data_1AD7 # _entry.id 1AD7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.393 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1AD7 pdb_00001ad7 10.2210/pdb1ad7/pdb WWPDB D_1000170673 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-08-20 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2015-10-21 5 'Structure model' 1 4 2024-06-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Source and taxonomy' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' chem_comp_atom 2 5 'Structure model' chem_comp_bond 3 5 'Structure model' database_2 4 5 'Structure model' pdbx_database_status 5 5 'Structure model' pdbx_nmr_software 6 5 'Structure model' struct_conn 7 5 'Structure model' struct_ref_seq_dif 8 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_database_status.process_site' 4 5 'Structure model' '_pdbx_nmr_software.name' 5 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 5 'Structure model' '_struct_ref_seq_dif.details' 17 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1AD7 _pdbx_database_status.recvd_initial_deposition_date 1997-02-21 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rigby, A.C.' 1 'Baleja, J.D.' 2 'Furie, B.C.' 3 'Furie, B.' 4 # _citation.id primary _citation.title ;Three-dimensional structure of a gamma-carboxyglutamic acid-containing conotoxin, conantokin G, from the marine snail Conus geographus: the metal-free conformer. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 36 _citation.page_first 6906 _citation.page_last 6914 _citation.year 1997 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9188685 _citation.pdbx_database_id_DOI 10.1021/bi970321w # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rigby, A.C.' 1 ? primary 'Baleja, J.D.' 2 ? primary 'Furie, B.C.' 3 ? primary 'Furie, B.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'CONANTOXIN G' _entity.formula_weight 2265.196 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'GE(CGU)(CGU)LQ(CGU)NQ(CGU)LIR(CGU)KSN(NH2)' _entity_poly.pdbx_seq_one_letter_code_can GEEELQENQELIREKSNX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLU n 1 3 CGU n 1 4 CGU n 1 5 LEU n 1 6 GLN n 1 7 CGU n 1 8 ASN n 1 9 GLN n 1 10 CGU n 1 11 LEU n 1 12 ILE n 1 13 ARG n 1 14 CGU n 1 15 LYS n 1 16 SER n 1 17 ASN n 1 18 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Conus geographus' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 6491 _pdbx_entity_src_syn.details 'C-TERMINAL AMIDE, SYNTHETIC PEPTIDE' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CGU 'L-peptide linking' n 'GAMMA-CARBOXY-GLUTAMIC ACID' ? 'C6 H9 N O6' 191.139 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 CGU 3 3 3 CGU CGU A . n A 1 4 CGU 4 4 4 CGU CGU A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 CGU 7 7 7 CGU CGU A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 CGU 10 10 10 CGU CGU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 CGU 14 14 14 CGU CGU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 NH2 18 18 18 NH2 NH2 A . n # _cell.entry_id 1AD7 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1AD7 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1AD7 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1AD7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1AD7 _struct.title 'NMR STRUCTURE OF METAL-FREE CONANTOKIN G, 1 STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1AD7 _struct_keywords.pdbx_keywords 'GAMMA-CARBOXYGLUTAMIC ACID' _struct_keywords.text 'GAMMA-CARBOXYGLUTAMIC ACID, CONANTOKIN G, CONOTOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CXKG_CONGE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P07231 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MHLYTYLYLLVPLVTFHLILGTGTLDDGGALTERRSADATALKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRGNKAR GEEELQENQELIREKSNGKR ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1AD7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 17 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07231 _struct_ref_seq.db_align_beg 81 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 97 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 17 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1AD7 CGU A 3 ? UNP P07231 GLU 83 'modified residue' 3 1 1 1AD7 CGU A 4 ? UNP P07231 GLU 84 'modified residue' 4 2 1 1AD7 CGU A 7 ? UNP P07231 GLU 87 'modified residue' 7 3 1 1AD7 CGU A 10 ? UNP P07231 GLU 90 'modified residue' 10 4 1 1AD7 CGU A 14 ? UNP P07231 GLU 94 'modified residue' 14 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CGU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 10 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CGU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 14 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CGU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 10 _struct_conf.end_auth_comp_id CGU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 14 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLU 2 C ? ? ? 1_555 A CGU 3 N ? ? A GLU 2 A CGU 3 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? A CGU 3 C ? ? ? 1_555 A CGU 4 N ? ? A CGU 3 A CGU 4 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale3 covale both ? A CGU 4 C ? ? ? 1_555 A LEU 5 N ? ? A CGU 4 A LEU 5 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale4 covale both ? A GLN 6 C ? ? ? 1_555 A CGU 7 N ? ? A GLN 6 A CGU 7 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale5 covale both ? A CGU 7 C ? ? ? 1_555 A ASN 8 N ? ? A CGU 7 A ASN 8 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale6 covale both ? A GLN 9 C ? ? ? 1_555 A CGU 10 N ? ? A GLN 9 A CGU 10 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale7 covale both ? A CGU 10 C ? ? ? 1_555 A LEU 11 N ? ? A CGU 10 A LEU 11 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale8 covale both ? A ARG 13 C ? ? ? 1_555 A CGU 14 N ? ? A ARG 13 A CGU 14 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale9 covale both ? A CGU 14 C ? ? ? 1_555 A LYS 15 N ? ? A CGU 14 A LYS 15 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale10 covale both ? A ASN 17 C ? ? ? 1_555 A NH2 18 N ? ? A ASN 17 A NH2 18 1_555 ? ? ? ? ? ? ? 1.326 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NH2 _struct_site.pdbx_auth_seq_id 18 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 1 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 18' # _struct_site_gen.id 1 _struct_site_gen.site_id AC1 _struct_site_gen.pdbx_num_res 1 _struct_site_gen.label_comp_id ASN _struct_site_gen.label_asym_id A _struct_site_gen.label_seq_id 17 _struct_site_gen.pdbx_auth_ins_code ? _struct_site_gen.auth_comp_id ASN _struct_site_gen.auth_asym_id A _struct_site_gen.auth_seq_id 17 _struct_site_gen.label_atom_id . _struct_site_gen.label_alt_id ? _struct_site_gen.symmetry 1_555 _struct_site_gen.details ? # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 2 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OE2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.362 _pdbx_validate_rmsd_bond.bond_target_value 1.252 _pdbx_validate_rmsd_bond.bond_deviation 0.110 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 13 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 13 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 13 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 124.32 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation 4.02 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 2 ? ? -158.19 27.78 2 1 CGU A 3 ? ? -107.16 41.21 3 1 LEU A 5 ? ? -157.25 77.27 4 1 ASN A 8 ? ? -100.50 67.87 5 1 ILE A 12 ? ? -93.64 43.29 6 1 LYS A 15 ? ? -113.42 54.93 7 1 SER A 16 ? ? -135.34 -42.33 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CGU 3 A CGU 3 ? GLU 'GAMMA-CARBOXY-GLUTAMIC ACID' 2 A CGU 4 A CGU 4 ? GLU 'GAMMA-CARBOXY-GLUTAMIC ACID' 3 A CGU 7 A CGU 7 ? GLU 'GAMMA-CARBOXY-GLUTAMIC ACID' 4 A CGU 10 A CGU 10 ? GLU 'GAMMA-CARBOXY-GLUTAMIC ACID' 5 A CGU 14 A CGU 14 ? GLU 'GAMMA-CARBOXY-GLUTAMIC ACID' # _pdbx_nmr_ensemble.entry_id 1AD7 _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 5.60 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 TOCSY 1 2 1 NOESY 1 # _pdbx_nmr_refine.entry_id 1AD7 _pdbx_nmr_refine.method DG _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DGII ? HAVEL 1 'structure solution' 'Insight II' ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 CGU N N N N 45 CGU CA C N S 46 CGU C C N N 47 CGU O O N N 48 CGU OXT O N N 49 CGU CB C N N 50 CGU CG C N N 51 CGU CD1 C N N 52 CGU CD2 C N N 53 CGU OE11 O N N 54 CGU OE12 O N N 55 CGU OE21 O N N 56 CGU OE22 O N N 57 CGU H H N N 58 CGU H2 H N N 59 CGU HA H N N 60 CGU HXT H N N 61 CGU HB2 H N N 62 CGU HB3 H N N 63 CGU HG H N N 64 CGU HE12 H N N 65 CGU HE22 H N N 66 GLN N N N N 67 GLN CA C N S 68 GLN C C N N 69 GLN O O N N 70 GLN CB C N N 71 GLN CG C N N 72 GLN CD C N N 73 GLN OE1 O N N 74 GLN NE2 N N N 75 GLN OXT O N N 76 GLN H H N N 77 GLN H2 H N N 78 GLN HA H N N 79 GLN HB2 H N N 80 GLN HB3 H N N 81 GLN HG2 H N N 82 GLN HG3 H N N 83 GLN HE21 H N N 84 GLN HE22 H N N 85 GLN HXT H N N 86 GLU N N N N 87 GLU CA C N S 88 GLU C C N N 89 GLU O O N N 90 GLU CB C N N 91 GLU CG C N N 92 GLU CD C N N 93 GLU OE1 O N N 94 GLU OE2 O N N 95 GLU OXT O N N 96 GLU H H N N 97 GLU H2 H N N 98 GLU HA H N N 99 GLU HB2 H N N 100 GLU HB3 H N N 101 GLU HG2 H N N 102 GLU HG3 H N N 103 GLU HE2 H N N 104 GLU HXT H N N 105 GLY N N N N 106 GLY CA C N N 107 GLY C C N N 108 GLY O O N N 109 GLY OXT O N N 110 GLY H H N N 111 GLY H2 H N N 112 GLY HA2 H N N 113 GLY HA3 H N N 114 GLY HXT H N N 115 ILE N N N N 116 ILE CA C N S 117 ILE C C N N 118 ILE O O N N 119 ILE CB C N S 120 ILE CG1 C N N 121 ILE CG2 C N N 122 ILE CD1 C N N 123 ILE OXT O N N 124 ILE H H N N 125 ILE H2 H N N 126 ILE HA H N N 127 ILE HB H N N 128 ILE HG12 H N N 129 ILE HG13 H N N 130 ILE HG21 H N N 131 ILE HG22 H N N 132 ILE HG23 H N N 133 ILE HD11 H N N 134 ILE HD12 H N N 135 ILE HD13 H N N 136 ILE HXT H N N 137 LEU N N N N 138 LEU CA C N S 139 LEU C C N N 140 LEU O O N N 141 LEU CB C N N 142 LEU CG C N N 143 LEU CD1 C N N 144 LEU CD2 C N N 145 LEU OXT O N N 146 LEU H H N N 147 LEU H2 H N N 148 LEU HA H N N 149 LEU HB2 H N N 150 LEU HB3 H N N 151 LEU HG H N N 152 LEU HD11 H N N 153 LEU HD12 H N N 154 LEU HD13 H N N 155 LEU HD21 H N N 156 LEU HD22 H N N 157 LEU HD23 H N N 158 LEU HXT H N N 159 LYS N N N N 160 LYS CA C N S 161 LYS C C N N 162 LYS O O N N 163 LYS CB C N N 164 LYS CG C N N 165 LYS CD C N N 166 LYS CE C N N 167 LYS NZ N N N 168 LYS OXT O N N 169 LYS H H N N 170 LYS H2 H N N 171 LYS HA H N N 172 LYS HB2 H N N 173 LYS HB3 H N N 174 LYS HG2 H N N 175 LYS HG3 H N N 176 LYS HD2 H N N 177 LYS HD3 H N N 178 LYS HE2 H N N 179 LYS HE3 H N N 180 LYS HZ1 H N N 181 LYS HZ2 H N N 182 LYS HZ3 H N N 183 LYS HXT H N N 184 NH2 N N N N 185 NH2 HN1 H N N 186 NH2 HN2 H N N 187 SER N N N N 188 SER CA C N S 189 SER C C N N 190 SER O O N N 191 SER CB C N N 192 SER OG O N N 193 SER OXT O N N 194 SER H H N N 195 SER H2 H N N 196 SER HA H N N 197 SER HB2 H N N 198 SER HB3 H N N 199 SER HG H N N 200 SER HXT H N N 201 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 CGU N CA sing N N 43 CGU N H sing N N 44 CGU N H2 sing N N 45 CGU CA C sing N N 46 CGU CA CB sing N N 47 CGU CA HA sing N N 48 CGU C O doub N N 49 CGU C OXT sing N N 50 CGU OXT HXT sing N N 51 CGU CB CG sing N N 52 CGU CB HB2 sing N N 53 CGU CB HB3 sing N N 54 CGU CG CD1 sing N N 55 CGU CG CD2 sing N N 56 CGU CG HG sing N N 57 CGU CD1 OE11 doub N N 58 CGU CD1 OE12 sing N N 59 CGU CD2 OE21 doub N N 60 CGU CD2 OE22 sing N N 61 CGU OE12 HE12 sing N N 62 CGU OE22 HE22 sing N N 63 GLN N CA sing N N 64 GLN N H sing N N 65 GLN N H2 sing N N 66 GLN CA C sing N N 67 GLN CA CB sing N N 68 GLN CA HA sing N N 69 GLN C O doub N N 70 GLN C OXT sing N N 71 GLN CB CG sing N N 72 GLN CB HB2 sing N N 73 GLN CB HB3 sing N N 74 GLN CG CD sing N N 75 GLN CG HG2 sing N N 76 GLN CG HG3 sing N N 77 GLN CD OE1 doub N N 78 GLN CD NE2 sing N N 79 GLN NE2 HE21 sing N N 80 GLN NE2 HE22 sing N N 81 GLN OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 ILE N CA sing N N 110 ILE N H sing N N 111 ILE N H2 sing N N 112 ILE CA C sing N N 113 ILE CA CB sing N N 114 ILE CA HA sing N N 115 ILE C O doub N N 116 ILE C OXT sing N N 117 ILE CB CG1 sing N N 118 ILE CB CG2 sing N N 119 ILE CB HB sing N N 120 ILE CG1 CD1 sing N N 121 ILE CG1 HG12 sing N N 122 ILE CG1 HG13 sing N N 123 ILE CG2 HG21 sing N N 124 ILE CG2 HG22 sing N N 125 ILE CG2 HG23 sing N N 126 ILE CD1 HD11 sing N N 127 ILE CD1 HD12 sing N N 128 ILE CD1 HD13 sing N N 129 ILE OXT HXT sing N N 130 LEU N CA sing N N 131 LEU N H sing N N 132 LEU N H2 sing N N 133 LEU CA C sing N N 134 LEU CA CB sing N N 135 LEU CA HA sing N N 136 LEU C O doub N N 137 LEU C OXT sing N N 138 LEU CB CG sing N N 139 LEU CB HB2 sing N N 140 LEU CB HB3 sing N N 141 LEU CG CD1 sing N N 142 LEU CG CD2 sing N N 143 LEU CG HG sing N N 144 LEU CD1 HD11 sing N N 145 LEU CD1 HD12 sing N N 146 LEU CD1 HD13 sing N N 147 LEU CD2 HD21 sing N N 148 LEU CD2 HD22 sing N N 149 LEU CD2 HD23 sing N N 150 LEU OXT HXT sing N N 151 LYS N CA sing N N 152 LYS N H sing N N 153 LYS N H2 sing N N 154 LYS CA C sing N N 155 LYS CA CB sing N N 156 LYS CA HA sing N N 157 LYS C O doub N N 158 LYS C OXT sing N N 159 LYS CB CG sing N N 160 LYS CB HB2 sing N N 161 LYS CB HB3 sing N N 162 LYS CG CD sing N N 163 LYS CG HG2 sing N N 164 LYS CG HG3 sing N N 165 LYS CD CE sing N N 166 LYS CD HD2 sing N N 167 LYS CD HD3 sing N N 168 LYS CE NZ sing N N 169 LYS CE HE2 sing N N 170 LYS CE HE3 sing N N 171 LYS NZ HZ1 sing N N 172 LYS NZ HZ2 sing N N 173 LYS NZ HZ3 sing N N 174 LYS OXT HXT sing N N 175 NH2 N HN1 sing N N 176 NH2 N HN2 sing N N 177 SER N CA sing N N 178 SER N H sing N N 179 SER N H2 sing N N 180 SER CA C sing N N 181 SER CA CB sing N N 182 SER CA HA sing N N 183 SER C O doub N N 184 SER C OXT sing N N 185 SER CB OG sing N N 186 SER CB HB2 sing N N 187 SER CB HB3 sing N N 188 SER OG HG sing N N 189 SER OXT HXT sing N N 190 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 1AD7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_