 HOH HOH A . D 4 HOH 25 625 625 HOH HOH A . D 4 HOH 26 626 626 HOH HOH A . D 4 HOH 27 627 627 HOH HOH A . D 4 HOH 28 628 628 HOH HOH A . D 4 HOH 29 629 629 HOH HOH A . D 4 HOH 30 630 630 HOH HOH A . D 4 HOH 31 631 631 HOH HOH A . D 4 HOH 32 632 632 HOH HOH A . D 4 HOH 33 633 633 HOH HOH A . D 4 HOH 34 634 634 HOH HOH A . D 4 HOH 35 635 635 HOH HOH A . D 4 HOH 36 636 636 HOH HOH A . D 4 HOH 37 637 637 HOH HOH A . D 4 HOH 38 638 638 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OG1 ? A THR 20 ? A THR 19 ? 1_555 MG ? B MG . ? A MG 550 ? 1_555 OG1 ? A THR 38 ? A THR 37 ? 1_555 95.0 ? 2 OG1 ? A THR 20 ? A THR 19 ? 1_555 MG ? B MG . ? A MG 550 ? 1_555 O2G ? C GSP . ? A GSP 538 ? 1_555 173.5 ? 3 OG1 ? A THR 38 ? A THR 37 ? 1_555 MG ? B MG . ? A MG 550 ? 1_555 O2G ? C GSP . ? A GSP 538 ? 1_555 91.2 ? 4 OG1 ? A THR 20 ? A THR 19 ? 1_555 MG ? B MG . ? A MG 550 ? 1_555 O2B ? C GSP . ? A GSP 538 ? 1_555 91.8 ? 5 OG1 ? A THR 38 ? A THR 37 ? 1_555 MG ? B MG . ? A MG 550 ? 1_555 O2B ? C GSP . ? A GSP 538 ? 1_555 167.6 ? 6 O2G ? C GSP . ? A GSP 538 ? 1_555 MG ? B MG . ? A MG 550 ? 1_555 O2B ? C GSP . ? A GSP 538 ? 1_555 81.7 ? 7 OG1 ? A THR 20 ? A THR 19 ? 1_555 MG ? B MG . ? A MG 550 ? 1_555 O ? D HOH . ? A HOH 604 ? 1_555 84.0 ? 8 OG1 ? A THR 38 ? A THR 37 ? 1_555 MG ? B MG . ? A MG 550 ? 1_555 O ? D HOH . ? A HOH 604 ? 1_555 85.9 ? 9 O2G ? C GSP . ? A GSP 538 ? 1_555 MG ? B MG . ? A MG 550 ? 1_555 O ? D HOH . ? A HOH 604 ? 1_555 94.3 ? 10 O2B ? C GSP . ? A GSP 538 ? 1_555 MG ? B MG . ? A MG 550 ? 1_555 O ? D HOH . ? A HOH 604 ? 1_555 84.5 ? 11 OG1 ? A THR 20 ? A THR 19 ? 1_555 MG ? B MG . ? A MG 550 ? 1_555 O ? D HOH . ? A HOH 605 ? 1_555 96.8 ? 12 OG1 ? A THR 38 ? A THR 37 ? 1_555 MG ? B MG . ? A MG 550 ? 1_555 O ? D HOH . ? A HOH 605 ? 1_555 102.2 ? 13 O2G ? C GSP . ? A GSP 538 ? 1_555 MG ? B MG . ? A MG 550 ? 1_555 O ? D HOH . ? A HOH 605 ? 1_555 83.9 ? 14 O2B ? C GSP . ? A GSP 538 ? 1_555 MG ? B MG . ? A MG 550 ? 1_555 O ? D HOH . ? A HOH 605 ? 1_555 87.2 ? 15 O ? D HOH . ? A HOH 604 ? 1_555 MG ? B MG . ? A MG 550 ? 1_555 O ? D HOH . ? A HOH 605 ? 1_555 171.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-06-17 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.value' 17 4 'Structure model' '_struct_conn.pdbx_dist_value' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 30 4 'Structure model' '_struct_ref_seq_dif.details' 31 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 32 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 33 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PROCESS 'data collection' . ? 1 PROCESS 'data reduction' . ? 2 X-PLOR 'model building' 3.8 ? 3 X-PLOR refinement 3.8 ? 4 PROCESS 'data scaling' . ? 5 X-PLOR phasing 3.8 ? 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 13 ? ? -57.18 174.30 2 1 LYS A 27 ? ? -142.98 -4.72 3 1 ASP A 28 ? ? 63.87 -9.47 4 1 ASP A 65 ? ? -47.83 -19.53 5 1 PRO A 75 ? ? -23.27 -78.92 6 1 LYS A 164 ? ? 83.49 -2.10 7 1 ASP A 165 ? ? -53.50 107.97 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 0 ? A SER 1 2 1 Y 1 A MET 1 ? A MET 2 3 1 Y 1 A ALA 2 ? A ALA 3 4 1 Y 1 A ALA 3 ? A ALA 4 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 "5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE" GSP 4 water HOH #