data_1ACZ # _entry.id 1ACZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ACZ pdb_00001acz 10.2210/pdb1acz/pdb WWPDB D_1000170665 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-07-07 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2020-07-29 5 'Structure model' 2 1 2024-11-06 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 4 'Structure model' 'Structure summary' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' chem_comp 3 4 'Structure model' entity 4 4 'Structure model' entity_name_com 5 4 'Structure model' pdbx_branch_scheme 6 4 'Structure model' pdbx_chem_comp_identifier 7 4 'Structure model' pdbx_database_status 8 4 'Structure model' pdbx_entity_branch 9 4 'Structure model' pdbx_entity_branch_descriptor 10 4 'Structure model' pdbx_entity_branch_link 11 4 'Structure model' pdbx_entity_branch_list 12 4 'Structure model' pdbx_entity_nonpoly 13 4 'Structure model' pdbx_molecule_features 14 4 'Structure model' pdbx_nonpoly_scheme 15 4 'Structure model' pdbx_struct_assembly 16 4 'Structure model' pdbx_struct_oper_list 17 4 'Structure model' struct_asym 18 4 'Structure model' struct_conn 19 4 'Structure model' struct_site 20 4 'Structure model' struct_site_gen 21 5 'Structure model' chem_comp 22 5 'Structure model' chem_comp_atom 23 5 'Structure model' chem_comp_bond 24 5 'Structure model' database_2 25 5 'Structure model' pdbx_entry_details 26 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.auth_asym_id' 2 4 'Structure model' '_atom_site.auth_seq_id' 3 4 'Structure model' '_atom_site.label_asym_id' 4 4 'Structure model' '_atom_site.pdbx_PDB_ins_code' 5 4 'Structure model' '_chem_comp.name' 6 4 'Structure model' '_chem_comp.type' 7 4 'Structure model' '_entity.formula_weight' 8 4 'Structure model' '_entity.pdbx_description' 9 4 'Structure model' '_entity.pdbx_number_of_molecules' 10 4 'Structure model' '_entity.type' 11 4 'Structure model' '_pdbx_database_status.process_site' 12 4 'Structure model' '_struct_conn.pdbx_dist_value' 13 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 14 4 'Structure model' '_struct_conn.pdbx_ptnr1_PDB_ins_code' 15 4 'Structure model' '_struct_conn.pdbx_ptnr2_PDB_ins_code' 16 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 21 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 24 5 'Structure model' '_chem_comp.pdbx_synonyms' 25 5 'Structure model' '_database_2.pdbx_DOI' 26 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ACZ _pdbx_database_status.recvd_initial_deposition_date 1997-02-10 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sorimachi, K.' 1 'Le Gal-Coeffet, M.-F.' 2 'Williamson, G.' 3 'Archer, D.B.' 4 'Williamson, M.P.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of the granular starch binding domain of Aspergillus niger glucoamylase bound to beta-cyclodextrin.' Structure 5 647 661 1997 STRUE6 UK 0969-2126 2005 ? 9195884 '10.1016/S0969-2126(97)00220-7' 1 ;Solution Structure of the Granular Starch Binding Domain of Glucoamylase from Aspergillus Niger by Nuclear Magnetic Resonance Spectroscopy ; J.Mol.Biol. 259 970 ? 1996 JMOBAK UK 0022-2836 0070 ? ? ? 2 '1H and 15N Assignments and Secondary Structure of the Starch-Binding Domain of Glucoamylase from Aspergillus Niger' Eur.J.Biochem. 233 568 ? 1995 EJBCAI IX 0014-2956 0262 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sorimachi, K.' 1 ? primary 'Le Gal-Coeffet, M.F.' 2 ? primary 'Williamson, G.' 3 ? primary 'Archer, D.B.' 4 ? primary 'Williamson, M.P.' 5 ? 1 'Sorimachi, K.' 6 ? 1 'Jacks, A.J.' 7 ? 1 'Le Gal-Coeffet, M.F.' 8 ? 1 'Williamson, G.' 9 ? 1 'Archer, D.B.' 10 ? 1 'Williamson, M.P.' 11 ? 2 'Jacks, A.J.' 12 ? 2 'Sorimachi, K.' 13 ? 2 'Le Gal-Coeffet, M.F.' 14 ? 2 'Williamson, G.' 15 ? 2 'Archer, D.B.' 16 ? 2 'Williamson, M.P.' 17 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man GLUCOAMYLASE 11884.820 1 3.2.1.3 ? 'STARCH-BINDING DOMAIN, RESIDUES 509 - 616' ? 