data_1ABV # _entry.id 1ABV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ABV pdb_00001abv 10.2210/pdb1abv/pdb WWPDB D_1000170633 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ABV _pdbx_database_status.recvd_initial_deposition_date 1997-01-29 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wilkens, S.' 1 'Dunn, S.D.' 2 'Chandler, J.' 3 'Dahlquist, F.W.' 4 'Capaldi, R.A.' 5 # _citation.id primary _citation.title 'Solution structure of the N-terminal domain of the delta subunit of the E. coli ATPsynthase.' _citation.journal_abbrev Nat.Struct.Biol. _citation.journal_volume 4 _citation.page_first 198 _citation.page_last 201 _citation.year 1997 _citation.journal_id_ASTM NSBIEW _citation.country US _citation.journal_id_ISSN 1072-8368 _citation.journal_id_CSD 2024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9164460 _citation.pdbx_database_id_DOI 10.1038/nsb0397-198 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wilkens, S.' 1 ? primary 'Dunn, S.D.' 2 ? primary 'Chandler, J.' 3 ? primary 'Dahlquist, F.W.' 4 ? primary 'Capaldi, R.A.' 5 ? # _cell.entry_id 1ABV _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ABV _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DELTA SUBUNIT OF THE F1F0-ATP SYNTHASE' _entity.formula_weight 14676.533 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.6.1.34 _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-TERMINAL DOMAIN, RESIDUES 1 - 134' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGALAPETLAESFIAVCGEQLDENGQNLIRVMA ENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSR ; _entity_poly.pdbx_seq_one_letter_code_can ;SEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGALAPETLAESFIAVCGEQLDENGQNLIRVMA ENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 PHE n 1 4 ILE n 1 5 THR n 1 6 VAL n 1 7 ALA n 1 8 ARG n 1 9 PRO n 1 10 TYR n 1 11 ALA n 1 12 LYS n 1 13 ALA n 1 14 ALA n 1 15 PHE n 1 16 ASP n 1 17 PHE n 1 18 ALA n 1 19 VAL n 1 20 GLU n 1 21 HIS n 1 22 GLN n 1 23 SER n 1 24 VAL n 1 25 GLU n 1 26 ARG n 1 27 TRP n 1 28 GLN n 1 29 ASP n 1 30 MET n 1 31 LEU n 1 32 ALA n 1 33 PHE n 1 34 ALA n 1 35 ALA n 1 36 GLU n 1 37 VAL n 1 38 THR n 1 39 LYS n 1 40 ASN n 1 41 GLU n 1 42 GLN n 1 43 MET n 1 44 ALA n 1 45 GLU n 1 46 LEU n 1 47 LEU n 1 48 SER n 1 49 GLY n 1 50 ALA n 1 51 LEU n 1 52 ALA n 1 53 PRO n 1 54 GLU n 1 55 THR n 1 56 LEU n 1 57 ALA n 1 58 GLU n 1 59 SER n 1 60 PHE n 1 61 ILE n 1 62 ALA n 1 63 VAL n 1 64 CYS n 1 65 GLY n 1 66 GLU n 1 67 GLN n 1 68 LEU n 1 69 ASP n 1 70 GLU n 1 71 ASN n 1 72 GLY n 1 73 GLN n 1 74 ASN n 1 75 LEU n 1 76 ILE n 1 77 ARG n 1 78 VAL n 1 79 MET n 1 80 ALA n 1 81 GLU n 1 82 ASN n 1 83 GLY n 1 84 ARG n 1 85 LEU n 1 86 ASN n 1 87 ALA n 1 88 LEU n 1 89 PRO n 1 90 ASP n 1 91 VAL n 1 92 LEU n 1 93 GLU n 1 94 GLN n 1 95 PHE n 1 96 ILE n 1 97 HIS n 1 98 LEU n 1 99 ARG n 1 100 ALA n 1 101 VAL n 1 102 SER n 1 103 GLU n 1 104 ALA n 1 105 THR n 1 106 ALA n 1 107 GLU n 1 108 VAL n 1 109 ASP n 1 110 VAL n 1 111 ILE n 1 112 SER n 1 113 ALA n 1 114 ALA n 1 115 ALA n 1 116 LEU n 1 117 SER n 1 118 GLU n 1 119 GLN n 1 120 GLN n 1 121 LEU n 1 122 ALA n 1 123 LYS n 1 124 ILE n 1 125 SER n 1 126 ALA n 1 127 ALA n 1 128 MET n 1 129 GLU n 1 130 LYS n 1 131 ARG n 1 132 LEU n 1 133 SER n 1 134 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene UNCH _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'MM294 AND 594' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PJC1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATPD_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P0ABA4 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGALAPETLAESFIAVCGEQLDENGQNLIRVM AENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKLNCKIDKSVMAGVIIRAGDMVI DGSVRGRLERLADVLQS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ABV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0ABA4 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 135 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 134 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '3D NOESY-HSMQC' 1 2 1 '3D TOCSY-HSMQC' 1 3 1 '3D C(CO)NH' 1 4 1 '3D H(CCO)NH' 1 5 1 'SIMULTANEOUS 13C/15N RESOLVED NOESY' 1 6 1 'VARIOUS 2D EXPERIMENTS' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? _pdbx_nmr_exptl_sample_conditions.pH_units ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 GN GE 500 ? 2 UNITY Varian 500 ? # _pdbx_nmr_refine.entry_id 1ABV _pdbx_nmr_refine.method 'DG, SA, MD' _pdbx_nmr_refine.details ;REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE. THIS ENTRY CONTAINS THE MINIMIZED AVERAGE OVER 30 FILES. THE AVERAGE RMS DIFFERENCE TO THE MEAN STRUCTURE FOR NON-HYDROGEN ATOMS IS 1.25067. THE AVERAGE RMS DIFFERENCE TO THE MEAN STRUCTURE FOR THE BACKBONE IS 0.795004. THE B VALUE FIELD (COLUMNS 61 =66) CONTAINS THE RMS DIFFERENCE FROM THE MEAN. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1ABV _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ALL _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 1ABV _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure calculation' X-PLOR 3.1 BRUNGER 2 # _exptl.entry_id 1ABV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1ABV _struct.title 'N-TERMINAL DOMAIN OF THE DELTA SUBUNIT OF THE F1F0-ATP SYNTHASE FROM ESCHERICHIA COLI, NMR, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ABV _struct_keywords.pdbx_keywords 'ATP SYNTHESIS' _struct_keywords.text 'ATP SYNTHESIS, ATP SYNTHASE, F1-ATPASE, DELTA SUBUNIT, NMR SPECTROSCOPY' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 4 ? GLU A 20 ? ILE A 4 GLU A 20 1 ? 17 HELX_P HELX_P2 2 VAL A 24 ? THR A 38 ? VAL A 24 THR A 38 1 ? 15 HELX_P HELX_P3 3 GLU A 41 ? LEU A 47 ? GLU A 41 LEU A 47 1 ? 7 HELX_P HELX_P4 4 PRO A 53 ? CYS A 64 ? PRO A 53 CYS A 64 1 ? 12 HELX_P HELX_P5 5 GLU A 70 ? GLU A 81 ? GLU A 70 GLU A 81 1 ? 12 HELX_P HELX_P6 6 LEU A 88 ? GLU A 103 ? LEU A 88 GLU A 103 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1ABV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ABV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 ALA 106 106 ? ? ? A . n A 1 107 GLU 107 107 ? ? ? A . n A 1 108 VAL 108 108 ? ? ? A . n A 1 109 ASP 109 109 ? ? ? A . n A 1 110 VAL 110 110 ? ? ? A . n A 1 111 ILE 111 111 ? ? ? A . n A 1 112 SER 112 112 ? ? ? A . n A 1 113 ALA 113 113 ? ? ? A . n A 1 114 ALA 114 114 ? ? ? A . n A 1 115 ALA 115 115 ? ? ? A . n A 1 116 LEU 116 116 ? ? ? A . n A 1 117 SER 117 117 ? ? ? A . n A 1 118 GLU 118 118 ? ? ? A . n A 1 119 GLN 119 119 ? ? ? A . n A 1 120 GLN 120 120 ? ? ? A . n A 1 121 LEU 121 121 ? ? ? A . n A 1 122 ALA 122 122 ? ? ? A . n A 1 123 LYS 123 123 ? ? ? A . n A 1 124 ILE 124 124 ? ? ? A . n A 1 125 SER 125 125 ? ? ? A . n A 1 126 ALA 126 126 ? ? ? A . n A 1 127 ALA 127 127 ? ? ? A . n A 1 128 MET 128 128 ? ? ? A . n A 1 129 GLU 129 129 ? ? ? A . n A 1 130 LYS 130 130 ? ? ? A . n A 1 131 ARG 131 131 ? ? ? A . n A 1 132 LEU 132 132 ? ? ? A . n A 1 133 SER 133 133 ? ? ? A . n A 1 134 ARG 134 134 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-07-07 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_representative 4 4 'Structure model' pdbx_nmr_software 5 4 'Structure model' pdbx_nmr_spectrometer 6 4 'Structure model' pdbx_struct_assembly 7 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.authors' 5 4 'Structure model' '_pdbx_nmr_software.classification' 6 4 'Structure model' '_pdbx_nmr_software.version' 7 4 'Structure model' '_pdbx_nmr_spectrometer.manufacturer' 8 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 36 ? ? HZ2 A LYS 39 ? ? 1.40 2 1 O A SER 23 ? ? H A TRP 27 ? ? 1.49 3 1 HZ1 A LYS 12 ? ? OD1 A ASP 16 ? ? 1.55 4 1 O A ARG 77 ? ? H A GLU 81 ? ? 1.58 5 1 O A VAL 101 ? ? H A THR 105 ? ? 1.60 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ALA _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 87 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -81.00 _pdbx_validate_torsion.psi 37.02 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 8 ? ? 0.303 'SIDE CHAIN' 2 1 ARG A 26 ? ? 0.282 'SIDE CHAIN' 3 1 ARG A 77 ? ? 0.319 'SIDE CHAIN' 4 1 ARG A 84 ? ? 0.309 'SIDE CHAIN' 5 1 ARG A 99 ? ? 0.238 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 106 ? A ALA 106 2 1 Y 1 A GLU 107 ? A GLU 107 3 1 Y 1 A VAL 108 ? A VAL 108 4 1 Y 1 A ASP 109 ? A ASP 109 5 1 Y 1 A VAL 110 ? A VAL 110 6 1 Y 1 A ILE 111 ? A ILE 111 7 1 Y 1 A SER 112 ? A SER 112 8 1 Y 1 A ALA 113 ? A ALA 113 9 1 Y 1 A ALA 114 ? A ALA 114 10 1 Y 1 A ALA 115 ? A ALA 115 11 1 Y 1 A LEU 116 ? A LEU 116 12 1 Y 1 A SER 117 ? A SER 117 13 1 Y 1 A GLU 118 ? A GLU 118 14 1 Y 1 A GLN 119 ? A GLN 119 15 1 Y 1 A GLN 120 ? A GLN 120 16 1 Y 1 A LEU 121 ? A LEU 121 17 1 Y 1 A ALA 122 ? A ALA 122 18 1 Y 1 A LYS 123 ? A LYS 123 19 1 Y 1 A ILE 124 ? A ILE 124 20 1 Y 1 A SER 125 ? A SER 125 21 1 Y 1 A ALA 126 ? A ALA 126 22 1 Y 1 A ALA 127 ? A ALA 127 23 1 Y 1 A MET 128 ? A MET 128 24 1 Y 1 A GLU 129 ? A GLU 129 25 1 Y 1 A LYS 130 ? A LYS 130 26 1 Y 1 A ARG 131 ? A ARG 131 27 1 Y 1 A LEU 132 ? A LEU 132 28 1 Y 1 A SER 133 ? A SER 133 29 1 Y 1 A ARG 134 ? A ARG 134 #