data_1A3Z # _entry.id 1A3Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1A3Z pdb_00001a3z 10.2210/pdb1a3z/pdb WWPDB D_1000170363 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1A3Z _pdbx_database_status.recvd_initial_deposition_date 1998-01-27 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhao, D.' 1 'Shoham, M.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Rusticyanin: Extremes in acid stability and redox potential explained by the crystal structure.' Biophys.J. 74 233 233 1998 BIOJAU US 0006-3495 0030 ? -1 ? 1 ;Multiple Wavelength Anomalous Diffraction (MAD) Crystal Structure of Rusticyanin: A Highly Oxidizing Cupredoxin with Extreme Acid Stability ; J.Mol.Biol. 263 730 ? 1996 JMOBAK UK 0022-2836 0070 ? ? ? 2 ;NMR Solution Structure of Cu(I) Rusticyanin from Thiobacillus Ferrooxidans: Structural Basis for the Extreme Acid Stability and Redox Potential ; J.Mol.Biol. 263 752 ? 1996 JMOBAK UK 0022-2836 0070 ? ? ? 3 'Crystallization and Preliminary X-Ray Crystallographic Studies of Rusticyanin from Thiobacillus Ferrooxidans' J.Mol.Biol. 227 581 ? 1992 JMOBAK UK 0022-2836 0070 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhao, D.' 1 ? primary 'Shoham, M.' 2 ? 1 'Walter, R.L.' 3 ? 1 'Ealick, S.E.' 4 ? 1 'Friedman, A.M.' 5 ? 1 'Blake II, R.C.' 6 ? 1 'Proctor, P.' 7 ? 1 'Shoham, M.' 8 ? 2 'Botuyan, M.V.' 9 ? 2 'Toy-Palmer, A.' 10 ? 2 'Chung, J.' 11 ? 2 'Blake II, R.C.' 12 ? 2 'Beroza, P.' 13 ? 2 'Case, D.A.' 14 ? 2 'Dyson, H.J.' 15 ? 3 'Djebli, A.' 16 ? 3 'Proctor, P.' 17 ? 3 'Blake II, R.C.' 18 ? 3 'Shoham, M.' 19 ? # _cell.entry_id 1A3Z _cell.length_a 32.450 _cell.length_b 60.590 _cell.length_c 38.080 _cell.angle_alpha 90.00 _cell.angle_beta 108.02 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1A3Z _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat RUSTICYANIN 16569.879 1 ? ? ? 'REDUCED FORM' 2 non-polymer syn 'COPPER (I) ION' 63.546 1 ? ? ? ? 3 water nat water 18.015 85 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GTLDSTWKEATLPQVKAMLEKDDGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTN KGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGHAATGMFGKIVVK ; _entity_poly.pdbx_seq_one_letter_code_can ;GTLDSTWKEATLPQVKAMLEKDDGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTN KGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGHAATGMFGKIVVK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 THR n 1 3 LEU n 1 4 ASP n 1 5 SER n 1 6 THR n 1 7 TRP n 1 8 LYS n 1 9 GLU n 1 10 ALA n 1 11 THR n 1 12 LEU n 1 13 PRO n 1 14 GLN n 1 15 VAL n 1 16 LYS n 1 17 ALA n 1 18 MET n 1 19 LEU n 1 20 GLU n 1 21 LYS n 1 22 ASP n 1 23 ASP n 1 24 GLY n 1 25 LYS n 1 26 VAL n 1 27 SER n 1 28 GLY n 1 29 ASP n 1 30 THR n 1 31 VAL n 1 32 THR n 1 33 TYR n 1 34 SER n 1 35 GLY n 1 36 LYS n 1 37 THR n 1 38 VAL n 1 39 HIS n 1 40 VAL n 1 41 VAL n 1 42 ALA n 1 43 ALA n 1 44 ALA n 1 45 VAL n 1 46 LEU n 1 47 PRO n 1 48 GLY n 1 49 PHE n 1 50 PRO n 1 51 PHE n 1 52 PRO n 1 53 SER n 1 54 PHE n 1 55 GLU n 1 56 VAL n 1 57 HIS n 1 58 ASP n 1 59 LYS n 1 60 LYS n 1 61 ASN n 1 62 PRO n 1 63 THR n 1 64 LEU n 1 65 GLU n 1 66 ILE n 1 67 PRO n 1 68 ALA n 1 69 GLY n 1 70 ALA n 1 71 THR n 1 72 VAL n 1 73 ASP n 1 74 VAL n 1 75 THR n 1 76 PHE n 1 77 ILE n 1 78 ASN n 1 79 THR n 1 80 ASN n 1 81 LYS n 1 82 GLY n 1 83 PHE n 1 84 GLY n 1 85 HIS n 1 86 SER n 1 87 PHE n 1 88 ASP n 1 89 ILE n 1 90 THR n 1 91 LYS n 1 92 LYS n 1 93 GLY n 1 94 PRO n 1 95 PRO n 1 96 TYR n 1 97 ALA n 1 98 VAL n 1 99 MET n 1 100 PRO n 1 101 VAL n 1 102 ILE n 1 103 ASP n 1 104 PRO n 1 105 ILE n 1 106 VAL n 1 107 ALA n 1 108 GLY n 1 109 THR n 1 110 GLY n 1 111 PHE n 1 112 SER n 1 113 PRO n 1 114 VAL n 1 115 PRO n 1 116 LYS n 1 117 ASP n 1 118 GLY n 1 119 LYS n 1 120 PHE n 1 121 GLY n 1 122 TYR n 1 123 THR n 1 124 ASP n 1 125 PHE n 1 126 THR n 1 127 TRP n 1 128 HIS n 1 129 PRO n 1 130 THR n 1 131 ALA n 1 132 GLY n 1 133 THR n 1 134 TYR n 1 135 TYR n 1 136 TYR n 1 137 VAL n 1 138 CYS n 1 139 GLN n 1 140 ILE n 1 141 PRO n 1 142 GLY n 1 143 HIS n 1 144 ALA n 1 145 ALA n 1 146 THR n 1 147 GLY n 1 148 MET n 1 149 PHE n 1 150 GLY n 1 151 LYS n 1 152 ILE n 1 153 VAL n 1 154 VAL n 1 155 LYS n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Acidithiobacillus ferrooxidans' _entity_src_nat.pdbx_ncbi_taxonomy_id 920 _entity_src_nat.genus Acidithiobacillus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location PERIPLASM _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RUS2_THIFE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P24930 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MYTQNTMKKNWYVTVGAAAALAATVGMGTAMAGTLDSTWKEATLPQVKAMLEKDTGKVSGDTVTYSGKTVHVVAAAVLPG FPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWH PTAGTYYYVCQIPGHAATGMFGKIIVK ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1A3Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 155 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P24930 _struct_ref_seq.db_align_beg 33 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 187 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 155 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1A3Z ASP A 23 ? UNP P24930 THR 55 conflict 23 1 1 1A3Z VAL A 153 ? UNP P24930 ILE 185 conflict 153 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU1 non-polymer . 'COPPER (I) ION' ? 'Cu 1' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1A3Z _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_percent_sol 44 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;VAPOR DIFFUSION IN HANGING DROPS AGAINST 100 MM-SODIUM CITRATE, PH 4.6, 200 MM LITHIUM CHLORIDE AND 25%(W/V) PEG 8000 AT 277K. CRYSTALS SOAKED IN 10MM DITHIONITE FOR 3 DAYS PRIOR TO DATA COLLECTION., vapor diffusion - hanging drop ; # _diffrn.id 1 _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'AREA DETECTOR' _diffrn_detector.type ADSC _diffrn_detector.pdbx_collection_date 1995-06 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GRAPHITE(002)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1A3Z _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 100 _reflns.d_resolution_high 1.90 _reflns.number_obs 9718 _reflns.number_all ? _reflns.percent_possible_obs 87.4 _reflns.pdbx_Rmerge_I_obs 0.0630000 _reflns.pdbx_Rsym_value 0.0630000 _reflns.pdbx_netI_over_sigmaI 13.3 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 1.97 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.90 _reflns_shell.d_res_low 1.969 _reflns_shell.percent_possible_all 78 _reflns_shell.Rmerge_I_obs 0.1990000 _reflns_shell.pdbx_Rsym_value 0.1990000 _reflns_shell.meanI_over_sigI_obs 3.02 _reflns_shell.pdbx_redundancy 1.42 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1A3Z _refine.ls_number_reflns_obs 9664 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF 1000000.00 _refine.pdbx_data_cutoff_low_absF 0.001 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 100.0 _refine.ls_d_res_high 1.90 _refine.ls_percent_reflns_obs 87.4 _refine.ls_R_factor_obs 0.2130000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2130000 _refine.ls_R_factor_R_free 0.2720000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 518 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 19.0 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1RCY' _refine.pdbx_method_to_determine_struct 'PHASES TAKEN FROM THE OXIDIZED FORM, PDB ENTRY 1RCY' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1135 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 85 _refine_hist.number_atoms_total 1220 _refine_hist.d_res_high 1.90 _refine_hist.d_res_low 100.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 28.9 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 0.70 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 3.042 ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 3.984 ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 4.240 ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 5.579 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 1.90 _refine_ls_shell.d_res_low 1.99 _refine_ls_shell.number_reflns_R_work 990 _refine_ls_shell.R_factor_R_work 0.3120000 _refine_ls_shell.percent_reflns_obs 77.1 _refine_ls_shell.R_factor_R_free 0.3680000 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 5 _refine_ls_shell.number_reflns_R_free 52 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM TOPH19.PEP 'X-RAY DIFFRACTION' 2 ? TOPH19.SOL 'X-RAY DIFFRACTION' 3 ? TOPHCSDX.PRO 'X-RAY DIFFRACTION' # _struct.entry_id 1A3Z _struct.title 'REDUCED RUSTICYANIN AT 1.9 ANGSTROMS' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1A3Z _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'CUPREDOXIN, METALLOPROTEIN, REDOX POTENTIAL, ACIDOPHILIC, ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 12 ? LYS A 21 ? LEU A 12 LYS A 21 1 ? 10 HELX_P HELX_P2 2 ALA A 144 ? THR A 146 ? ALA A 144 THR A 146 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 85 ND1 ? ? ? 1_555 B CU1 . CU ? ? A HIS 85 A CU1 156 1_555 ? ? ? ? ? ? ? 2.222 ? ? metalc2 metalc ? ? A CYS 138 SG ? ? ? 1_555 B CU1 . CU ? ? A CYS 138 A CU1 156 1_555 ? ? ? ? ? ? ? 2.251 ? ? metalc3 metalc ? ? A HIS 143 ND1 ? ? ? 1_555 B CU1 . CU ? ? A HIS 143 A CU1 156 1_555 ? ? ? ? ? ? ? 1.955 ? ? metalc4 metalc ? ? A MET 148 SD ? ? ? 1_555 B CU1 . CU ? ? A MET 148 A CU1 156 1_555 ? ? ? ? ? ? ? 2.747 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 51 A . ? PHE 51 A PRO 52 A ? PRO 52 A 1 -0.53 2 PRO 94 A . ? PRO 94 A PRO 95 A ? PRO 95 A 1 0.07 3 ASP 103 A . ? ASP 103 A PRO 104 A ? PRO 104 A 1 0.18 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? parallel B 3 4 ? parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 8 ? THR A 11 ? LYS A 8 THR A 11 A 2 LYS A 119 ? TRP A 127 ? LYS A 119 TRP A 127 A 3 THR A 71 ? ASN A 78 ? THR A 71 ASN A 78 A 4 THR A 37 ? ALA A 44 ? THR A 37 ALA A 44 A 5 PHE A 54 ? VAL A 56 ? PHE A 54 VAL A 56 B 1 LYS A 25 ? SER A 27 ? LYS A 25 SER A 27 B 2 THR A 30 ? THR A 32 ? THR A 30 THR A 32 B 3 THR A 63 ? ILE A 66 ? THR A 63 ILE A 66 B 4 PHE A 149 ? VAL A 154 ? PHE A 149 VAL A 154 B 5 GLY A 132 ? VAL A 137 ? GLY A 132 VAL A 137 B 6 ASP A 88 ? THR A 90 ? ASP A 88 THR A 90 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 8 ? O LYS A 8 N TYR A 122 ? N TYR A 122 A 2 3 O THR A 123 ? O THR A 123 N PHE A 76 ? N PHE A 76 A 3 4 O THR A 71 ? O THR A 71 N VAL A 38 ? N VAL A 38 A 4 5 O ALA A 43 ? O ALA A 43 N GLU A 55 ? N GLU A 55 B 1 2 O LYS A 25 ? O LYS A 25 N THR A 32 ? N THR A 32 B 2 3 O VAL A 31 ? O VAL A 31 N THR A 63 ? N THR A 63 B 3 4 O LEU A 64 ? O LEU A 64 N VAL A 153 ? N VAL A 153 B 4 5 O GLY A 150 ? O GLY A 150 N TYR A 136 ? N TYR A 136 B 5 6 O TYR A 135 ? O TYR A 135 N THR A 90 ? N THR A 90 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details CU Unknown ? ? ? ? 5 'COPPER BINDING SITE' AC1 Software A CU1 156 ? 4 'BINDING SITE FOR RESIDUE CU1 A 156' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 CU 5 HIS A 85 ? HIS A 85 . ? 1_555 ? 2 CU 5 CYS A 138 ? CYS A 138 . ? 1_555 ? 3 CU 5 HIS A 143 ? HIS A 143 . ? 1_555 ? 4 CU 5 MET A 148 ? MET A 148 . ? 1_555 ? 5 CU 5 CU1 B . ? CU1 A 156 . ? 1_555 ? 6 AC1 4 HIS A 85 ? HIS A 85 . ? 1_555 ? 7 AC1 4 CYS A 138 ? CYS A 138 . ? 1_555 ? 8 AC1 4 HIS A 143 ? HIS A 143 . ? 1_555 ? 9 AC1 4 MET A 148 ? MET A 148 . ? 1_555 ? # _database_PDB_matrix.entry_id 1A3Z _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1A3Z _atom_sites.fract_transf_matrix[1][1] 0.030817 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.010025 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016504 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.027615 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 MET 99 99 99 MET MET A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 TRP 127 127 127 TRP TRP A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 TYR 135 135 135 TYR TYR A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 CYS 138 138 138 CYS CYS A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 MET 148 148 148 MET MET A . n A 1 149 PHE 149 149 149 PHE PHE A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 LYS 155 155 155 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU1 1 156 156 CU1 CU1 A . C 3 HOH 1 201 201 HOH HOH A . C 3 HOH 2 202 202 HOH HOH A . C 3 HOH 3 203 203 HOH HOH A . C 3 HOH 4 204 204 HOH HOH A . C 3 HOH 5 205 205 HOH HOH A . C 3 HOH 6 206 206 HOH HOH A . C 3 HOH 7 207 207 HOH HOH A . C 3 HOH 8 208 208 HOH HOH A . C 3 HOH 9 209 209 HOH HOH A . C 3 HOH 10 210 210 HOH HOH A . C 3 HOH 11 211 211 HOH HOH A . C 3 HOH 12 212 212 HOH HOH A . C 3 HOH 13 213 213 HOH HOH A . C 3 HOH 14 214 214 HOH HOH A . C 3 HOH 15 215 215 HOH HOH A . C 3 HOH 16 216 216 HOH HOH A . C 3 HOH 17 217 217 HOH HOH A . C 3 HOH 18 218 218 HOH HOH A . C 3 HOH 19 219 219 HOH HOH A . C 3 HOH 20 220 220 HOH HOH A . C 3 HOH 21 221 221 HOH HOH A . C 3 HOH 22 222 222 HOH HOH A . C 3 HOH 23 223 223 HOH HOH A . C 3 HOH 24 224 224 HOH HOH A . C 3 HOH 25 225 225 HOH HOH A . C 3 HOH 26 226 226 HOH HOH A . C 3 HOH 27 227 227 HOH HOH A . C 3 HOH 28 228 228 HOH HOH A . C 3 HOH 29 229 229 HOH HOH A . C 3 HOH 30 230 230 HOH HOH A . C 3 HOH 31 231 231 HOH HOH A . C 3 HOH 32 232 232 HOH HOH A . C 3 HOH 33 233 233 HOH HOH A . C 3 HOH 34 234 234 HOH HOH A . C 3 HOH 35 235 235 HOH HOH A . C 3 HOH 36 236 236 HOH HOH A . C 3 HOH 37 237 237 HOH HOH A . C 3 HOH 38 238 238 HOH HOH A . C 3 HOH 39 239 239 HOH HOH A . C 3 HOH 40 240 240 HOH HOH A . C 3 HOH 41 241 241 HOH HOH A . C 3 HOH 42 242 242 HOH HOH A . C 3 HOH 43 243 243 HOH HOH A . C 3 HOH 44 244 244 HOH HOH A . C 3 HOH 45 245 245 HOH HOH A . C 3 HOH 46 246 246 HOH HOH A . C 3 HOH 47 247 247 HOH HOH A . C 3 HOH 48 248 248 HOH HOH A . C 3 HOH 49 249 249 HOH HOH A . C 3 HOH 50 250 250 HOH HOH A . C 3 HOH 51 251 251 HOH HOH A . C 3 HOH 52 252 252 HOH HOH A . C 3 HOH 53 253 253 HOH HOH A . C 3 HOH 54 254 254 HOH HOH A . C 3 HOH 55 255 255 HOH HOH A . C 3 HOH 56 256 256 HOH HOH A . C 3 HOH 57 257 257 HOH HOH A . C 3 HOH 58 258 258 HOH HOH A . C 3 HOH 59 259 259 HOH HOH A . C 3 HOH 60 260 260 HOH HOH A . C 3 HOH 61 261 261 HOH HOH A . C 3 HOH 62 262 262 HOH HOH A . C 3 HOH 63 263 263 HOH HOH A . C 3 HOH 64 264 264 HOH HOH A . C 3 HOH 65 265 265 HOH HOH A . C 3 HOH 66 266 266 HOH HOH A . C 3 HOH 67 267 267 HOH HOH A . C 3 HOH 68 268 268 HOH HOH A . C 3 HOH 69 269 269 HOH HOH A . C 3 HOH 70 270 270 HOH HOH A . C 3 HOH 71 271 271 HOH HOH A . C 3 HOH 72 272 272 HOH HOH A . C 3 HOH 73 273 273 HOH HOH A . C 3 HOH 74 274 274 HOH HOH A . C 3 HOH 75 275 275 HOH HOH A . C 3 HOH 76 276 276 HOH HOH A . C 3 HOH 77 277 277 HOH HOH A . C 3 HOH 78 278 278 HOH HOH A . C 3 HOH 79 279 279 HOH HOH A . C 3 HOH 80 280 280 HOH HOH A . C 3 HOH 81 281 281 HOH HOH A . C 3 HOH 82 282 282 HOH HOH A . C 3 HOH 83 283 283 HOH HOH A . C 3 HOH 84 284 284 HOH HOH A . C 3 HOH 85 285 285 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 85 ? A HIS 85 ? 1_555 CU ? B CU1 . ? A CU1 156 ? 1_555 SG ? A CYS 138 ? A CYS 138 ? 1_555 126.7 ? 2 ND1 ? A HIS 85 ? A HIS 85 ? 1_555 CU ? B CU1 . ? A CU1 156 ? 1_555 ND1 ? A HIS 143 ? A HIS 143 ? 1_555 103.6 ? 3 SG ? A CYS 138 ? A CYS 138 ? 1_555 CU ? B CU1 . ? A CU1 156 ? 1_555 ND1 ? A HIS 143 ? A HIS 143 ? 1_555 118.7 ? 4 ND1 ? A HIS 85 ? A HIS 85 ? 1_555 CU ? B CU1 . ? A CU1 156 ? 1_555 SD ? A MET 148 ? A MET 148 ? 1_555 91.1 ? 5 SG ? A CYS 138 ? A CYS 138 ? 1_555 CU ? B CU1 . ? A CU1 156 ? 1_555 SD ? A MET 148 ? A MET 148 ? 1_555 106.2 ? 6 ND1 ? A HIS 143 ? A HIS 143 ? 1_555 CU ? B CU1 . ? A CU1 156 ? 1_555 SD ? A MET 148 ? A MET 148 ? 1_555 105.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-07-29 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_initial_refinement_model 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif 5 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 4 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 5 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 9 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 15 4 'Structure model' '_struct_ref_seq_dif.details' 16 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 17 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 18 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.8 ? 1 X-PLOR refinement 3.8 ? 2 ADSC 'data collection' . ? 3 X-PLOR phasing 3.8 ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 29 ? ? -93.79 44.01 2 1 VAL A 45 ? ? 54.42 79.04 3 1 ASN A 61 ? ? 34.61 55.24 4 1 PRO A 141 ? ? -38.99 125.00 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 36 ? CG ? A LYS 36 CG 2 1 Y 1 A LYS 36 ? CD ? A LYS 36 CD 3 1 Y 1 A LYS 36 ? CE ? A LYS 36 CE 4 1 Y 1 A LYS 36 ? NZ ? A LYS 36 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A ASP 4 ? A ASP 4 5 1 Y 1 A SER 5 ? A SER 5 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (I) ION' CU1 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1RCY _pdbx_initial_refinement_model.details 'PDB ENTRY 1RCY' #