2 branched man 'Cycloheptakis-(1-4)-(alpha-D-glucopyranose)' 1153.001 2 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 '1,4-ALPHA-D-GLUCAN GLUCOHYDROLASE' 2 beta-cyclodextrin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;CTTPTAVAVTFDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYTSSDPLWYVTVTLPAGESFEYKFIRIESDDSV EWESDPNREYTVPQACGTSTATVTDTWR ; _entity_poly.pdbx_seq_one_letter_code_can ;CTTPTAVAVTFDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYTSSDPLWYVTVTLPAGESFEYKFIRIESDDSV EWESDPNREYTVPQACGTSTATVTDTWR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 THR n 1 3 THR n 1 4 PRO n 1 5 THR n 1 6 ALA n 1 7 VAL n 1 8 ALA n 1 9 VAL n 1 10 THR n 1 11 PHE n 1 12 ASP n 1 13 LEU n 1 14 THR n 1 15 ALA n 1 16 THR n 1 17 THR n 1 18 THR n 1 19 TYR n 1 20 GLY n 1 21 GLU n 1 22 ASN n 1 23 ILE n 1 24 TYR n 1 25 LEU n 1 26 VAL n 1 27 GLY n 1 28 SER n 1 29 ILE n 1 30 SER n 1 31 GLN n 1 32 LEU n 1 33 GLY n 1 34 ASP n 1 35 TRP n 1 36 GLU n 1 37 THR n 1 38 SER n 1 39 ASP n 1 40 GLY n 1 41 ILE n 1 42 ALA n 1 43 LEU n 1 44 SER n 1 45 ALA n 1 46 ASP n 1 47 LYS n 1 48 TYR n 1 49 THR n 1 50 SER n 1 51 SER n 1 52 ASP n 1 53 PRO n 1 54 LEU n 1 55 TRP n 1 56 TYR n 1 57 VAL n 1 58 THR n 1 59 VAL n 1 60 THR n 1 61 LEU n 1 62 PRO n 1 63 ALA n 1 64 GLY n 1 65 GLU n 1 66 SER n 1 67 PHE n 1 68 GLU n 1 69 TYR n 1 70 LYS n 1 71 PHE n 1 72 ILE n 1 73 ARG n 1 74 ILE n 1 75 GLU n 1 76 SER n 1 77 ASP n 1 78 ASP n 1 79 SER n 1 80 VAL n 1 81 GLU n 1 82 TRP n 1 83 GLU n 1 84 SER n 1 85 ASP n 1 86 PRO n 1 87 ASN n 1 88 ARG n 1 89 GLU n 1 90 TYR n 1 91 THR n 1 92 VAL n 1 93 PRO n 1 94 GLN n 1 95 ALA n 1 96 CYS n 1 97 GLY n 1 98 THR n 1 99 SER n 1 100 THR n 1 101 ALA n 1 102 THR n 1 103 VAL n 1 104 THR n 1 105 ASP n 1 106 THR n 1 107 TRP n 1 108 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Aspergillus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain AB4.1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aspergillus niger' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5061 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Aspergillus niger' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 5061 _entity_src_gen.host_org_genus Aspergillus _entity_src_gen.pdbx_host_org_gene GLAA _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PIGF _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # _pdbx_entity_branch_descriptor.ordinal 1 _pdbx_entity_branch_descriptor.entity_id 2 _pdbx_entity_branch_descriptor.descriptor 'WURCS=2.0/1,7,7/[a2122h-1a_1-5]/1-1-1-1-1-1-1/a1-g4_a4-b1_b4-c1_c4-d1_d4-e1_e4-f1_f4-g1' _pdbx_entity_branch_descriptor.type WURCS _pdbx_entity_branch_descriptor.program PDB2Glycan _pdbx_entity_branch_descriptor.program_version 1.1.0 # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 1 GLC C1 O1 7 GLC O4 HO4 sing ? 2 2 2 GLC C1 O1 1 GLC O4 HO4 sing ? 3 2 3 GLC C1 O1 2 GLC O4 HO4 sing ? 4 2 4 GLC C1 O1 3 GLC O4 HO4 sing ? 5 2 5 GLC C1 O1 4 GLC O4 HO4 sing ? 6 2 6 GLC C1 O1 5 GLC O4 HO4 sing ? 7 2 7 GLC C1 O1 6 GLC O4 HO4 sing ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose 'alpha-D-glucose; D-glucose; glucose' 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpa GLC 'COMMON NAME' GMML 1.0 a-D-glucopyranose GLC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Glcp GLC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Glc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 509 509 CYS CYS A . n A 1 2 THR 2 510 510 THR THR A . n A 1 3 THR 3 511 511 THR THR A . n A 1 4 PRO 4 512 512 PRO PRO A . n A 1 5 THR 5 513 513 THR THR A . n A 1 6 ALA 6 514 514 ALA ALA A . n A 1 7 VAL 7 515 515 VAL VAL A . n A 1 8 ALA 8 516 516 ALA ALA A . n A 1 9 VAL 9 517 517 VAL VAL A . n A 1 10 THR 10 518 518 THR THR A . n A 1 11 PHE 11 519 519 PHE PHE A . n A 1 12 ASP 12 520 520 ASP ASP A . n A 1 13 LEU 13 521 521 LEU LEU A . n A 1 14 THR 14 522 522 THR THR A . n A 1 15 ALA 15 523 523 ALA ALA A . n A 1 16 THR 16 524 524 THR THR A . n A 1 17 THR 17 525 525 THR THR A . n A 1 18 THR 18 526 526 THR THR A . n A 1 19 TYR 19 527 527 TYR TYR A . n A 1 20 GLY 20 528 528 GLY GLY A . n A 1 21 GLU 21 529 529 GLU GLU A . n A 1 22 ASN 22 530 530 ASN ASN A . n A 1 23 ILE 23 531 531 ILE ILE A . n A 1 24 TYR 24 532 532 TYR TYR A . n A 1 25 LEU 25 533 533 LEU LEU A . n A 1 26 VAL 26 534 534 VAL VAL A . n A 1 27 GLY 27 535 535 GLY GLY A . n A 1 28 SER 28 536 536 SER SER A . n A 1 29 ILE 29 537 537 ILE ILE A . n A 1 30 SER 30 538 538 SER SER A . n A 1 31 GLN 31 539 539 GLN GLN A . n A 1 32 LEU 32 540 540 LEU LEU A . n A 1 33 GLY 33 541 541 GLY GLY A . n A 1 34 ASP 34 542 542 ASP ASP A . n A 1 35 TRP 35 543 543 TRP TRP A . n A 1 36 GLU 36 544 544 GLU GLU A . n A 1 37 THR 37 545 545 THR THR A . n A 1 38 SER 38 546 546 