data_1A62 # _entry.id 1A62 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1A62 WWPDB D_1000170437 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1A62 _pdbx_database_status.recvd_initial_deposition_date 1998-03-05 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Allison, T.J.' 1 'Wood, T.C.' 2 'Briercheck, D.M.' 3 'Rastinejad, F.' 4 'Richardson, J.P.' 5 'Rule, G.S.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystal structure of the RNA-binding domain from transcription termination factor rho.' Nat.Struct.Biol. 5 352 356 1998 NSBIEW US 1072-8368 2024 ? 9586995 10.1038/nsb0598-352 1 'The NMR Structure of the RNA Binding Domain of E. Coli Rho Factor Suggests Possible RNA-Protein Interactions' Nat.Struct.Biol. 5 393 ? 1998 NSBIEW US 1072-8368 2024 ? ? ? 2 '1H, 15N and 13C Resonance Assignments and Secondary Structure Determination of the RNA-Binding Domain of E.Coli Rho Protein' J.Biomol.NMR 8 429 ? 1996 JBNME9 NE 0925-2738 0800 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Allison, T.J.' 1 primary 'Wood, T.C.' 2 primary 'Briercheck, D.M.' 3 primary 'Rastinejad, F.' 4 primary 'Richardson, J.P.' 5 primary 'Rule, G.S.' 6 1 'Briercheck, D.M.' 7 1 'Wood, T.C.' 8 1 'Allison, T.J.' 9 1 'Richardson, J.P.' 10 1 'Rule, G.S.' 11 2 'Briercheck, D.M.' 12 2 'Allison, T.J.' 13 2 'Richardson, J.P.' 14 2 'Ellena, J.F.' 15 2 'Wood, T.C.' 16 2 'Rule, G.S.' 17 # _cell.entry_id 1A62 _cell.length_a 25.950 _cell.length_b 56.010 _cell.length_c 42.920 _cell.angle_alpha 90.00 _cell.angle_beta 99.35 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1A62 _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man RHO 14775.287 1 ? ? 'RNA BINDING DOMAIN, RESIDUES 1 - 130' ? 2 water nat water 18.015 115 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)NLTELKNTPVSELITLGEN(MSE)GLENLAR(MSE)RKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSA DSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVNFDKPENARNK ; _entity_poly.pdbx_seq_one_letter_code_can ;MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIY VSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVNFDKPENARNK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ASN n 1 3 LEU n 1 4 THR n 1 5 GLU n 1 6 LEU n 1 7 LYS n 1 8 ASN n 1 9 THR n 1 10 PRO n 1 11 VAL n 1 12 SER n 1 13 GLU n 1 14 LEU n 1 15 ILE n 1 16 THR n 1 17 LEU n 1 18 GLY n 1 19 GLU n 1 20 ASN n 1 21 MSE n 1 22 GLY n 1 23 LEU n 1 24 GLU n 1 25 ASN n 1 26 LEU n 1 27 ALA n 1 28 ARG n 1 29 MSE n 1 30 ARG n 1 31 LYS n 1 32 GLN n 1 33 ASP n 1 34 ILE n 1 35 ILE n 1 36 PHE n 1 37 ALA n 1 38 ILE n 1 39 LEU n 1 40 LYS n 1 41 GLN n 1 42 HIS n 1 43 ALA n 1 44 LYS n 1 45 SER n 1 46 GLY n 1 47 GLU n 1 48 ASP n 1 49 ILE n 1 50 PHE n 1 51 GLY n 1 52 ASP n 1 53 GLY n 1 54 VAL n 1 55 LEU n 1 56 GLU n 1 57 ILE n 1 58 LEU n 1 59 GLN n 1 60 ASP n 1 61 GLY n 1 62 PHE n 1 63 GLY n 1 64 PHE n 1 65 LEU n 1 66 ARG n 1 67 SER n 1 68 ALA n 1 69 ASP n 1 70 SER n 1 71 SER n 1 72 TYR n 1 73 LEU n 1 74 ALA n 1 75 GLY n 1 76 PRO n 1 77 ASP n 1 78 ASP n 1 79 ILE n 1 80 TYR n 1 81 VAL n 1 82 SER n 1 83 PRO n 1 84 SER n 1 85 GLN n 1 86 ILE n 1 87 ARG n 1 88 ARG n 1 89 PHE n 1 90 ASN n 1 91 LEU n 1 92 ARG n 1 93 THR n 1 94 GLY n 1 95 ASP n 1 96 THR n 1 97 ILE n 1 98 SER n 1 99 GLY n 1 100 LYS n 1 101 ILE n 1 102 ARG n 1 103 PRO n 1 104 PRO n 1 105 LYS n 1 106 GLU n 1 107 GLY n 1 108 GLU n 1 109 ARG n 1 110 TYR n 1 111 PHE n 1 112 ALA n 1 113 LEU n 1 114 LEU n 1 115 LYS n 1 116 VAL n 1 117 ASN n 1 118 GLU n 1 119 VAL n 1 120 ASN n 1 121 PHE n 1 122 ASP n 1 123 LYS n 1 124 PRO n 1 125 GLU n 1 126 ASN n 1 127 ALA n 1 128 ARG n 1 129 ASN n 1 130 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Escherichia coli' _entity_src_gen.gene_src_strain 'BL21 (DE3)' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 469008 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene RHO _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector T7 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET11A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RHO_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P03002 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIY VSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVNFDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTAR VLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATAL IDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLI NKLAMTKTNDDFFEMMKRS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1A62 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03002 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 130 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1A62 MSE A 21 ? UNP P03002 MET 21 'MODIFIED RESIDUE' 21 1 1 1A62 MSE A 29 ? UNP P03002 MET 29 'MODIFIED RESIDUE' 29 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1A62 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 4 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.08 _exptl_crystal.density_percent_sol 33. _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 7.0' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type FUJI _diffrn_detector.pdbx_collection_date 1997-05 _diffrn_detector.details MIRROR # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(111)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.969 1.0 2 0.978 1.0 3 0.979 1.0 4 0.984 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.969, 0.978, 0.979, 0.984' # _reflns.entry_id 1A62 _reflns.observed_criterion_sigma_I 0.01 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30. _reflns.d_resolution_high 1.55 _reflns.number_obs 16360 _reflns.number_all ? _reflns.percent_possible_obs 92. _reflns.pdbx_Rmerge_I_obs 0.0680000 _reflns.pdbx_Rsym_value 0.0400000 _reflns.pdbx_netI_over_sigmaI 22. _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 6.0 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.55 _reflns_shell.d_res_low 1.61 _reflns_shell.percent_possible_all 67. _reflns_shell.Rmerge_I_obs 0.2700000 _reflns_shell.pdbx_Rsym_value 0.2600000 _reflns_shell.meanI_over_sigI_obs 5.2 _reflns_shell.pdbx_redundancy 5. _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1A62 _refine.ls_number_reflns_obs 16360 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.01 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30. _refine.ls_d_res_high 1.55 _refine.ls_percent_reflns_obs 92. _refine.ls_R_factor_obs 0.2160000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2160000 _refine.ls_R_factor_R_free 0.2500000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10. _refine.ls_number_reflns_R_free 1636 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 21.1 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 988 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 115 _refine_hist.number_atoms_total 1103 _refine_hist.d_res_high 1.55 _refine_hist.d_res_low 30. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.011 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.32 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARAM19X.PRO TOPH19X.PRO 'X-RAY DIFFRACTION' 2 ? ? 'X-RAY DIFFRACTION' # _struct.entry_id 1A62 _struct.title 'CRYSTAL STRUCTURE OF THE RNA-BINDING DOMAIN OF THE TRANSCRIPTIONAL TERMINATOR PROTEIN RHO' _struct.pdbx_descriptor RHO _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1A62 _struct_keywords.pdbx_keywords 'TRANSCRIPTION TERMINATION' _struct_keywords.text 'TRANSCRIPTION TERMINATION, TERMINATION, RNA BINDING DOMAIN, TRANSCRIPTION REGULATION, OB FOLD, F1-ATPASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 3 ? LYS A 7 ? LEU A 3 LYS A 7 1 ? 5 HELX_P HELX_P2 2 VAL A 11 ? MSE A 21 ? VAL A 11 MSE A 21 1 ? 11 HELX_P HELX_P3 3 LYS A 31 ? SER A 45 ? LYS A 31 SER A 45 1 ? 15 HELX_P HELX_P4 4 ALA A 68 ? SER A 70 ? ALA A 68 SER A 70 5 ? 3 HELX_P HELX_P5 5 PRO A 83 ? ARG A 88 ? PRO A 83 ARG A 88 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 1 C ? ? ? 1_555 A ASN 2 N ? ? A MSE 1 A ASN 2 1_555 ? ? ? ? ? ? ? 1.332 ? covale2 covale ? ? A MSE 21 N ? ? ? 1_555 A ASN 20 C ? ? A MSE 21 A ASN 20 1_555 ? ? ? ? ? ? ? 1.338 ? covale3 covale ? ? A MSE 21 C ? ? ? 1_555 A GLY 22 N ? ? A MSE 21 A GLY 22 1_555 ? ? ? ? ? ? ? 1.336 ? covale4 covale ? ? A MSE 29 N ? ? ? 1_555 A ARG 28 C ? ? A MSE 29 A ARG 28 1_555 ? ? ? ? ? ? ? 1.327 ? covale5 covale ? ? A MSE 29 C ? ? ? 1_555 A ARG 30 N ? ? A MSE 29 A ARG 30 1_555 ? ? ? ? ? ? ? 1.328 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 79 ? VAL A 81 ? ILE A 79 VAL A 81 A 2 GLY A 63 ? ARG A 66 ? GLY A 63 ARG A 66 A 3 ILE A 49 ? ILE A 57 ? ILE A 49 ILE A 57 A 4 THR A 96 ? ILE A 101 ? THR A 96 ILE A 101 A 5 LYS A 115 ? VAL A 119 ? LYS A 115 VAL A 119 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 79 ? O ILE A 79 N LEU A 65 ? N LEU A 65 A 2 3 O PHE A 64 ? O PHE A 64 N GLU A 56 ? N GLU A 56 A 3 4 O ILE A 49 ? O ILE A 49 N ILE A 101 ? N ILE A 101 A 4 5 O SER A 98 ? O SER A 98 N GLU A 118 ? N GLU A 118 # _database_PDB_matrix.entry_id 1A62 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1A62 _atom_sites.fract_transf_matrix[1][1] 0.038536 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.006345 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017854 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023613 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 MSE 21 21 21 MSE MSE A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 MSE 29 29 29 MSE MSE A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 ASN 126 126 ? ? ? A . n A 1 127 ALA 127 127 ? ? ? A . n A 1 128 ARG 128 128 ? ? ? A . n A 1 129 ASN 129 129 ? ? ? A . n A 1 130 LYS 130 130 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 1001 1001 HOH HOH A . B 2 HOH 2 1002 1002 HOH HOH A . B 2 HOH 3 1003 1003 HOH HOH A . B 2 HOH 4 1004 1004 HOH HOH A . B 2 HOH 5 1005 1005 HOH HOH A . B 2 HOH 6 1006 1006 HOH HOH A . B 2 HOH 7 1007 1007 HOH HOH A . B 2 HOH 8 1008 1008 HOH HOH A . B 2 HOH 9 1009 1009 HOH HOH A . B 2 HOH 10 1011 1011 HOH HOH A . B 2 HOH 11 1012 1012 HOH HOH A . B 2 HOH 12 1013 1013 HOH HOH A . B 2 HOH 13 1014 1014 HOH HOH A . B 2 HOH 14 1015 1015 HOH HOH A . B 2 HOH 15 1016 1016 HOH HOH A . B 2 HOH 16 1017 1017 HOH HOH A . B 2 HOH 17 1018 1018 HOH HOH A . B 2 HOH 18 1019 1019 HOH HOH A . B 2 HOH 19 1020 1020 HOH HOH A . B 2 HOH 20 1021 1021 HOH HOH A . B 2 HOH 21 1022 1022 HOH HOH A . B 2 HOH 22 1023 1023 HOH HOH A . B 2 HOH 23 1024 1024 HOH HOH A . B 2 HOH 24 1025 1025 HOH HOH A . B 2 HOH 25 1026 1026 HOH HOH A . B 2 HOH 26 1030 1030 HOH HOH A . B 2 HOH 27 1032 1032 HOH HOH A . B 2 HOH 28 1035 1035 HOH HOH A . B 2 HOH 29 1036 1036 HOH HOH A . B 2 HOH 30 1037 1037 HOH HOH A . B 2 HOH 31 1039 1039 HOH HOH A . B 2 HOH 32 1042 1042 HOH HOH A . B 2 HOH 33 1043 1043 HOH HOH A . B 2 HOH 34 1048 1048 HOH HOH A . B 2 HOH 35 1049 1049 HOH HOH A . B 2 HOH 36 1050 1050 HOH HOH A . B 2 HOH 37 1052 1052 HOH HOH A . B 2 HOH 38 1053 1053 HOH HOH A . B 2 HOH 39 1054 1054 HOH HOH A . B 2 HOH 40 1061 1061 HOH HOH A . B 2 HOH 41 1064 1064 HOH HOH A . B 2 HOH 42 1075 1075 HOH HOH A . B 2 HOH 43 1077 1077 HOH HOH A . B 2 HOH 44 1079 1079 HOH HOH A . B 2 HOH 45 1089 1089 HOH HOH A . B 2 HOH 46 1107 1107 HOH HOH A . B 2 HOH 47 1120 1120 HOH HOH A . B 2 HOH 48 1133 1133 HOH HOH A . B 2 HOH 49 1134 1134 HOH HOH A . B 2 HOH 50 1150 1150 HOH HOH A . B 2 HOH 51 1152 1152 HOH HOH A . B 2 HOH 52 2006 2006 HOH HOH A . B 2 HOH 53 2008 2008 HOH HOH A . B 2 HOH 54 2018 2018 HOH HOH A . B 2 HOH 55 2029 2029 HOH HOH A . B 2 HOH 56 2045 2045 HOH HOH A . B 2 HOH 57 2059 2059 HOH HOH A . B 2 HOH 58 2074 2074 HOH HOH A . B 2 HOH 59 2096 2096 HOH HOH A . B 2 HOH 60 2207 2207 HOH HOH A . B 2 HOH 61 3002 3002 HOH HOH A . B 2 HOH 62 3004 3004 HOH HOH A . B 2 HOH 63 3006 3006 HOH HOH A . B 2 HOH 64 3008 3008 HOH HOH A . B 2 HOH 65 3011 3011 HOH HOH A . B 2 HOH 66 3012 3012 HOH HOH A . B 2 HOH 67 3013 3013 HOH HOH A . B 2 HOH 68 3016 3016 HOH HOH A . B 2 HOH 69 3022 3022 HOH HOH A . B 2 HOH 70 3037 3037 HOH HOH A . B 2 HOH 71 3044 3044 HOH HOH A . B 2 HOH 72 3053 3053 HOH HOH A . B 2 HOH 73 3177 3177 HOH HOH A . B 2 HOH 74 3203 3203 HOH HOH A . B 2 HOH 75 4001 4001 HOH HOH A . B 2 HOH 76 4015 4015 HOH HOH A . B 2 HOH 77 4023 4023 HOH HOH A . B 2 HOH 78 4025 4025 HOH HOH A . B 2 HOH 79 4034 4034 HOH HOH A . B 2 HOH 80 4035 4035 HOH HOH A . B 2 HOH 81 4038 4038 HOH HOH A . B 2 HOH 82 4039 4039 HOH HOH A . B 2 HOH 83 4040 4040 HOH HOH A . B 2 HOH 84 4047 4047 HOH HOH A . B 2 HOH 85 4055 4055 HOH HOH A . B 2 HOH 86 4061 4061 HOH HOH A . B 2 HOH 87 4066 4066 HOH HOH A . B 2 HOH 88 4072 4072 HOH HOH A . B 2 HOH 89 4079 4079 HOH HOH A . B 2 HOH 90 4102 4102 HOH HOH A . B 2 HOH 91 4111 4111 HOH HOH A . B 2 HOH 92 4119 4119 HOH HOH A . B 2 HOH 93 4124 4124 HOH HOH A . B 2 HOH 94 4191 4191 HOH HOH A . B 2 HOH 95 5002 5002 HOH HOH A . B 2 HOH 96 5007 5007 HOH HOH A . B 2 HOH 97 5009 5009 HOH HOH A . B 2 HOH 98 5010 5010 HOH HOH A . B 2 HOH 99 5012 5012 HOH HOH A . B 2 HOH 100 5013 5013 HOH HOH A . B 2 HOH 101 5015 5015 HOH HOH A . B 2 HOH 102 5018 5018 HOH HOH A . B 2 HOH 103 5020 5020 HOH HOH A . B 2 HOH 104 5024 5024 HOH HOH A . B 2 HOH 105 5029 5029 HOH HOH A . B 2 HOH 106 5033 5033 HOH HOH A . B 2 HOH 107 5034 5034 HOH HOH A . B 2 HOH 108 5038 5038 HOH HOH A . B 2 HOH 109 5044 5044 HOH HOH A . B 2 HOH 110 5058 5058 HOH HOH A . B 2 HOH 111 5061 5061 HOH HOH A . B 2 HOH 112 5063 5063 HOH HOH A . B 2 HOH 113 5084 5084 HOH HOH A . B 2 HOH 114 5093 5093 HOH HOH A . B 2 HOH 115 5094 5094 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 21 A MSE 21 ? MET SELENOMETHIONINE 3 A MSE 29 A MSE 29 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-06-17 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 X-PLOR phasing . ? 5 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CG _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 MSE _pdbx_validate_rmsd_bond.auth_seq_id_1 21 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 SE _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 MSE _pdbx_validate_rmsd_bond.auth_seq_id_2 21 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.698 _pdbx_validate_rmsd_bond.bond_target_value 1.950 _pdbx_validate_rmsd_bond.bond_deviation -0.252 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.034 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 72 ? ? 84.52 17.83 2 1 PHE A 121 ? ? 59.77 15.30 3 1 PRO A 124 ? ? -54.43 14.21 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 126 ? A ASN 126 2 1 Y 1 A ALA 127 ? A ALA 127 3 1 Y 1 A ARG 128 ? A ARG 128 4 1 Y 1 A ASN 129 ? A ASN 129 5 1 Y 1 A LYS 130 ? A LYS 130 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #