data_1A34 # _entry.id 1A34 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.312 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1A34 RCSB PRV020 WWPDB D_1000170332 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1A34 _pdbx_database_status.recvd_initial_deposition_date 1998-01-28 _pdbx_database_status.deposit_site BNL _pdbx_database_status.process_site NDB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Larson, S.B.' 1 'Day, J.' 2 'Greenwood, A.J.' 3 'McPherson, A.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Refined structure of satellite tobacco mosaic virus at 1.8 A resolution.' J.Mol.Biol. 277 37 59 1998 JMOBAK UK 0022-2836 0070 ? 9514737 10.1006/jmbi.1997.1570 1 'Double-Helical RNA in Satellite Tobacco Mosaic Virus' Nature 361 179 ? 1993 NATUAS UK 0028-0836 0006 ? ? ? 2 'Three-Dimensional Structure of Satellite Tobacco Mosaic Virus at 2.9 A Resolution' J.Mol.Biol. 231 375 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? 3 'Macromolecular Crystal Growth Experiments on International Microgravity Laboratory--1' 'Protein Sci.' 1 1254 ? 1992 PRCIEI US 0961-8368 0795 ? ? ? 4 'Preliminary Analysis of Crystals of Satellite Tobacco Mosaic Virus' J.Mol.Biol. 209 323 ? 1989 JMOBAK UK 0022-2836 0070 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Larson, S.B.' 1 ? primary 'Day, J.' 2 ? primary 'Greenwood, A.' 3 ? primary 'McPherson, A.' 4 ? 1 'Larson, S.B.' 5 ? 1 'Koszelak, S.' 6 ? 1 'Day, J.' 7 ? 1 'Greenwood, A.' 8 ? 1 'Dodds, J.A.' 9 ? 1 'McPherson, A.' 10 ? 2 'Larson, S.B.' 11 ? 2 'Koszelak, S.' 12 ? 2 'Day, J.' 13 ? 2 'Greenwood, A.' 14 ? 2 'Dodds, J.A.' 15 ? 2 'McPherson, A.' 16 ? 3 'Day, J.' 17 ? 3 'McPherson, A.' 18 ? 4 'Koszelak, S.' 19 ? 4 'Dodds, J.A.' 20 ? 4 'McPherson, A.' 21 ? # _cell.entry_id 1A34 _cell.length_a 174.270 _cell.length_b 191.770 _cell.length_c 202.500 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 120 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1A34 _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROTEIN (SATELLITE TOBACCO MOSAIC VIRUS)' 17533.949 1 ? ? ? ? 2 polymer syn ;RNA (5'-R(P*AP*AP*AP*AP*AP*AP*AP*AP*AP*A)-3') ; 3247.100 1 ? ? ? ? 3 polymer syn ;RNA (5'-R(P*UP*UP*UP*UP*UP*UP*UP*UP*UP*U)-3') ; 3016.700 1 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 5 non-polymer syn "URIDINE-5'-MONOPHOSPHATE" 324.181 1 ? ? ? ? 6 water nat water 18.015 168 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name STMV # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MGRGKVKPNRKSTGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSLFSANFRTDSFTSVTVMSVRA WTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASNINTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN ; ;MGRGKVKPNRKSTGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSLFSANFRTDSFTSVTVMSVRA WTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASNINTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN ; A ? 2 polyribonucleotide no no AAAAAAAAAA AAAAAAAAAA B ? 3 polyribonucleotide no no UUUUUUUUUU UUUUUUUUUU C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ARG n 1 4 GLY n 1 5 LYS n 1 6 VAL n 1 7 LYS n 1 8 PRO n 1 9 ASN n 1 10 ARG n 1 11 LYS n 1 12 SER n 1 13 THR n 1 14 GLY n 1 15 ASP n 1 16 ASN n 1 17 SER n 1 18 ASN n 1 19 VAL n 1 20 VAL n 1 21 THR n 1 22 MET n 1 23 ILE n 1 24 ARG n 1 25 ALA n 1 26 GLY n 1 27 SER n 1 28 TYR n 1 29 PRO n 1 30 LYS n 1 31 VAL n 1 32 ASN n 1 33 PRO n 1 34 THR n 1 35 PRO n 1 36 THR n 1 37 TRP n 1 38 VAL n 1 39 ARG n 1 40 ALA n 1 41 ILE n 1 42 PRO n 1 43 PHE n 1 44 GLU n 1 45 VAL n 1 46 SER n 1 47 VAL n 1 48 GLN n 1 49 SER n 1 50 GLY n 1 51 ILE n 1 52 ALA n 1 53 PHE n 1 54 LYS n 1 55 VAL n 1 56 PRO n 1 57 VAL n 1 58 GLY n 1 59 SER n 1 60 LEU n 1 61 PHE n 1 62 SER n 1 63 ALA n 1 64 ASN n 1 65 PHE n 1 66 ARG n 1 67 THR n 1 68 ASP n 1 69 SER n 1 70 PHE n 1 71 THR n 1 72 SER n 1 73 VAL n 1 74 THR n 1 75 VAL n 1 76 MET n 1 77 SER n 1 78 VAL n 1 79 ARG n 1 80 ALA n 1 81 TRP n 1 82 THR n 1 83 GLN n 1 84 LEU n 1 85 THR n 1 86 PRO n 1 87 PRO n 1 88 VAL n 1 89 ASN n 1 90 GLU n 1 91 TYR n 1 92 SER n 1 93 PHE n 1 94 VAL n 1 95 ARG n 1 96 LEU n 1 97 LYS n 1 98 PRO n 1 99 LEU n 1 100 PHE n 1 101 LYS n 1 102 THR n 1 103 GLY n 1 104 ASP n 1 105 SER n 1 106 THR n 1 107 GLU n 1 108 GLU n 1 109 PHE n 1 110 GLU n 1 111 GLY n 1 112 ARG n 1 113 ALA n 1 114 SER n 1 115 ASN n 1 116 ILE n 1 117 ASN n 1 118 THR n 1 119 ARG n 1 120 ALA n 1 121 SER n 1 122 VAL n 1 123 GLY n 1 124 TYR n 1 125 ARG n 1 126 ILE n 1 127 PRO n 1 128 THR n 1 129 ASN n 1 130 LEU n 1 131 ARG n 1 132 GLN n 1 133 ASN n 1 134 THR n 1 135 VAL n 1 136 ALA n 1 137 ALA n 1 138 ASP n 1 139 ASN n 1 140 VAL n 1 141 CYS n 1 142 GLU n 1 143 VAL n 1 144 ARG n 1 145 SER n 1 146 ASN n 1 147 CYS n 1 148 ARG n 1 149 GLN n 1 150 VAL n 1 151 ALA n 1 152 LEU n 1 153 VAL n 1 154 ILE n 1 155 SER n 1 156 CYS n 1 157 CYS n 1 158 PHE n 1 159 ASN n 2 1 A n 2 2 A n 2 3 A n 2 4 A n 2 5 A n 2 6 A n 2 7 A n 2 8 A n 2 9 A n 2 10 A n 3 1 U n 3 2 U n 3 3 U n 3 4 U n 3 5 U n 3 6 U n 3 7 U n 3 8 U n 3 9 U n 3 10 U n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Satellite Tobacco Mosaic Virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 12881 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'common tobacco' _entity_src_gen.pdbx_host_org_scientific_name 'Nicotiana tabacum' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4097 _entity_src_gen.host_org_genus Nicotiana _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_db_isoform 1 UNP COAT_STMV P17574 1 1 ? ? 2 PDB 1A34 1A34 2 ? ? ? 3 PDB 1A34 1A34 3 ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1A34 A 1 ? 159 ? P17574 1 ? 159 ? 1 159 2 2 1A34 B 1 ? 10 ? 1A34 1 ? 10 ? 1 10 3 3 1A34 C 1 ? 10 ? 1A34 1 ? 10 ? 1 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A 'RNA linking' y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1A34 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 20 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.42 _exptl_crystal.density_percent_sol 25.0000 _exptl_crystal.description '8 SPACE-GROWN CRYSTALS AND 12 EARTH-GROWN CRYSTALS' _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'liquid diffusion in microgravity' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.50 _exptl_crystal_grow.pdbx_details ;PROTEIN WAS FOUR TIMES RECRYSTALLIZED FROM BULK SOLUTION BY ADDITION AF AMMONIUM SULFATE TO 15% SATURATION. SPACE CRYSTALS WERE GROWN BY LIQUID-LIQUID DIFFUSION IN A MICROGRAVITY ENVIRONMENT OVER 12 DAYS ABOARD IML-I MISSION OF THE US SPACE SHUTTLE., pH 6.50, liquid diffusion in microgravity ; _exptl_crystal_grow.pdbx_pH_range ? # loop_ _exptl_crystal_grow_comp.crystal_id _exptl_crystal_grow_comp.id _exptl_crystal_grow_comp.sol_id _exptl_crystal_grow_comp.name _exptl_crystal_grow_comp.volume _exptl_crystal_grow_comp.conc _exptl_crystal_grow_comp.details 1 1 1 WATER ? ? ? 1 2 1 'AMMONIUM SULFATE' ? ? ? 1 3 2 WATER ? ? ? 1 4 ? 'AMMONIUM SULFATE' ? ? ? # _diffrn.id 1 _diffrn.ambient_temp 290.00 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'AREA DETECTOR' _diffrn_detector.type SDMS _diffrn_detector.pdbx_collection_date 1992-02 _diffrn_detector.details NONE # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SUPPER GRAPHITE' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1A34 _reflns.observed_criterion_sigma_I 2.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30.000 _reflns.d_resolution_high 1.810 _reflns.number_obs 271689 _reflns.number_all ? _reflns.percent_possible_obs 89.000 _reflns.pdbx_Rmerge_I_obs 0.091 _reflns.pdbx_Rsym_value 0.091 _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 8.70 _reflns.pdbx_redundancy 8.200 _reflns.R_free_details ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.810 _reflns_shell.d_res_low 1.940 _reflns_shell.percent_possible_all 63.90 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.199 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 2.100 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1A34 _refine.ls_number_reflns_obs 215809 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 4.000 _refine.pdbx_data_cutoff_high_absF 100000.000 _refine.pdbx_data_cutoff_low_absF 0.1000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.000 _refine.ls_d_res_high 1.810 _refine.ls_percent_reflns_obs 71.800 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.179 _refine.ls_R_factor_R_free 0.184 _refine.ls_R_factor_R_free_error 0.003 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 1.500 _refine.ls_number_reflns_R_free 3277 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 14.60 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ;THE RMS DEVIATIONS LISTED ABOVE ARE FOR THE PROTEIN. RMS DEVIATIONS FOR THE DOUBLE HELICAL RNA ARE THE FOLLOWING: BONDS: 0.021 ANGLES: 3.06 DIHEDRAL ANGLES: 11.12 IMPROPER ANGLES: 2.05 MEAN B FOR RNA IS 99.1 AND FOR ALL NON- HYDROGEN ATOMS THE MEAN B IS 37.6. NCS RESTRAINTS WERE APPLIED TO THE RNA BACKBONE ONLY. THREE GROUPS WERE DEFINED: GROUP 1, NUCLEOTIDES 1002 - 1006 AND 1102 - 1106; GROUP 2, 1001, 1007 AND 1101, 1107; GROUP 3, 1000, 1008, 1009 AND 1100, 1108, 1109. ; _refine.pdbx_starting_model 'MODIFIED STNV' _refine.pdbx_method_to_determine_struct 'MIR, MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model 'INDIVIDUAL RESTRAINED' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1A34 _refine_analyze.Luzzati_coordinate_error_obs 0.18 _refine_analyze.Luzzati_sigma_a_obs 0.16 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.19 _refine_analyze.Luzzati_sigma_a_free 0.17 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1137 _refine_hist.pdbx_number_atoms_nucleic_acid 422 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.number_atoms_solvent 168 _refine_hist.number_atoms_total 1745 _refine_hist.d_res_high 1.810 _refine_hist.d_res_low 30.000 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.80 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 17.77 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.39 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 1.850 1.500 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 3.340 2.000 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 2.780 2.000 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 4.470 2.500 ? ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_ens_id _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number 1 ? 0.470 100.0 0.310 1.000 . 1 'X-RAY DIFFRACTION' 1 . ? 2 ? 0.510 30.00 0.300 2.000 . 2 'X-RAY DIFFRACTION' 2 . ? 3 ? 0.870 5.000 0.510 3.000 . 3 'X-RAY DIFFRACTION' 3 . ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.81 _refine_ls_shell.d_res_low 1.90 _refine_ls_shell.number_reflns_R_work 13835 _refine_ls_shell.R_factor_R_work 0.204 _refine_ls_shell.percent_reflns_obs 71.80 _refine_ls_shell.R_factor_R_free 0.215 _refine_ls_shell.R_factor_R_free_error 0.01 _refine_ls_shell.percent_reflns_R_free 1.40 _refine_ls_shell.number_reflns_R_free 199 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARAMSBLW.PRO TOPSBL.PRO 'X-RAY DIFFRACTION' 2 DNA-RNA-ALLH3NEW.PARAM DNA-RNA-ALLH.TOP 'X-RAY DIFFRACTION' 3 PARAM19.SOL ? 'X-RAY DIFFRACTION' 4 PARAM.HBN ? 'X-RAY DIFFRACTION' # loop_ _struct_ncs_oper.id _struct_ncs_oper.code _struct_ncs_oper.details _struct_ncs_oper.matrix[1][1] _struct_ncs_oper.matrix[1][2] _struct_ncs_oper.matrix[1][3] _struct_ncs_oper.matrix[2][1] _struct_ncs_oper.matrix[2][2] _struct_ncs_oper.matrix[2][3] _struct_ncs_oper.matrix[3][1] _struct_ncs_oper.matrix[3][2] _struct_ncs_oper.matrix[3][3] _struct_ncs_oper.vector[1] _struct_ncs_oper.vector[2] _struct_ncs_oper.vector[3] 1 given ? 1.00000000 0.00000000 0.00000000 0.00000000 1.00000000 0.00000000 0.00000000 0.00000000 1.00000000 0.00000 0.00000 0.00000 2 generate ? 0.50000000 0.30901699 0.80901699 0.30901699 0.80901699 -0.50000000 -0.80901699 0.50000000 0.30901699 0.00000 0.00000 0.00000 3 generate ? -0.30901699 0.80901699 0.50000000 0.80901699 0.50000000 -0.30901699 -0.50000000 0.30901699 -0.80901699 0.00000 0.00000 0.00000 4 generate ? -0.30901699 0.80901699 -0.50000000 0.80901699 0.50000000 0.30901699 0.50000000 -0.30901699 -0.80901699 0.00000 0.00000 0.00000 5 generate ? 0.50000000 0.30901699 -0.80901699 0.30901699 0.80901699 0.50000000 0.80901699 -0.50000000 0.30901699 0.00000 0.00000 0.00000 6 generate ? -0.80901699 0.50000000 0.30901699 0.50000000 0.30901699 0.80901699 0.30901699 0.80901699 -0.50000000 0.00000 0.00000 0.00000 7 generate ? -0.50000000 0.30901699 -0.80901699 -0.30901699 0.80901699 0.50000000 0.80901699 0.50000000 -0.30901699 0.00000 0.00000 0.00000 8 generate ? 0.50000000 -0.30901699 -0.80901699 -0.30901699 0.80901699 -0.50000000 0.80901699 0.50000000 0.30901699 0.00000 0.00000 0.00000 9 generate ? 0.80901699 -0.50000000 0.30901699 0.50000000 0.30901699 -0.80901699 0.30901699 0.80901699 0.50000000 0.00000 0.00000 0.00000 10 generate ? 0.00000000 0.00000000 1.00000000 1.00000000 0.00000000 0.00000000 0.00000000 1.00000000 0.00000000 0.00000 0.00000 0.00000 11 generate ? 0.80901699 0.50000000 0.30901699 0.50000000 -0.30901699 -0.80901699 -0.30901699 0.80901699 -0.50000000 0.00000 0.00000 0.00000 12 generate ? 0.30901699 0.80901699 0.50000000 0.80901699 -0.50000000 0.30901699 0.50000000 0.30901699 -0.80901699 0.00000 0.00000 0.00000 13 generate ? 0.00000000 1.00000000 0.00000000 0.00000000 0.00000000 1.00000000 1.00000000 0.00000000 0.00000000 0.00000 0.00000 0.00000 14 generate ? 0.30901699 0.80901699 -0.50000000 -0.80901699 0.50000000 0.30901699 0.50000000 0.30901699 0.80901699 0.00000 0.00000 0.00000 15 generate ? 0.80901699 0.50000000 -0.30901699 -0.50000000 0.30901699 -0.80901699 -0.30901699 0.80901699 0.50000000 0.00000 0.00000 0.00000 # loop_ _struct_ncs_dom.id _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.details 1 1 ? 2 2 ? 3 3 ? # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 ? 2 ? 3 ? # _struct.entry_id 1A34 _struct.title 'SATELLITE TOBACCO MOSAIC VIRUS/RNA COMPLEX' _struct.pdbx_descriptor 'SATELLITE TOBACCO MOSAIC VIRUS/RNA COMPLEX' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1A34 _struct_keywords.pdbx_keywords Virus/RNA _struct_keywords.text ;WATER STRUCTURE, RNA, VIRUS ASSEMBLY, MACROMOLECULAR INTERACTIONS, SATELLITE TOBACCO MOSAIC VIRUS, Icosahedral virus, Virus-RNA COMPLEX ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? G N N 6 ? H N N 6 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 57 ? LEU A 60 ? VAL A 57 LEU A 60 5 ? 4 HELX_P HELX_P2 2 ALA A 63 ? PHE A 65 ? ALA A 63 PHE A 65 5 ? 3 HELX_P HELX_P3 3 THR A 128 ? LEU A 130 ? THR A 128 LEU A 130 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order hydrog1 hydrog ? ? B A 1 N1 ? ? ? 1_555 C U 9 N3 ? ? B A 1 C U 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog2 hydrog ? ? B A 1 N6 ? ? ? 1_555 C U 9 O4 ? ? B A 1 C U 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog3 hydrog ? ? B A 3 N1 ? ? ? 1_555 C U 7 N3 ? ? B A 3 C U 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog4 hydrog ? ? B A 3 N6 ? ? ? 1_555 C U 7 O4 ? ? B A 3 C U 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog5 hydrog ? ? B A 4 N1 ? ? ? 1_555 C U 6 N3 ? ? B A 4 C U 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog6 hydrog ? ? B A 4 N6 ? ? ? 1_555 C U 6 O4 ? ? B A 4 C U 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog7 hydrog ? ? B A 5 N1 ? ? ? 1_555 C U 5 N3 ? ? B A 5 C U 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog8 hydrog ? ? B A 5 N6 ? ? ? 1_555 C U 5 O4 ? ? B A 5 C U 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog9 hydrog ? ? B A 6 N1 ? ? ? 1_555 C U 4 N3 ? ? B A 6 C U 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog10 hydrog ? ? B A 6 N6 ? ? ? 1_555 C U 4 O4 ? ? B A 6 C U 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog11 hydrog ? ? B A 7 N1 ? ? ? 1_555 C U 3 N3 ? ? B A 7 C U 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog12 hydrog ? ? B A 7 N6 ? ? ? 1_555 C U 3 O4 ? ? B A 7 C U 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog13 hydrog ? ? B A 8 N1 ? ? ? 1_555 C U 2 N3 ? ? B A 8 C U 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog14 hydrog ? ? B A 8 N6 ? ? ? 1_555 C U 2 O4 ? ? B A 8 C U 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog15 hydrog ? ? B A 9 N6 ? ? ? 1_555 C U 1 O4 ? ? B A 9 C U 1 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? # _struct_conn_type.id hydrog _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 37 ? SER A 46 ? TRP A 37 SER A 46 A 2 GLN A 149 ? ASN A 159 ? GLN A 149 ASN A 159 A 3 SER A 72 ? THR A 82 ? SER A 72 THR A 82 A 4 SER A 121 ? ARG A 125 ? SER A 121 ARG A 125 B 1 PHE A 109 ? ARG A 112 ? PHE A 109 ARG A 112 B 2 PHE A 93 ? PRO A 98 ? PHE A 93 PRO A 98 B 3 ASN A 139 ? SER A 145 ? ASN A 139 SER A 145 B 4 PHE A 53 ? PRO A 56 ? PHE A 53 PRO A 56 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TRP A 37 ? O TRP A 37 N PHE A 158 ? N PHE A 158 A 2 3 O ALA A 151 ? O ALA A 151 N TRP A 81 ? N TRP A 81 A 3 4 O VAL A 78 ? O VAL A 78 N TYR A 124 ? N TYR A 124 B 1 2 O PHE A 109 ? O PHE A 109 N LEU A 96 ? N LEU A 96 B 2 3 O ARG A 95 ? O ARG A 95 N ARG A 144 ? N ARG A 144 B 3 4 O VAL A 140 ? O VAL A 140 N VAL A 55 ? N VAL A 55 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 3001' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE U B 11' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ASN A 115 ? ASN A 115 . ? 1_555 ? 2 AC1 3 ASN A 117 ? ASN A 117 . ? 1_555 ? 3 AC1 3 HOH F . ? HOH A 2701 . ? 1_555 ? 4 AC2 4 THR A 13 ? THR A 13 . ? 1_555 ? 5 AC2 4 GLY A 14 ? GLY A 14 . ? 1_555 ? 6 AC2 4 A B 8 ? A B 8 . ? 1_555 ? 7 AC2 4 A B 9 ? A B 9 . ? 1_555 ? # _database_PDB_matrix.entry_id 1A34 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1A34 _atom_sites.fract_transf_matrix[1][1] 0.005738 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005215 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004938 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 GLY 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 VAL 6 6 ? ? ? A . n A 1 7 LYS 7 7 ? ? ? A . n A 1 8 PRO 8 8 ? ? ? A . n A 1 9 ASN 9 9 ? ? ? A . n A 1 10 ARG 10 10 ? ? ? A . n A 1 11 LYS 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 TRP 81 81 81 TRP TRP A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 GLN 132 132 132 GLN GLN A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 CYS 141 141 141 CYS CYS A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 CYS 147 147 147 CYS CYS A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 CYS 156 156 156 CYS CYS A . n A 1 157 CYS 157 157 157 CYS CYS A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 ASN 159 159 159 ASN ASN A . n B 2 1 A 1 1 1 A A B . n B 2 2 A 2 2 2 A A B . n B 2 3 A 3 3 3 A A B . n B 2 4 A 4 4 4 A A B . n B 2 5 A 5 5 5 A A B . n B 2 6 A 6 6 6 A A B . n B 2 7 A 7 7 7 A A B . n B 2 8 A 8 8 8 A A B . n B 2 9 A 9 9 9 A A B . n B 2 10 A 10 10 10 A A B . n C 3 1 U 1 1 1 U U C . n C 3 2 U 2 2 2 U U C . n C 3 3 U 3 3 3 U U C . n C 3 4 U 4 4 4 U U C . n C 3 5 U 5 5 5 U U C . n C 3 6 U 6 6 6 U U C . n C 3 7 U 7 7 7 U U C . n C 3 8 U 8 8 8 U U C . n C 3 9 U 9 9 9 U U C . n C 3 10 U 10 10 10 U U C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 SO4 1 3001 3001 SO4 SO4 A . E 5 U 1 11 1 U U B . F 6 HOH 1 2001 2001 HOH HOH A . F 6 HOH 2 2002 2002 HOH HOH A . F 6 HOH 3 2003 2003 HOH HOH A . F 6 HOH 4 2004 2004 HOH HOH A . F 6 HOH 5 2005 2005 HOH HOH A . F 6 HOH 6 2006 2006 HOH HOH A . F 6 HOH 7 2007 2007 HOH HOH A . F 6 HOH 8 2008 2008 HOH HOH A . F 6 HOH 9 2009 2009 HOH HOH A . F 6 HOH 10 2010 2010 HOH HOH A . F 6 HOH 11 2011 2011 HOH HOH A . F 6 HOH 12 2012 2012 HOH HOH A . F 6 HOH 13 2013 2013 HOH HOH A . F 6 HOH 14 2014 2014 HOH HOH A . F 6 HOH 15 2015 2015 HOH HOH A . F 6 HOH 16 2016 2016 HOH HOH A . F 6 HOH 17 2017 2017 HOH HOH A . F 6 HOH 18 2018 2018 HOH HOH A . F 6 HOH 19 2019 2019 HOH HOH A . F 6 HOH 20 2020 2020 HOH HOH A . F 6 HOH 21 2021 2021 HOH HOH A . F 6 HOH 22 2022 2022 HOH HOH A . F 6 HOH 23 2023 2023 HOH HOH A . F 6 HOH 24 2024 2024 HOH HOH A . F 6 HOH 25 2101 2101 HOH HOH A . F 6 HOH 26 2102 2102 HOH HOH A . F 6 HOH 27 2103 2103 HOH HOH A . F 6 HOH 28 2104 2104 HOH HOH A . F 6 HOH 29 2105 2105 HOH HOH A . F 6 HOH 30 2106 2106 HOH HOH A . F 6 HOH 31 2107 2107 HOH HOH A . F 6 HOH 32 2108 2108 HOH HOH A . F 6 HOH 33 2109 2109 HOH HOH A . F 6 HOH 34 2110 2110 HOH HOH A . F 6 HOH 35 2111 2111 HOH HOH A . F 6 HOH 36 2112 2112 HOH HOH A . F 6 HOH 37 2113 2113 HOH HOH A . F 6 HOH 38 2114 2114 HOH HOH A . F 6 HOH 39 2115 2115 HOH HOH A . F 6 HOH 40 2116 2116 HOH HOH A . F 6 HOH 41 2117 2117 HOH HOH A . F 6 HOH 42 2118 2118 HOH HOH A . F 6 HOH 43 2119 2119 HOH HOH A . F 6 HOH 44 2120 2120 HOH HOH A . F 6 HOH 45 2121 2121 HOH HOH A . F 6 HOH 46 2122 2122 HOH HOH A . F 6 HOH 47 2123 2123 HOH HOH A . F 6 HOH 48 2124 2124 HOH HOH A . F 6 HOH 49 2125 2125 HOH HOH A . F 6 HOH 50 2126 2126 HOH HOH A . F 6 HOH 51 2127 2127 HOH HOH A . F 6 HOH 52 2128 2128 HOH HOH A . F 6 HOH 53 2129 2129 HOH HOH A . F 6 HOH 54 2130 2130 HOH HOH A . F 6 HOH 55 2131 2131 HOH HOH A . F 6 HOH 56 2132 2132 HOH HOH A . F 6 HOH 57 2133 2133 HOH HOH A . F 6 HOH 58 2134 2134 HOH HOH A . F 6 HOH 59 2135 2135 HOH HOH A . F 6 HOH 60 2136 2136 HOH HOH A . F 6 HOH 61 2137 2137 HOH HOH A . F 6 HOH 62 2138 2138 HOH HOH A . F 6 HOH 63 2139 2139 HOH HOH A . F 6 HOH 64 2140 2140 HOH HOH A . F 6 HOH 65 2141 2141 HOH HOH A . F 6 HOH 66 2142 2142 HOH HOH A . F 6 HOH 67 2143 2143 HOH HOH A . F 6 HOH 68 2144 2144 HOH HOH A . F 6 HOH 69 2145 2145 HOH HOH A . F 6 HOH 70 2146 2146 HOH HOH A . F 6 HOH 71 2147 2147 HOH HOH A . F 6 HOH 72 2148 2148 HOH HOH A . F 6 HOH 73 2149 2149 HOH HOH A . F 6 HOH 74 2150 2150 HOH HOH A . F 6 HOH 75 2151 2151 HOH HOH A . F 6 HOH 76 2152 2152 HOH HOH A . F 6 HOH 77 2153 2153 HOH HOH A . F 6 HOH 78 2154 2154 HOH HOH A . F 6 HOH 79 2155 2155 HOH HOH A . F 6 HOH 80 2156 2156 HOH HOH A . F 6 HOH 81 2157 2157 HOH HOH A . F 6 HOH 82 2158 2158 HOH HOH A . F 6 HOH 83 2159 2159 HOH HOH A . F 6 HOH 84 2160 2160 HOH HOH A . F 6 HOH 85 2161 2161 HOH HOH A . F 6 HOH 86 2162 2162 HOH HOH A . F 6 HOH 87 2163 2163 HOH HOH A . F 6 HOH 88 2164 2164 HOH HOH A . F 6 HOH 89 2165 2165 HOH HOH A . F 6 HOH 90 2166 2166 HOH HOH A . F 6 HOH 91 2167 2167 HOH HOH A . F 6 HOH 92 2168 2168 HOH HOH A . F 6 HOH 93 2169 2169 HOH HOH A . F 6 HOH 94 2170 2170 HOH HOH A . F 6 HOH 95 2171 2171 HOH HOH A . F 6 HOH 96 2172 2172 HOH HOH A . F 6 HOH 97 2173 2173 HOH HOH A . F 6 HOH 98 2174 2174 HOH HOH A . F 6 HOH 99 2175 2175 HOH HOH A . F 6 HOH 100 2176 2176 HOH HOH A . F 6 HOH 101 2177 2177 HOH HOH A . F 6 HOH 102 2178 2178 HOH HOH A . F 6 HOH 103 2179 2179 HOH HOH A . F 6 HOH 104 2180 2180 HOH HOH A . F 6 HOH 105 2181 2181 HOH HOH A . F 6 HOH 106 2182 2182 HOH HOH A . F 6 HOH 107 2183 2183 HOH HOH A . F 6 HOH 108 2184 2184 HOH HOH A . F 6 HOH 109 2185 2185 HOH HOH A . F 6 HOH 110 2186 2186 HOH HOH A . F 6 HOH 111 2187 2187 HOH HOH A . F 6 HOH 112 2188 2188 HOH HOH A . F 6 HOH 113 2189 2189 HOH HOH A . F 6 HOH 114 2190 2190 HOH HOH A . F 6 HOH 115 2191 2191 HOH HOH A . F 6 HOH 116 2192 2192 HOH HOH A . F 6 HOH 117 2193 2193 HOH HOH A . F 6 HOH 118 2194 2194 HOH HOH A . F 6 HOH 119 2195 2195 HOH HOH A . F 6 HOH 120 2196 2196 HOH HOH A . F 6 HOH 121 2197 2197 HOH HOH A . F 6 HOH 122 2198 2198 HOH HOH A . F 6 HOH 123 2199 2199 HOH HOH A . F 6 HOH 124 2207 2207 HOH HOH A . F 6 HOH 125 2301 2301 HOH HOH A . F 6 HOH 126 2302 2302 HOH HOH A . F 6 HOH 127 2303 2303 HOH HOH A . F 6 HOH 128 2304 2304 HOH HOH A . F 6 HOH 129 2305 2305 HOH HOH A . F 6 HOH 130 2306 2306 HOH HOH A . F 6 HOH 131 2401 2401 HOH HOH A . F 6 HOH 132 2402 2402 HOH HOH A . F 6 HOH 133 2403 2403 HOH HOH A . F 6 HOH 134 2404 2404 HOH HOH A . F 6 HOH 135 2405 2405 HOH HOH A . F 6 HOH 136 2501 2501 HOH HOH A . F 6 HOH 137 2502 2502 HOH HOH A . F 6 HOH 138 2503 2503 HOH HOH A . F 6 HOH 139 2504 2504 HOH HOH A . F 6 HOH 140 2505 2505 HOH HOH A . F 6 HOH 141 2506 2506 HOH HOH A . F 6 HOH 142 2507 2507 HOH HOH A . F 6 HOH 143 2508 2508 HOH HOH A . F 6 HOH 144 2509 2509 HOH HOH A . F 6 HOH 145 2601 2601 HOH HOH A . F 6 HOH 146 2606 2606 HOH HOH A . F 6 HOH 147 2607 2607 HOH HOH A . F 6 HOH 148 2701 2701 HOH HOH A . F 6 HOH 149 2901 2901 HOH HOH A . G 6 HOH 1 2201 2201 HOH HOH B . G 6 HOH 2 2202 2202 HOH HOH B . G 6 HOH 3 2203 2203 HOH HOH B . G 6 HOH 4 2204 2204 HOH HOH B . G 6 HOH 5 2210 2210 HOH HOH B . G 6 HOH 6 2211 2211 HOH HOH B . G 6 HOH 7 2602 2602 HOH HOH B . G 6 HOH 8 2603 2603 HOH HOH B . G 6 HOH 9 2604 2604 HOH HOH B . G 6 HOH 10 2605 2605 HOH HOH B . G 6 HOH 11 2801 2801 HOH HOH B . H 6 HOH 1 2205 2205 HOH HOH C . H 6 HOH 2 2206 2206 HOH HOH C . H 6 HOH 3 2208 2208 HOH HOH C . H 6 HOH 4 2209 2209 HOH HOH C . H 6 HOH 5 2212 2212 HOH HOH C . H 6 HOH 6 2608 2608 HOH HOH C . H 6 HOH 7 2609 2609 HOH HOH C . H 6 HOH 8 2610 2610 HOH HOH C . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 'complete icosahedral assembly' ? 180-MERIC 180 2 'icosahedral asymmetric unit' ? trimeric 3 3 'icosahedral pentamer' ? pentadecameric 15 4 'icosahedral 23 hexamer' ? octadecameric 18 5 'icosahedral asymmetric unit, std point frame' ? trimeric 3 6 'crystal asymmetric unit, crystal frame' ? 45-meric 45 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 '(1-60)' A,B,C,D,E,F,G,H 2 1 A,B,C,D,E,F,G,H 3 '(1-5)' A,B,C,D,E,F,G,H 4 '(1,2,6,10,23,24)' A,B,C,D,E,F,G,H 5 P A,B,C,D,E,F,G,H 6 '(X0)(1-10,21-25)' A,B,C,D,E,F,G,H # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] P 'transform to point frame' ? ? 0.80901699 -0.50000000 0.30901699 0.00000 0.50000000 0.30901699 -0.80901699 0.00000 0.30901699 0.80901699 0.50000000 -0.00000 X0 'transform to crystal frame' ? ? 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 1 'point symmetry operation' ? ? 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 2 'point symmetry operation' ? ? 0.50000000 0.30901699 0.80901699 0.00000 0.30901699 0.80901699 -0.50000000 0.00000 -0.80901699 0.50000000 0.30901699 0.00000 3 'point symmetry operation' ? ? -0.30901699 0.80901699 0.50000000 0.00000 0.80901699 0.50000000 -0.30901699 0.00000 -0.50000000 0.30901699 -0.80901699 0.00000 4 'point symmetry operation' ? ? -0.30901699 0.80901699 -0.50000000 0.00000 0.80901699 0.50000000 0.30901699 0.00000 0.50000000 -0.30901699 -0.80901699 0.00000 5 'point symmetry operation' ? ? 0.50000000 0.30901699 -0.80901699 0.00000 0.30901699 0.80901699 0.50000000 0.00000 0.80901699 -0.50000000 0.30901699 0.00000 6 'point symmetry operation' ? ? -0.80901699 0.50000000 0.30901699 0.00000 0.50000000 0.30901699 0.80901699 0.00000 0.30901699 0.80901699 -0.50000000 0.00000 7 'point symmetry operation' ? ? -0.50000000 0.30901699 -0.80901699 0.00000 -0.30901699 0.80901699 0.50000000 0.00000 0.80901699 0.50000000 -0.30901699 0.00000 8 'point symmetry operation' ? ? 0.50000000 -0.30901699 -0.80901699 0.00000 -0.30901699 0.80901699 -0.50000000 0.00000 0.80901699 0.50000000 0.30901699 0.00000 9 'point symmetry operation' ? ? 0.80901699 -0.50000000 0.30901699 0.00000 0.50000000 0.30901699 -0.80901699 0.00000 0.30901699 0.80901699 0.50000000 0.00000 10 'point symmetry operation' ? ? 0.00000000 0.00000000 1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 11 'point symmetry operation' ? ? -0.50000000 0.30901699 -0.80901699 0.00000 0.30901699 -0.80901699 -0.50000000 0.00000 -0.80901699 -0.50000000 0.30901699 0.00000 12 'point symmetry operation' ? ? 0.50000000 -0.30901699 -0.80901699 0.00000 0.30901699 -0.80901699 0.50000000 0.00000 -0.80901699 -0.50000000 -0.30901699 0.00000 13 'point symmetry operation' ? ? 0.80901699 -0.50000000 0.30901699 0.00000 -0.50000000 -0.30901699 0.80901699 0.00000 -0.30901699 -0.80901699 -0.50000000 0.00000 14 'point symmetry operation' ? ? 0.00000000 0.00000000 1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 15 'point symmetry operation' ? ? -0.80901699 0.50000000 0.30901699 0.00000 -0.50000000 -0.30901699 -0.80901699 0.00000 -0.30901699 -0.80901699 0.50000000 0.00000 16 'point symmetry operation' ? ? 0.30901699 -0.80901699 0.50000000 0.00000 -0.80901699 -0.50000000 -0.30901699 0.00000 0.50000000 -0.30901699 -0.80901699 0.00000 17 'point symmetry operation' ? ? -0.50000000 -0.30901699 0.80901699 0.00000 -0.30901699 -0.80901699 -0.50000000 0.00000 0.80901699 -0.50000000 0.30901699 0.00000 18 'point symmetry operation' ? ? -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 19 'point symmetry operation' ? ? -0.50000000 -0.30901699 -0.80901699 0.00000 -0.30901699 -0.80901699 0.50000000 0.00000 -0.80901699 0.50000000 0.30901699 0.00000 20 'point symmetry operation' ? ? 0.30901699 -0.80901699 -0.50000000 0.00000 -0.80901699 -0.50000000 0.30901699 0.00000 -0.50000000 0.30901699 -0.80901699 0.00000 21 'point symmetry operation' ? ? 0.80901699 0.50000000 0.30901699 0.00000 0.50000000 -0.30901699 -0.80901699 0.00000 -0.30901699 0.80901699 -0.50000000 0.00000 22 'point symmetry operation' ? ? 0.30901699 0.80901699 0.50000000 0.00000 0.80901699 -0.50000000 0.30901699 0.00000 0.50000000 0.30901699 -0.80901699 0.00000 23 'point symmetry operation' ? ? 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 24 'point symmetry operation' ? ? 0.30901699 0.80901699 -0.50000000 0.00000 -0.80901699 0.50000000 0.30901699 0.00000 0.50000000 0.30901699 0.80901699 0.00000 25 'point symmetry operation' ? ? 0.80901699 0.50000000 -0.30901699 0.00000 -0.50000000 0.30901699 -0.80901699 0.00000 -0.30901699 0.80901699 0.50000000 0.00000 26 'point symmetry operation' ? ? -0.30901699 0.80901699 0.50000000 0.00000 -0.80901699 -0.50000000 0.30901699 0.00000 0.50000000 -0.30901699 0.80901699 0.00000 27 'point symmetry operation' ? ? -0.30901699 0.80901699 -0.50000000 0.00000 -0.80901699 -0.50000000 -0.30901699 0.00000 -0.50000000 0.30901699 0.80901699 0.00000 28 'point symmetry operation' ? ? 0.50000000 0.30901699 -0.80901699 0.00000 -0.30901699 -0.80901699 -0.50000000 0.00000 -0.80901699 0.50000000 -0.30901699 0.00000 29 'point symmetry operation' ? ? 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 30 'point symmetry operation' ? ? 0.50000000 0.30901699 0.80901699 0.00000 -0.30901699 -0.80901699 0.50000000 0.00000 0.80901699 -0.50000000 -0.30901699 0.00000 31 'point symmetry operation' ? ? -0.50000000 -0.30901699 -0.80901699 0.00000 0.30901699 0.80901699 -0.50000000 0.00000 0.80901699 -0.50000000 -0.30901699 0.00000 32 'point symmetry operation' ? ? 0.30901699 -0.80901699 -0.50000000 0.00000 0.80901699 0.50000000 -0.30901699 0.00000 0.50000000 -0.30901699 0.80901699 0.00000 33 'point symmetry operation' ? ? 0.30901699 -0.80901699 0.50000000 0.00000 0.80901699 0.50000000 0.30901699 0.00000 -0.50000000 0.30901699 0.80901699 0.00000 34 'point symmetry operation' ? ? -0.50000000 -0.30901699 0.80901699 0.00000 0.30901699 0.80901699 0.50000000 0.00000 -0.80901699 0.50000000 -0.30901699 0.00000 35 'point symmetry operation' ? ? -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 36 'point symmetry operation' ? ? 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 37 'point symmetry operation' ? ? -0.30901699 -0.80901699 0.50000000 0.00000 -0.80901699 0.50000000 0.30901699 0.00000 -0.50000000 -0.30901699 -0.80901699 0.00000 38 'point symmetry operation' ? ? -0.80901699 -0.50000000 0.30901699 0.00000 -0.50000000 0.30901699 -0.80901699 0.00000 0.30901699 -0.80901699 -0.50000000 0.00000 39 'point symmetry operation' ? ? -0.80901699 -0.50000000 -0.30901699 0.00000 0.50000000 -0.30901699 -0.80901699 0.00000 0.30901699 -0.80901699 0.50000000 0.00000 40 'point symmetry operation' ? ? -0.30901699 -0.80901699 -0.50000000 0.00000 0.80901699 -0.50000000 0.30901699 0.00000 -0.50000000 -0.30901699 0.80901699 0.00000 41 'point symmetry operation' ? ? 0.80901699 0.50000000 -0.30901699 0.00000 0.50000000 -0.30901699 0.80901699 0.00000 0.30901699 -0.80901699 -0.50000000 0.00000 42 'point symmetry operation' ? ? 0.80901699 0.50000000 0.30901699 0.00000 -0.50000000 0.30901699 0.80901699 0.00000 0.30901699 -0.80901699 0.50000000 0.00000 43 'point symmetry operation' ? ? 0.30901699 0.80901699 0.50000000 0.00000 -0.80901699 0.50000000 -0.30901699 0.00000 -0.50000000 -0.30901699 0.80901699 0.00000 44 'point symmetry operation' ? ? 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 45 'point symmetry operation' ? ? 0.30901699 0.80901699 -0.50000000 0.00000 0.80901699 -0.50000000 -0.30901699 0.00000 -0.50000000 -0.30901699 -0.80901699 0.00000 46 'point symmetry operation' ? ? -0.50000000 0.30901699 0.80901699 0.00000 -0.30901699 0.80901699 -0.50000000 0.00000 -0.80901699 -0.50000000 -0.30901699 0.00000 47 'point symmetry operation' ? ? -0.80901699 0.50000000 -0.30901699 0.00000 0.50000000 0.30901699 -0.80901699 0.00000 -0.30901699 -0.80901699 -0.50000000 0.00000 48 'point symmetry operation' ? ? 0.00000000 0.00000000 -1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 49 'point symmetry operation' ? ? 0.80901699 -0.50000000 -0.30901699 0.00000 0.50000000 0.30901699 0.80901699 0.00000 -0.30901699 -0.80901699 0.50000000 0.00000 50 'point symmetry operation' ? ? 0.50000000 -0.30901699 0.80901699 0.00000 -0.30901699 0.80901699 0.50000000 0.00000 -0.80901699 -0.50000000 0.30901699 0.00000 51 'point symmetry operation' ? ? 0.00000000 0.00000000 -1.00000000 0.00000 -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 52 'point symmetry operation' ? ? 0.80901699 -0.50000000 -0.30901699 0.00000 -0.50000000 -0.30901699 -0.80901699 0.00000 0.30901699 0.80901699 -0.50000000 0.00000 53 'point symmetry operation' ? ? 0.50000000 -0.30901699 0.80901699 0.00000 0.30901699 -0.80901699 -0.50000000 0.00000 0.80901699 0.50000000 -0.30901699 0.00000 54 'point symmetry operation' ? ? -0.50000000 0.30901699 0.80901699 0.00000 0.30901699 -0.80901699 0.50000000 0.00000 0.80901699 0.50000000 0.30901699 0.00000 55 'point symmetry operation' ? ? -0.80901699 0.50000000 -0.30901699 0.00000 -0.50000000 -0.30901699 0.80901699 0.00000 0.30901699 0.80901699 0.50000000 0.00000 56 'point symmetry operation' ? ? -0.30901699 -0.80901699 0.50000000 0.00000 0.80901699 -0.50000000 -0.30901699 0.00000 0.50000000 0.30901699 0.80901699 0.00000 57 'point symmetry operation' ? ? -0.80901699 -0.50000000 0.30901699 0.00000 0.50000000 -0.30901699 0.80901699 0.00000 -0.30901699 0.80901699 0.50000000 0.00000 58 'point symmetry operation' ? ? -0.80901699 -0.50000000 -0.30901699 0.00000 -0.50000000 0.30901699 0.80901699 0.00000 -0.30901699 0.80901699 -0.50000000 0.00000 59 'point symmetry operation' ? ? -0.30901699 -0.80901699 -0.50000000 0.00000 -0.80901699 0.50000000 -0.30901699 0.00000 0.50000000 0.30901699 -0.80901699 0.00000 60 'point symmetry operation' ? ? 0.00000000 -1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 1.00000000 0.00000000 0.00000000 0.00000 # _pdbx_point_symmetry.entry_id 1A34 _pdbx_point_symmetry.Schoenflies_symbol I _pdbx_point_symmetry.H-M_notation 532 _pdbx_point_symmetry.circular_symmetry ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-04-29 2 'Structure model' 1 1 2008-05-22 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2012-07-25 5 'Structure model' 1 4 2019-07-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' Other 4 4 'Structure model' 'Source and taxonomy' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 5 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_software.classification' 2 5 'Structure model' '_software.name' 3 5 'Structure model' '_software.version' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR refinement 3.843 ? 1 "BRICOGNE'S" 'model building' GENERATE ? 2 INTERPOLATE 'model building' . ? 3 TNT refinement . ? 4 HEAVY 'model building' . ? 5 SDMS 'data reduction' 'DETECTOR SYSTEM' ? 6 SDMS 'data scaling' 'DETECTOR SYSTEM' ? 7 HEAVY phasing . ? 8 "BRICOGNE'S" phasing GENERATE ? 9 INTERPOLATE phasing . ? 10 TNT phasing . ? 11 # _pdbx_entry_details.entry_id 1A34 _pdbx_entry_details.compound_details ;RNA CHAIN B HAS BEEN DESCRIBED BY AN ARBITRARY 10 NUCLEOTIDE CHAIN COMPOSED OF ADENINE BASES. LIKEWISE CHAINS C AND D ARE URIDINES. THE TRUE SEQUENCE IS UNDOUBTEDLY DISORDERED, BUT THE GREATEST POPULATION IN THE RNA GENOME OF STMV OCCURS FOR ADENINE AND URIDINE BASES. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A GLY 14 ? ? OP1 B U 11 ? ? 1.20 2 1 O A HOH 2005 ? ? H2 A HOH 2117 ? ? 1.51 3 1 N A GLY 14 ? ? OP1 B U 11 ? ? 2.13 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 "O3'" B A 1 ? ? "C3'" B A 1 ? ? 1.512 1.427 0.085 0.012 N 2 1 "C2'" C U 1 ? ? "O2'" C U 1 ? ? 1.497 1.420 0.077 0.010 N 3 1 C4 C U 4 ? ? O4 C U 4 ? ? 1.284 1.232 0.052 0.008 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 "O3'" B A 1 ? ? P B A 2 ? ? OP2 B A 2 ? ? 89.58 105.20 -15.62 2.20 Y 2 1 "O3'" B A 1 ? ? P B A 2 ? ? OP1 B A 2 ? ? 121.85 110.50 11.35 1.10 Y 3 1 "O3'" B A 9 ? ? P B A 10 ? ? OP2 B A 10 ? ? 120.25 110.50 9.75 1.10 Y 4 1 "O3'" B A 9 ? ? P B A 10 ? ? OP1 B A 10 ? ? 90.54 105.20 -14.66 2.20 Y 5 1 N1 C U 1 ? ? "C1'" C U 1 ? ? "C2'" C U 1 ? ? 122.78 114.00 8.78 1.30 N 6 1 "O5'" C U 4 ? ? P C U 4 ? ? OP2 C U 4 ? ? 98.99 105.70 -6.71 0.90 N 7 1 "O5'" C U 5 ? ? P C U 5 ? ? OP2 C U 5 ? ? 99.61 105.70 -6.09 0.90 N 8 1 "O5'" C U 9 ? ? P C U 9 ? ? OP2 C U 9 ? ? 100.12 105.70 -5.58 0.90 N 9 1 "O5'" C U 10 ? ? P C U 10 ? ? OP2 C U 10 ? ? 97.54 105.70 -8.16 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 15 ? ? 162.70 -148.48 2 1 ASN A 16 ? ? 101.77 -15.61 3 1 ASN A 89 ? ? 77.49 -7.36 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 24 ? ? 0.285 'SIDE CHAIN' 2 1 ARG A 79 ? ? 0.150 'SIDE CHAIN' 3 1 ARG A 95 ? ? 0.077 'SIDE CHAIN' 4 1 ARG A 148 ? ? 0.271 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 B U 11 ? "O3'" ? E U 1 "O3'" 2 1 N 1 B U 11 ? C2 ? E U 1 C2 3 1 N 1 B U 11 ? O2 ? E U 1 O2 4 1 N 1 B U 11 ? N3 ? E U 1 N3 5 1 N 1 B U 11 ? C4 ? E U 1 C4 6 1 N 1 B U 11 ? O4 ? E U 1 O4 7 1 N 1 B U 11 ? C5 ? E U 1 C5 8 1 N 1 B U 11 ? C6 ? E U 1 C6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A GLY 4 ? A GLY 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A VAL 6 ? A VAL 6 7 1 Y 1 A LYS 7 ? A LYS 7 8 1 Y 1 A PRO 8 ? A PRO 8 9 1 Y 1 A ASN 9 ? A ASN 9 10 1 Y 1 A ARG 10 ? A ARG 10 11 1 Y 1 A LYS 11 ? A LYS 11 12 1 Y 1 A SER 12 ? A SER 12 # loop_ _ndb_struct_conf_na.entry_id _ndb_struct_conf_na.feature 1A34 'double helix' 1A34 'a-form double helix' # loop_ _ndb_struct_na_base_pair.model_number _ndb_struct_na_base_pair.i_label_asym_id _ndb_struct_na_base_pair.i_label_comp_id _ndb_struct_na_base_pair.i_label_seq_id _ndb_struct_na_base_pair.i_symmetry _ndb_struct_na_base_pair.j_label_asym_id _ndb_struct_na_base_pair.j_label_comp_id _ndb_struct_na_base_pair.j_label_seq_id _ndb_struct_na_base_pair.j_symmetry _ndb_struct_na_base_pair.shear _ndb_struct_na_base_pair.stretch _ndb_struct_na_base_pair.stagger _ndb_struct_na_base_pair.buckle _ndb_struct_na_base_pair.propeller _ndb_struct_na_base_pair.opening _ndb_struct_na_base_pair.pair_number _ndb_struct_na_base_pair.pair_name _ndb_struct_na_base_pair.i_auth_asym_id _ndb_struct_na_base_pair.i_auth_seq_id _ndb_struct_na_base_pair.i_PDB_ins_code _ndb_struct_na_base_pair.j_auth_asym_id _ndb_struct_na_base_pair.j_auth_seq_id _ndb_struct_na_base_pair.j_PDB_ins_code _ndb_struct_na_base_pair.hbond_type_28 _ndb_struct_na_base_pair.hbond_type_12 1 B A 1 1_555 C U 9 1_555 1.054 -0.489 0.247 -17.442 4.339 -3.951 1 B_A1:U9_C B 1 ? C 9 ? 20 1 1 B A 3 1_555 C U 7 1_555 -0.205 -0.180 0.040 7.986 -11.004 -1.243 2 B_A3:U7_C B 3 ? C 7 ? 20 1 1 B A 4 1_555 C U 6 1_555 -0.297 -0.157 -0.073 5.355 -6.325 -0.150 3 B_A4:U6_C B 4 ? C 6 ? 20 1 1 B A 5 1_555 C U 5 1_555 -0.538 -0.044 -0.186 -4.583 -12.707 1.867 4 B_A5:U5_C B 5 ? C 5 ? 20 1 1 B A 6 1_555 C U 4 1_555 -0.190 0.017 -0.118 -7.009 -13.227 1.516 5 B_A6:U4_C B 6 ? C 4 ? 20 1 1 B A 7 1_555 C U 3 1_555 0.872 0.074 0.079 -8.746 -12.999 6.911 6 B_A7:U3_C B 7 ? C 3 ? 20 1 1 B A 8 1_555 C U 2 1_555 0.607 -0.099 -0.027 -13.458 -14.664 11.331 7 B_A8:U2_C B 8 ? C 2 ? 20 1 1 B A 9 1_555 C U 1 1_555 1.110 -1.173 -1.054 -4.533 4.827 1.044 8 B_A9:U1_C B 9 ? C 1 ? ? 1 # loop_ _ndb_struct_na_base_pair_step.model_number _ndb_struct_na_base_pair_step.i_label_asym_id_1 _ndb_struct_na_base_pair_step.i_label_comp_id_1 _ndb_struct_na_base_pair_step.i_label_seq_id_1 _ndb_struct_na_base_pair_step.i_symmetry_1 _ndb_struct_na_base_pair_step.j_label_asym_id_1 _ndb_struct_na_base_pair_step.j_label_comp_id_1 _ndb_struct_na_base_pair_step.j_label_seq_id_1 _ndb_struct_na_base_pair_step.j_symmetry_1 _ndb_struct_na_base_pair_step.i_label_asym_id_2 _ndb_struct_na_base_pair_step.i_label_comp_id_2 _ndb_struct_na_base_pair_step.i_label_seq_id_2 _ndb_struct_na_base_pair_step.i_symmetry_2 _ndb_struct_na_base_pair_step.j_label_asym_id_2 _ndb_struct_na_base_pair_step.j_label_comp_id_2 _ndb_struct_na_base_pair_step.j_label_seq_id_2 _ndb_struct_na_base_pair_step.j_symmetry_2 _ndb_struct_na_base_pair_step.shift _ndb_struct_na_base_pair_step.slide _ndb_struct_na_base_pair_step.rise _ndb_struct_na_base_pair_step.tilt _ndb_struct_na_base_pair_step.roll _ndb_struct_na_base_pair_step.twist _ndb_struct_na_base_pair_step.x_displacement _ndb_struct_na_base_pair_step.y_displacement _ndb_struct_na_base_pair_step.helical_rise _ndb_struct_na_base_pair_step.inclination _ndb_struct_na_base_pair_step.tip _ndb_struct_na_base_pair_step.helical_twist _ndb_struct_na_base_pair_step.step_number _ndb_struct_na_base_pair_step.step_name _ndb_struct_na_base_pair_step.i_auth_asym_id_1 _ndb_struct_na_base_pair_step.i_auth_seq_id_1 _ndb_struct_na_base_pair_step.i_PDB_ins_code_1 _ndb_struct_na_base_pair_step.j_auth_asym_id_1 _ndb_struct_na_base_pair_step.j_auth_seq_id_1 _ndb_struct_na_base_pair_step.j_PDB_ins_code_1 _ndb_struct_na_base_pair_step.i_auth_asym_id_2 _ndb_struct_na_base_pair_step.i_auth_seq_id_2 _ndb_struct_na_base_pair_step.i_PDB_ins_code_2 _ndb_struct_na_base_pair_step.j_auth_asym_id_2 _ndb_struct_na_base_pair_step.j_auth_seq_id_2 _ndb_struct_na_base_pair_step.j_PDB_ins_code_2 1 B A 3 1_555 C U 7 1_555 B A 4 1_555 C U 6 1_555 -0.462 -1.330 3.353 -4.031 10.183 29.100 -4.381 0.113 2.779 19.420 7.687 31.051 1 BB_A3A4:U6U7_CC B 3 ? C 7 ? B 4 ? C 6 ? 1 B A 4 1_555 C U 6 1_555 B A 5 1_555 C U 5 1_555 -0.213 -1.619 3.453 -2.391 17.690 37.606 -4.089 0.057 2.489 25.744 3.480 41.490 2 BB_A4A5:U5U6_CC B 4 ? C 6 ? B 5 ? C 5 ? 1 B A 5 1_555 C U 5 1_555 B A 6 1_555 C U 4 1_555 -0.300 -1.439 3.316 -3.439 9.509 31.850 -4.016 -0.023 2.799 16.806 6.079 33.377 3 BB_A5A6:U4U5_CC B 5 ? C 5 ? B 6 ? C 4 ? 1 B A 6 1_555 C U 4 1_555 B A 7 1_555 C U 3 1_555 0.484 -2.238 3.283 1.266 11.398 32.046 -5.458 -0.647 2.387 19.869 -2.206 33.985 4 BB_A6A7:U3U4_CC B 6 ? C 4 ? B 7 ? C 3 ? 1 B A 7 1_555 C U 3 1_555 B A 8 1_555 C U 2 1_555 1.076 -1.842 3.527 4.368 7.670 31.116 -4.716 -1.132 3.115 13.949 -7.944 32.314 5 BB_A7A8:U2U3_CC B 7 ? C 3 ? B 8 ? C 2 ? 1 B A 8 1_555 C U 2 1_555 B A 9 1_555 C U 1 1_555 -0.365 -0.993 3.563 11.470 4.032 28.401 -2.693 3.034 3.027 7.783 -22.139 30.844 6 BB_A8A9:U1U2_CC B 8 ? C 2 ? B 9 ? C 1 ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 4 'SULFATE ION' SO4 5 "URIDINE-5'-MONOPHOSPHATE" U 6 water HOH #