SER SER A . n A 1 39 ASP 39 547 547 ASP ASP A . n A 1 40 GLY 40 548 548 GLY GLY A . n A 1 41 ILE 41 549 549 ILE ILE A . n A 1 42 ALA 42 550 550 ALA ALA A . n A 1 43 LEU 43 551 551 LEU LEU A . n A 1 44 SER 44 552 552 SER SER A . n A 1 45 ALA 45 553 553 ALA ALA A . n A 1 46 ASP 46 554 554 ASP ASP A . n A 1 47 LYS 47 555 555 LYS LYS A . n A 1 48 TYR 48 556 556 TYR TYR A . n A 1 49 THR 49 557 557 THR THR A . n A 1 50 SER 50 558 558 SER SER A . n A 1 51 SER 51 559 559 SER SER A . n A 1 52 ASP 52 560 560 ASP ASP A . n A 1 53 PRO 53 561 561 PRO PRO A . n A 1 54 LEU 54 562 562 LEU LEU A . n A 1 55 TRP 55 563 563 TRP TRP A . n A 1 56 TYR 56 564 564 TYR TYR A . n A 1 57 VAL 57 565 565 VAL VAL A . n A 1 58 THR 58 566 566 THR THR A . n A 1 59 VAL 59 567 567 VAL VAL A . n A 1 60 THR 60 568 568 THR THR A . n A 1 61 LEU 61 569 569 LEU LEU A . n A 1 62 PRO 62 570 570 PRO PRO A . n A 1 63 ALA 63 571 571 ALA ALA A . n A 1 64 GLY 64 572 572 GLY GLY A . n A 1 65 GLU 65 573 573 GLU GLU A . n A 1 66 SER 66 574 574 SER SER A . n A 1 67 PHE 67 575 575 PHE PHE A . n A 1 68 GLU 68 576 576 GLU GLU A . n A 1 69 TYR 69 577 577 TYR TYR A . n A 1 70 LYS 70 578 578 LYS LYS A . n A 1 71 PHE 71 579 579 PHE PHE A . n A 1 72 ILE 72 580 580 ILE ILE A . n A 1 73 ARG 73 581 581 ARG ARG A . n A 1 74 ILE 74 582 582 ILE ILE A . n A 1 75 GLU 75 583 583 GLU GLU A . n A 1 76 SER 76 584 584 SER SER A . n A 1 77 ASP 77 585 585 ASP ASP A . n A 1 78 ASP 78 586 586 ASP ASP A . n A 1 79 SER 79 587 587 SER SER A . n A 1 80 VAL 80 588 588 VAL VAL A . n A 1 81 GLU 81 589 589 GLU GLU A . n A 1 82 TRP 82 590 590 TRP TRP A . n A 1 83 GLU 83 591 591 GLU GLU A . n A 1 84 SER 84 592 592 SER SER A . n A 1 85 ASP 85 593 593 ASP ASP A . n A 1 86 PRO 86 594 594 PRO PRO A . n A 1 87 ASN 87 595 595 ASN ASN A . n A 1 88 ARG 88 596 596 ARG ARG A . n A 1 89 GLU 89 597 597 GLU GLU A . n A 1 90 TYR 90 598 598 TYR TYR A . n A 1 91 THR 91 599 599 THR THR A . n A 1 92 VAL 92 600 600 VAL VAL A . n A 1 93 PRO 93 601 601 PRO PRO A . n A 1 94 GLN 94 602 602 GLN GLN A . n A 1 95 ALA 95 603 603 ALA ALA A . n A 1 96 CYS 96 604 604 CYS CYS A . n A 1 97 GLY 97 605 605 GLY GLY A . n A 1 98 THR 98 606 606 THR THR A . n A 1 99 SER 99 607 607 SER SER A . n A 1 100 THR 100 608 608 THR THR A . n A 1 101 ALA 101 609 609 ALA ALA A . n A 1 102 THR 102 610 610 THR THR A . n A 1 103 VAL 103 611 611 VAL VAL A . n A 1 104 THR 104 612 612 THR THR A . n A 1 105 ASP 105 613 613 ASP ASP A . n A 1 106 THR 106 614 614 THR THR A . n A 1 107 TRP 107 615 615 TRP TRP A . n A 1 108 ARG 108 616 616 ARG ARG A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 GLC 1 B GLC 1 ? GLC 1 n B 2 GLC 2 B GLC 2 ? GLC 2 n B 2 GLC 3 B GLC 3 ? GLC 3 n B 2 GLC 4 B GLC 4 ? GLC 4 n B 2 GLC 5 B GLC 5 ? GLC 5 n B 2 GLC 6 B GLC 6 ? GLC 6 n B 2 GLC 7 B GLC 7 ? GLC 7 n C 2 GLC 1 C GLC 1 ? GLC 1 n C 2 GLC 2 C GLC 2 ? GLC 2 n C 2 GLC 3 C GLC 3 ? GLC 3 n C 2 GLC 4 C GLC 4 ? GLC 4 n C 2 GLC 5 C GLC 5 ? GLC 5 n C 2 GLC 6 C GLC 6 ? GLC 6 n C 2 GLC 7 C GLC 7 ? GLC 7 n # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _cell.entry_id 1ACZ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ACZ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1ACZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1ACZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1ACZ _struct.title 'GLUCOAMYLASE, GRANULAR STARCH-BINDING DOMAIN COMPLEX WITH CYCLODEXTRIN, NMR, 5 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ACZ _struct_keywords.pdbx_keywords 'POLYSACCHARIDE DEGRADATION' _struct_keywords.text 'HYDROLASE, STARCH BINDING DOMAIN, GLYCOSIDASE, POLYSACCHARIDE DEGRADATION, GLYCOPROTEIN, ALTERNATIVE SPLICING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AMYG_ASPNG _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P04064 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MSFRSLLALSGLVCTGLANVISKRATLDSWLSNEATVARTAILNNIGADGAWVSGADSGIVVASPSTDNPDYFYTWTRDS GLVLKTLVDLFRNGDTSLLSTIENYISAQAIVQGISNPSGDLSSGAGLGEPKFNVDETAYTGSWGRPQRDGPALRATAMI GFGQWLLDNGYTSTATDIVWPLVRNDLSYVAQYWNQTGYDLWEEVNGSSFFTIAVQHRALVEGSAFATAVGSSCSWCDSQ APEILCYLQSFWTGSFILANFDSSRSGKDANTLLGSIHTFDPEAACDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLS DSEAVAVGRYPEDTYYNGNPWFLCTLAAAEQLYDALYQWDKQGSLEVTDVSLDFFKALYSDAATGTYSSSSSTYSSIVDA VKTFADGFVSIVETHAASNGSMSEQYDKSDGEQLSARDLTWSYAALLTANNRRNSVVPASWGETSASSVPGTCAATSAIG TYSSVTVTSWPSIVATGGTTTTATPTGSGSVTSTSKTTATASKTSTSTSSTSCTTPTAVAVTFDLTATTTYGENIYLVGS ISQLGDWETSDGIALSADKYTSSDPLWYVTVTLPAGESFEYKFIRIESDDSVEWESDPNREYTVPQACGTSTATVTDTWR ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ACZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04064 _struct_ref_seq.db_align_beg 533 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 640 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 509 _struct_ref_seq.pdbx_auth_seq_align_end 616 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 37 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 39 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 545 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 547 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 1 SG ? ? ? 1_555 A CYS 96 SG ? ? A CYS 509 A CYS 604 1_555 ? ? ? ? ? ? ? 2.020 ? ? covale1 covale both ? B GLC . O4 ? ? ? 1_555 B GLC . C1 ? ? B GLC 1 B GLC 2 1_555 ? ? ? ? ? ? ? 1.402 ? ? covale2 covale both ? B GLC . C1 ? ? ? 1_555 B GLC . O4 ? ? B GLC 1 B GLC 7 1_555 ? ? ? ? ? ? ? 1.400 ? ? covale3 covale both ? B GLC . O4 ? ? ? 1_555 B GLC . C1 ? ? B GLC 2 B GLC 3 1_555 ? ? ? ? ? ? ? 1.398 ? ? covale4 covale both ? B GLC . O4 ? ? ? 1_555 B GLC . C1 ? ? B GLC 3 B GLC 4 1_555 ? ? ? ? ? ? ? 1.398 ? ? covale5 covale both ? B GLC . O4 ? ? ? 1_555 B GLC . C1 ? ? B GLC 4 B GLC 5 1_555 ? ? ? ? ? ? ? 1.399 ? ? covale6 covale both ? B GLC . O4 ? ? ? 1_555 B GLC . C1 ? ? B GLC 5 B GLC 6 1_555 ? ? ? ? ? ? ? 1.399 ? ? covale7 covale both ? B GLC . O4 ? ? ? 1_555 B GLC . C1 ? ? B GLC 6 B GLC 7 1_555 ? ? ? ? ? ? ? 1.398 ? ? covale8 covale both ? C GLC . O4 ? ? ? 1_555 C GLC . C1 ? ? C GLC 1 C GLC 2 1_555 ? ? ? ? ? ? ? 1.397 ? ? covale9 covale both ? C GLC . C1 ? ? ? 1_555 C GLC . O4 ? ? C GLC 1 C GLC 7 1_555 ? ? ? ? ? ? ? 1.401 ? ? covale10 covale both ? C GLC . O4 ? ? ? 1_555 C GLC . C1 ? ? C GLC 2 C GLC 3 1_555 ? ? ? ? ? ? ? 1.402 ? ? covale11 covale both ? C GLC . O4 ? ? ? 1_555 C GLC . C1 ? ? C GLC 3 C GLC 4 1_555 ? ? ? ? ? ? ? 1.398 ? ? covale12 covale both ? C GLC . O4 ? ? ? 1_555 C GLC . C1 ? ? C GLC 4 C GLC 5 1_555 ? ? ? ? ? ? ? 1.399 ? ? covale13 covale both ? C GLC . O4 ? ? ? 1_555 C GLC . C1 ? ? C GLC 5 C GLC 6 1_555 ? ? ? ? ? ? ? 1.398 ? ? covale14 covale both ? C GLC . O4 ? ? ? 1_555 C GLC . C1 ? ? C GLC 6 C GLC 7 1_555 ? ? ? ? ? ? ? 1.400 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 1 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 96 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 509 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 604 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 99 ? TRP A 107 ? SER A 607 TRP A 615 A 2 THR A 5 ? ALA A 15 ? THR A 513 ALA A 523 A 3 PRO A 53 ? ALA A 63 ? PRO A 561 ALA A 571 A 4 ILE A 41 ? SER A 44 ? ILE A 549 SER A 552 A 5 ASN A 22 ? SER A 28 ? ASN A 530 SER A 536 A 6 GLU A 65 ? ILE A 74 ? GLU A 573 ILE A 582 A 7 GLU A 81 ? GLU A 83 ? GLU A 589 GLU A 591 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 101 ? O ALA A 609 N THR A 10 ? N THR A 518 A 2 3 O VAL A 9 ? O VAL A 517 N VAL A 59 ? N VAL A 567 A 3 4 O TYR A 56 ? O TYR A 564 N SER A 44 ? N SER A 552 A 4 5 O ILE A 41 ? O ILE A 549 N LEU A 25 ? N LEU A 533 A 5 6 O VAL A 26 ? O VAL A 534 N LYS A 70 ? N LYS A 578 A 6 7 O ARG A 73 ? O ARG A 581 N GLU A 81 ? N GLU A 589 # _pdbx_entry_details.entry_id 1ACZ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG1 A THR 557 ? ? HG3 A PRO 561 ? ? 1.57 2 1 O A GLY 535 ? ? O A LEU 540 ? ? 2.14 3 3 O A GLY 535 ? ? O A LEU 540 ? ? 2.02 4 4 O A GLY 535 ? ? O A LEU 540 ? ? 1.99 5 5 O A SER 552 ? ? OH A TYR 556 ? ? 2.11 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 5 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 TYR _pdbx_validate_rmsd_angle.auth_seq_id_1 532 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 TYR _pdbx_validate_rmsd_angle.auth_seq_id_2 532 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CD2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 TYR _pdbx_validate_rmsd_angle.auth_seq_id_3 532 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.27 _pdbx_validate_rmsd_angle.angle_target_value 121.00 _pdbx_validate_rmsd_angle.angle_deviation -3.73 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.60 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 510 ? ? -143.48 18.35 2 1 LEU A 521 ? ? -162.13 119.47 3 1 ALA A 523 ? ? -149.72 12.35 4 1 THR A 524 ? ? 49.69 161.14 5 1 THR A 525 ? ? -144.32 -155.36 6 1 THR A 526 ? ? -154.76 59.76 7 1 TYR A 527 ? ? 37.64 29.56 8 1 GLU A 529 ? ? 167.24 -178.71 9 1 LEU A 540 ? ? -98.39 32.27 10 1 GLU A 544 ? ? 168.55 91.43 11 1 ASP A 547 ? ? -141.14 35.00 12 1 TYR A 556 ? ? -58.93 -131.04 13 1 THR A 557 ? ? -76.91 -153.82 14 1 SER A 559 ? ? -88.52 -75.99 15 1 ASP A 560 ? ? 169.54 74.62 16 1 TRP A 563 ? ? 42.65 81.14 17 1 VAL A 565 ? ? 174.09 159.91 18 1 THR A 566 ? ? -159.25 89.75 19 1 GLU A 573 ? ? -162.50 -158.26 20 1 ASP A 586 ? ? 52.66 74.67 21 1 SER A 587 ? ? -170.49 110.89 22 1 TRP A 590 ? ? -41.81 88.91 23 1 GLU A 591 ? ? -58.33 94.05 24 1 PRO A 594 ? ? -74.05 -165.94 25 1 VAL A 611 ? ? -160.11 66.23 26 1 ASP A 613 ? ? -163.90 -168.46 27 2 THR A 510 ? ? -135.47 -53.53 28 2 LEU A 521 ? ? -162.40 92.78 29 2 ALA A 523 ? ? -163.49 31.80 30 2 THR A 524 ? ? 53.44 164.01 31 2 GLU A 529 ? ? 172.68 159.24 32 2 ASP A 542 ? ? 63.04 -5.49 33 2 ASP A 547 ? ? -146.67 40.03 34 2 ALA A 553 ? ? -154.48 82.12 35 2 TYR A 556 ? ? -45.25 164.55 36 2 SER A 558 ? ? -80.40 -107.73 37 2 TRP A 563 ? ? 54.93 123.61 38 2 TYR A 564 ? ? -145.69 -158.83 39 2 VAL A 565 ? ? 169.66 157.83 40 2 THR A 566 ? ? -158.35 89.15 41 2 LEU A 569 ? ? -160.93 94.73 42 2 ALA A 571 ? ? -162.26 -166.06 43 2 GLU A 573 ? ? -162.85 -156.39 44 2 GLU A 583 ? ? 58.24 -5.10 45 2 ASP A 585 ? ? -125.90 -73.02 46 2 ASP A 586 ? ? -128.17 -62.47 47 2 SER A 587 ? ? -123.39 -133.89 48 2 GLU A 591 ? ? -100.27 -130.08 49 2 SER A 592 ? ? 84.60 70.09 50 2 ASN A 595 ? ? -68.45 -174.66 51 2 THR A 606 ? ? -167.90 34.67 52 2 VAL A 611 ? ? -160.71 57.16 53 3 THR A 510 ? ? -137.54 -60.25 54 3 PRO A 512 ? ? -80.87 35.03 55 3 ALA A 523 ? ? -144.41 -137.60 56 3 THR A 524 ? ? 164.58 116.25 57 3 THR A 525 ? ? -162.06 -162.67 58 3 THR A 526 ? ? -45.61 101.38 59 3 TYR A 527 ? ? -63.68 89.47 60 3 GLU A 529 ? ? -88.43 -158.72 61 3 LEU A 540 ? ? -119.00 63.97 62 3 ASP A 542 ? ? 79.41 -26.88 63 3 GLU A 544 ? ? 176.62 95.11 64 3 ASP A 547 ? ? -145.06 36.13 65 3 ASP A 554 ? ? -39.89 82.79 66 3 TYR A 556 ? ? -58.25 -165.91 67 3 THR A 557 ? ? -77.32 -112.03 68 3 SER A 558 ? ? -54.86 -110.46 69 3 ASP A 560 ? ? 176.31 81.71 70 3 TRP A 563 ? ? 43.99 149.27 71 3 VAL A 565 ? ? 169.28 159.10 72 3 THR A 566 ? ? -160.61 76.06 73 3 VAL A 567 ? ? -102.67 -160.27 74 3 LEU A 569 ? ? -160.37 81.59 75 3 ALA A 571 ? ? -162.07 -67.74 76 3 ASP A 585 ? ? -110.71 -75.14 77 3 ASP A 586 ? ? -61.12 -97.34 78 3 SER A 587 ? ? -166.20 -145.91 79 3 TRP A 590 ? ? -54.16 91.46 80 3 ASP A 593 ? ? -90.52 -68.85 81 3 TYR A 598 ? ? -65.96 91.61 82 3 PRO A 601 ? ? -79.47 -168.62 83 3 ALA A 603 ? ? 70.21 98.52 84 3 THR A 606 ? ? -105.89 -80.64 85 3 VAL A 611 ? ? -160.05 78.53 86 4 THR A 510 ? ? 69.86 94.51 87 4 THR A 511 ? ? 58.21 175.33 88 4 PRO A 512 ? ? -78.39 -83.29 89 4 THR A 513 ? ? -153.70 21.68 90 4 LEU A 521 ? ? -162.00 102.20 91 4 ALA A 523 ? ? -158.05 -139.96 92 4 THR A 525 ? ? -56.17 -158.09 93 4 TYR A 527 ? ? -35.74 -33.09 94 4 GLU A 529 ? ? 173.22 142.50 95 4 ASP A 542 ? ? 78.75 -31.35 96 4 GLU A 544 ? ? -172.92 91.39 97 4 THR A 545 ? ? -48.98 -16.46 98 4 ASP A 547 ? ? -151.14 49.59 99 4 SER A 552 ? ? -131.86 -101.50 100 4 ASP A 554 ? ? -36.49 87.85 101 4 LYS A 555 ? ? 67.59 -85.20 102 4 TYR A 556 ? ? 43.39 -125.59 103 4 THR A 557 ? ? -147.41 -128.95 104 4 SER A 558 ? ? -42.67 -99.07 105 4 ASP A 560 ? ? 74.41 95.43 106 4 TRP A 563 ? ? 31.18 101.60 107 4 VAL A 565 ? ? 178.17 153.43 108 4 THR A 566 ? ? -160.10 84.27 109 4 LEU A 569 ? ? -160.37 79.46 110 4 ALA A 571 ? ? -164.45 -37.11 111 4 GLU A 573 ? ? -161.32 -133.82 112 4 ASP A 586 ? ? 80.37 105.19 113 4 TRP A 590 ? ? -57.97 88.21 114 4 GLU A 591 ? ? -64.20 95.84 115 4 PRO A 601 ? ? -79.36 -168.93 116 4 GLN A 602 ? ? -56.53 179.63 117 4 CYS A 604 ? ? -65.03 96.12 118 4 ALA A 609 ? ? -140.24 -144.86 119 4 VAL A 611 ? ? -161.04 76.31 120 5 THR A 510 ? ? 178.80 38.54 121 5 THR A 511 ? ? 63.55 61.62 122 5 ALA A 523 ? ? -169.04 -144.75 123 5 THR A 524 ? ? 173.84 114.62 124 5 THR A 525 ? ? -131.55 -149.88 125 5 THR A 526 ? ? -114.62 52.29 126 5 TYR A 527 ? ? 37.04 36.13 127 5 GLU A 529 ? ? -63.73 -157.47 128 5 SER A 536 ? ? -82.69 47.10 129 5 ASP A 542 ? ? -49.07 -11.38 130 5 GLU A 544 ? ? 172.45 94.20 131 5 THR A 545 ? ? -48.84 -16.71 132 5 ASP A 547 ? ? -141.34 45.00 133 5 ILE A 549 ? ? -156.59 82.51 134 5 SER A 552 ? ? -129.95 -96.54 135 5 LYS A 555 ? ? 69.88 89.34 136 5 THR A 557 ? ? -164.87 -91.86 137 5 SER A 559 ? ? -152.31 -83.69 138 5 ASP A 560 ? ? -146.90 14.69 139 5 TRP A 563 ? ? 33.39 101.03 140 5 VAL A 567 ? ? -123.63 -167.31 141 5 LEU A 569 ? ? -160.66 88.92 142 5 ALA A 571 ? ? -162.63 -163.99 143 5 GLU A 573 ? ? -163.84 -139.04 144 5 ASP A 586 ? ? 57.42 84.11 145 5 SER A 587 ? ? -171.21 112.66 146 5 GLU A 589 ? ? -112.43 71.76 147 5 TRP A 590 ? ? -44.27 89.84 148 5 GLU A 591 ? ? -56.72 93.67 149 5 ASP A 593 ? ? -90.16 -65.79 150 5 ARG A 596 ? ? -160.14 -165.02 151 5 TYR A 598 ? ? 177.92 100.56 152 5 VAL A 600 ? ? 65.70 125.32 153 5 PRO A 601 ? ? -79.43 -169.06 154 5 GLN A 602 ? ? -77.89 -83.09 155 5 ALA A 603 ? ? 60.44 173.02 156 5 ALA A 609 ? ? -137.81 -156.73 157 5 VAL A 611 ? ? -160.04 71.38 158 5 ASP A 613 ? ? -162.77 -164.92 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 581 ? ? 0.184 'SIDE CHAIN' 2 1 ARG A 596 ? ? 0.200 'SIDE CHAIN' 3 1 ARG A 616 ? ? 0.283 'SIDE CHAIN' 4 2 ARG A 581 ? ? 0.163 'SIDE CHAIN' 5 2 ARG A 596 ? ? 0.247 'SIDE CHAIN' 6 2 ARG A 616 ? ? 0.318 'SIDE CHAIN' 7 3 ARG A 581 ? ? 0.122 'SIDE CHAIN' 8 3 ARG A 596 ? ? 0.091 'SIDE CHAIN' 9 3 ARG A 616 ? ? 0.261 'SIDE CHAIN' 10 4 ARG A 581 ? ? 0.138 'SIDE CHAIN' 11 4 ARG A 596 ? ? 0.300 'SIDE CHAIN' 12 4 ARG A 616 ? ? 0.262 'SIDE CHAIN' 13 5 ARG A 581 ? ? 0.317 'SIDE CHAIN' 14 5 ARG A 596 ? ? 0.284 'SIDE CHAIN' # _pdbx_molecule_features.prd_id PRD_900012 _pdbx_molecule_features.name beta-cyclodextrin _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class 'Drug delivery' _pdbx_molecule_features.details 'cyclic oligosaccharide' # loop_ _pdbx_molecule.instance_id _pdbx_molecule.prd_id _pdbx_molecule.asym_id 1 PRD_900012 B 2 PRD_900012 C # _pdbx_nmr_ensemble.entry_id 1ACZ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 5 _pdbx_nmr_ensemble.conformer_selection_criteria 'RANDOM FROM 81 GOOD STRUCTURES' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 5.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '15N-EDITED TOCSY' 1 2 1 NOESY 1 # _pdbx_nmr_refine.entry_id 1ACZ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' X-PLOR ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLC C1 C N S 88 GLC C2 C N R 89 GLC C3 C N S 90 GLC C4 C N S 91 GLC C5 C N R 92 GLC C6 C N N 93 GLC O1 O N N 94 GLC O2 O N N 95 GLC O3 O N N 96 GLC O4 O N N 97 GLC O5 O N N 98 GLC O6 O N N 99 GLC H1 H N N 100 GLC H2 H N N 101 GLC H3 H N N 102 GLC H4 H N N 103 GLC H5 H N N 104 GLC H61 H N N 105 GLC H62 H N N 106 GLC HO1 H N N 107 GLC HO2 H N N 108 GLC HO3 H N N 109 GLC HO4 H N N 110 GLC HO6 H N N 111 GLN N N N N 112 GLN CA C N S 113 GLN C C N N 114 GLN O O N N 115 GLN CB C N N 116 GLN CG C N N 117 GLN CD C N N 118 GLN OE1 O N N 119 GLN NE2 N N N 120 GLN OXT O N N 121 GLN H H N N 122 GLN H2 H N N 123 GLN HA H N N 124 GLN HB2 H N N 125 GLN HB3 H N N 126 GLN HG2 H N N 127 GLN HG3 H N N 128 GLN HE21 H N N 129 GLN HE22 H N N 130 GLN HXT H N N 131 GLU N N N N 132 GLU CA C N S 133 GLU C C N N 134 GLU O O N N 135 GLU CB C N N 136 GLU CG C N N 137 GLU CD C N N 138 GLU OE1 O N N 139 GLU OE2 O N N 140 GLU OXT O N N 141 GLU H H N N 142 GLU H2 H N N 143 GLU HA H N N 144 GLU HB2 H N N 145 GLU HB3 H N N 146 GLU HG2 H N N 147 GLU HG3 H N N 148 GLU HE2 H N N 149 GLU HXT H N N 150 GLY N N N N 151 GLY CA C N N 152 GLY C C N N 153 GLY O O N N 154 GLY OXT O N N 155 GLY H H N N 156 GLY H2 H N N 157 GLY HA2 H N N 158 GLY HA3 H N N 159 GLY HXT H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 PHE N N N N 230 PHE CA C N S 231 PHE C C N N 232 PHE O O N N 233 PHE CB C N N 234 PHE CG C Y N 235 PHE CD1 C Y N 236 PHE CD2 C Y N 237 PHE CE1 C Y N 238 PHE CE2 C Y N 239 PHE CZ C Y N 240 PHE OXT O N N 241 PHE H H N N 242 PHE H2 H N N 243 PHE HA H N N 244 PHE HB2 H N N 245 PHE HB3 H N N 246 PHE HD1 H N N 247 PHE HD2 H N N 248 PHE HE1 H N N 249 PHE HE2 H N N 250 PHE HZ H N N 251 PHE HXT H N N 252 PRO N N N N 253 PRO CA C N S 254 PRO C C N N 255 PRO O O N N 256 PRO CB C N N 257 PRO CG C N N 258 PRO CD C N N 259 PRO OXT O N N 260 PRO H H N N 261 PRO HA H N N 262 PRO HB2 H N N 263 PRO HB3 H N N 264 PRO HG2 H N N 265 PRO HG3 H N N 266 PRO HD2 H N N 267 PRO HD3 H N N 268 PRO HXT H N N 269 SER N N N N 270 SER CA C N S 271 SER C C N N 272 SER O O N N 273 SER CB C N N 274 SER OG O N N 275 SER OXT O N N 276 SER H H N N 277 SER H2 H N N 278 SER HA H N N 279 SER HB2 H N N 280 SER HB3 H N N 281 SER HG H N N 282 SER HXT H N N 283 THR N N N N 284 THR CA C N S 285 THR C C N N 286 THR O O N N 287 THR CB C N R 288 THR OG1 O N N 289 THR CG2 C N N 290 THR OXT O N N 291 THR H H N N 292 THR H2 H N N 293 THR HA H N N 294 THR HB H N N 295 THR HG1 H N N 296 THR HG21 H N N 297 THR HG22 H N N 298 THR HG23 H N N 299 THR HXT H N N 300 TRP N N N N 301 TRP CA C N S 302 TRP C C N N 303 TRP O O N N 304 TRP CB C N N 305 TRP CG C Y N 306 TRP CD1 C Y N 307 TRP CD2 C Y N 308 TRP NE1 N Y N 309 TRP CE2 C Y N 310 TRP CE3 C Y N 311 TRP CZ2 C Y N 312 TRP CZ3 C Y N 313 TRP CH2 C Y N 314 TRP OXT O N N 315 TRP H H N N 316 TRP H2 H N N 317 TRP HA H N N 318 TRP HB2 H N N 319 TRP HB3 H N N 320 TRP HD1 H N N 321 TRP HE1 H N N 322 TRP HE3 H N N 323 TRP HZ2 H N N 324 TRP HZ3 H N N 325 TRP HH2 H N N 326 TRP HXT H N N 327 TYR N N N N 328 TYR CA C N S 329 TYR C C N N 330 TYR O O N N 331 TYR CB C N N 332 TYR CG C Y N 333 TYR CD1 C Y N 334 TYR CD2 C Y N 335 TYR CE1 C Y N 336 TYR CE2 C Y N 337 TYR CZ C Y N 338 TYR OH O N N 339 TYR OXT O N N 340 TYR H H N N 341 TYR H2 H N N 342 TYR HA H N N 343 TYR HB2 H N N 344 TYR HB3 H N N 345 TYR HD1 H N N 346 TYR HD2 H N N 347 TYR HE1 H N N 348 TYR HE2 H N N 349 TYR HH H N N 350 TYR HXT H N N 351 VAL N N N N 352 VAL CA C N S 353 VAL C C N N 354 VAL O O N N 355 VAL CB C N N 356 VAL CG1 C N N 357 VAL CG2 C N N 358 VAL OXT O N N 359 VAL H H N N 360 VAL H2 H N N 361 VAL HA H N N 362 VAL HB H N N 363 VAL HG11 H N N 364 VAL HG12 H N N 365 VAL HG13 H N N 366 VAL HG21 H N N 367 VAL HG22 H N N 368 VAL HG23 H N N 369 VAL HXT H N N 370 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLC C1 C2 sing N N 83 GLC C1 O1 sing N N 84 GLC C1 O5 sing N N 85 GLC C1 H1 sing N N 86 GLC C2 C3 sing N N 87 GLC C2 O2 sing N N 88 GLC C2 H2 sing N N 89 GLC C3 C4 sing N N 90 GLC C3 O3 sing N N 91 GLC C3 H3 sing N N 92 GLC C4 C5 sing N N 93 GLC C4 O4 sing N N 94 GLC C4 H4 sing N N 95 GLC C5 C6 sing N N 96 GLC C5 O5 sing N N 97 GLC C5 H5 sing N N 98 GLC C6 O6 sing N N 99 GLC C6 H61 sing N N 100 GLC C6 H62 sing N N 101 GLC O1 HO1 sing N N 102 GLC O2 HO2 sing N N 103 GLC O3 HO3 sing N N 104 GLC O4 HO4 sing N N 105 GLC O6 HO6 sing N N 106 GLN N CA sing N N 107 GLN N H sing N N 108 GLN N H2 sing N N 109 GLN CA C sing N N 110 GLN CA CB sing N N 111 GLN CA HA sing N N 112 GLN C O doub N N 113 GLN C OXT sing N N 114 GLN CB CG sing N N 115 GLN CB HB2 sing N N 116 GLN CB HB3 sing N N 117 GLN CG CD sing N N 118 GLN CG HG2 sing N N 119 GLN CG HG3 sing N N 120 GLN CD OE1 doub N N 121 GLN CD NE2 sing N N 122 GLN NE2 HE21 sing N N 123 GLN NE2 HE22 sing N N 124 GLN OXT HXT sing N N 125 GLU N CA sing N N 126 GLU N H sing N N 127 GLU N H2 sing N N 128 GLU CA C sing N N 129 GLU CA CB sing N N 130 GLU CA HA sing N N 131 GLU C O doub N N 132 GLU C OXT sing N N 133 GLU CB CG sing N N 134 GLU CB HB2 sing N N 135 GLU CB HB3 sing N N 136 GLU CG CD sing N N 137 GLU CG HG2 sing N N 138 GLU CG HG3 sing N N 139 GLU CD OE1 doub N N 140 GLU CD OE2 sing N N 141 GLU OE2 HE2 sing N N 142 GLU OXT HXT sing N N 143 GLY N CA sing N N 144 GLY N H sing N N 145 GLY N H2 sing N N 146 GLY CA C sing N N 147 GLY CA HA2 sing N N 148 GLY CA HA3 sing N N 149 GLY C O doub N N 150 GLY C OXT sing N N 151 GLY OXT HXT sing N N 152 ILE N CA sing N N 153 ILE N H sing N N 154 ILE N H2 sing N N 155 ILE CA C sing N N 156 ILE CA CB sing N N 157 ILE CA HA sing N N 158 ILE C O doub N N 159 ILE C OXT sing N N 160 ILE CB CG1 sing N N 161 ILE CB CG2 sing N N 162 ILE CB HB sing N N 163 ILE CG1 CD1 sing N N 164 ILE CG1 HG12 sing N N 165 ILE CG1 HG13 sing N N 166 ILE CG2 HG21 sing N N 167 ILE CG2 HG22 sing N N 168 ILE CG2 HG23 sing N N 169 ILE CD1 HD11 sing N N 170 ILE CD1 HD12 sing N N 171 ILE CD1 HD13 sing N N 172 ILE OXT HXT sing N N 173 LEU N CA sing N N 174 LEU N H sing N N 175 LEU N H2 sing N N 176 LEU CA C sing N N 177 LEU CA CB sing N N 178 LEU CA HA sing N N 179 LEU C O doub N N 180 LEU C OXT sing N N 181 LEU CB CG sing N N 182 LEU CB HB2 sing N N 183 LEU CB HB3 sing N N 184 LEU CG CD1 sing N N 185 LEU CG CD2 sing N N 186 LEU CG HG sing N N 187 LEU CD1 HD11 sing N N 188 LEU CD1 HD12 sing N N 189 LEU CD1 HD13 sing N N 190 LEU CD2 HD21 sing N N 191 LEU CD2 HD22 sing N N 192 LEU CD2 HD23 sing N N 193 LEU OXT HXT sing N N 194 LYS N CA sing N N 195 LYS N H sing N N 196 LYS N H2 sing N N 197 LYS CA C sing N N 198 LYS CA CB sing N N 199 LYS CA HA sing N N 200 LYS C O doub N N 201 LYS C OXT sing N N 202 LYS CB CG sing N N 203 LYS CB HB2 sing N N 204 LYS CB HB3 sing N N 205 LYS CG CD sing N N 206 LYS CG HG2 sing N N 207 LYS CG HG3 sing N N 208 LYS CD CE sing N N 209 LYS CD HD2 sing N N 210 LYS CD HD3 sing N N 211 LYS CE NZ sing N N 212 LYS CE HE2 sing N N 213 LYS CE HE3 sing N N 214 LYS NZ HZ1 sing N N 215 LYS NZ HZ2 sing N N 216 LYS NZ HZ3 sing N N 217 LYS OXT HXT sing N N 218 PHE N CA sing N N 219 PHE N H sing N N 220 PHE N H2 sing N N 221 PHE CA C sing N N 222 PHE CA CB sing N N 223 PHE CA HA sing N N 224 PHE C O doub N N 225 PHE C OXT sing N N 226 PHE CB CG sing N N 227 PHE CB HB2 sing N N 228 PHE CB HB3 sing N N 229 PHE CG CD1 doub Y N 230 PHE CG CD2 sing Y N 231 PHE CD1 CE1 sing Y N 232 PHE CD1 HD1 sing N N 233 PHE CD2 CE2 doub Y N 234 PHE CD2 HD2 sing N N 235 PHE CE1 CZ doub Y N 236 PHE CE1 HE1 sing N N 237 PHE CE2 CZ sing Y N 238 PHE CE2 HE2 sing N N 239 PHE CZ HZ sing N N 240 PHE OXT HXT sing N N 241 PRO N CA sing N N 242 PRO N CD sing N N 243 PRO N H sing N N 244 PRO CA C sing N N 245 PRO CA CB sing N N 246 PRO CA HA sing N N 247 PRO C O doub N N 248 PRO C OXT sing N N 249 PRO CB CG sing N N 250 PRO CB HB2 sing N N 251 PRO CB HB3 sing N N 252 PRO CG CD sing N N 253 PRO CG HG2 sing N N 254 PRO CG HG3 sing N N 255 PRO CD HD2 sing N N 256 PRO CD HD3 sing N N 257 PRO OXT HXT sing N N 258 SER N CA sing N N 259 SER N H sing N N 260 SER N H2 sing N N 261 SER CA C sing N N 262 SER CA CB sing N N 263 SER CA HA sing N N 264 SER C O doub N N 265 SER C OXT sing N N 266 SER CB OG sing N N 267 SER CB HB2 sing N N 268 SER CB HB3 sing N N 269 SER OG HG sing N N 270 SER OXT HXT sing N N 271 THR N CA sing N N 272 THR N H sing N N 273 THR N H2 sing N N 274 THR CA C sing N N 275 THR CA CB sing N N 276 THR CA HA sing N N 277 THR C O doub N N 278 THR C OXT sing N N 279 THR CB OG1 sing N N 280 THR CB CG2 sing N N 281 THR CB HB sing N N 282 THR OG1 HG1 sing N N 283 THR CG2 HG21 sing N N 284 THR CG2 HG22 sing N N 285 THR CG2 HG23 sing N N 286 THR OXT HXT sing N N 287 TRP N CA sing N N 288 TRP N H sing N N 289 TRP N H2 sing N N 290 TRP CA C sing N N 291 TRP CA CB sing N N 292 TRP CA HA sing N N 293 TRP C O doub N N 294 TRP C OXT sing N N 295 TRP CB CG sing N N 296 TRP CB HB2 sing N N 297 TRP CB HB3 sing N N 298 TRP CG CD1 doub Y N 299 TRP CG CD2 sing Y N 300 TRP CD1 NE1 sing Y N 301 TRP CD1 HD1 sing N N 302 TRP CD2 CE2 doub Y N 303 TRP CD2 CE3 sing Y N 304 TRP NE1 CE2 sing Y N 305 TRP NE1 HE1 sing N N 306 TRP CE2 CZ2 sing Y N 307 TRP CE3 CZ3 doub Y N 308 TRP CE3 HE3 sing N N 309 TRP CZ2 CH2 doub Y N 310 TRP CZ2 HZ2 sing N N 311 TRP CZ3 CH2 sing Y N 312 TRP CZ3 HZ3 sing N N 313 TRP CH2 HH2 sing N N 314 TRP OXT HXT sing N N 315 TYR N CA sing N N 316 TYR N H sing N N 317 TYR N H2 sing N N 318 TYR CA C sing N N 319 TYR CA CB sing N N 320 TYR CA HA sing N N 321 TYR C O doub N N 322 TYR C OXT sing N N 323 TYR CB CG sing N N 324 TYR CB HB2 sing N N 325 TYR CB HB3 sing N N 326 TYR CG CD1 doub Y N 327 TYR CG CD2 sing Y N 328 TYR CD1 CE1 sing Y N 329 TYR CD1 HD1 sing N N 330 TYR CD2 CE2 doub Y N 331 TYR CD2 HD2 sing N N 332 TYR CE1 CZ doub Y N 333 TYR CE1 HE1 sing N N 334 TYR CE2 CZ sing Y N 335 TYR CE2 HE2 sing N N 336 TYR CZ OH sing N N 337 TYR OH HH sing N N 338 TYR OXT HXT sing N N 339 VAL N CA sing N N 340 VAL N H sing N N 341 VAL N H2 sing N N 342 VAL CA C sing N N 343 VAL CA CB sing N N 344 VAL CA HA sing N N 345 VAL C O doub N N 346 VAL C OXT sing N N 347 VAL CB CG1 sing N N 348 VAL CB CG2 sing N N 349 VAL CB HB sing N N 350 VAL CG1 HG11 sing N N 351 VAL CG1 HG12 sing N N 352 VAL CG1 HG13 sing N N 353 VAL CG2 HG21 sing N N 354 VAL CG2 HG22 sing N N 355 VAL CG2 HG23 sing N N 356 VAL OXT HXT sing N N 357 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 GLC 1 n 2 GLC 2 n 2 GLC 3 n 2 GLC 4 n 2 GLC 5 n 2 GLC 6 n 2 GLC 7 n # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AMX 500' _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 # _atom_sites.entry_id 1ACZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #