data_1AIW # _entry.id 1AIW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1AIW pdb_00001aiw 10.2210/pdb1aiw/pdb WWPDB D_1000170871 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-05-06 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2024-06-05 5 'Structure model' 1 4 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_database_status 5 4 'Structure model' pdbx_nmr_software 6 5 'Structure model' pdbx_entry_details 7 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1AIW _pdbx_database_status.recvd_initial_deposition_date 1997-04-30 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Brun, E.' 1 'Moriaud, F.' 2 'Gans, P.' 3 'Blackledge, M.J.' 4 'Barras, F.' 5 'Marion, D.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of the cellulose-binding domain of the endoglucanase Z secreted by Erwinia chrysanthemi.' Biochemistry 36 16074 16086 1997 BICHAW US 0006-2960 0033 ? 9405041 10.1021/bi9718494 1 ;Overproduction, Purification and Characterization of the Cellulose-Binding Domain of the Erwinia Chrysanthemi Secreted Endoglucanase Egz ; Eur.J.Biochem. 231 142 ? 1995 EJBCAI IX 0014-2956 0262 ? ? ? 2 'Periplasmic Disulphide Bond Formation is Essential for Cellulase Secretion by the Plant Pathogen Erwinia Chrysanthemi' Mol.Microbiol. 11 545 ? 1994 MOMIEE UK 0950-382X 2007 ? ? ? 3 'Cellulase Egz of Erwinia Chrysanthemi: Structural Organization and Importance of His98 and Glu133 Residues for Catalysis' 'Protein Eng.' 4 325 ? 1991 PRENE9 UK 0269-2139 0859 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Brun, E.' 1 ? primary 'Moriaud, F.' 2 ? primary 'Gans, P.' 3 ? primary 'Blackledge, M.J.' 4 ? primary 'Barras, F.' 5 ? primary 'Marion, D.' 6 ? 1 'Brun, E.' 7 ? 1 'Gans, P.' 8 ? 1 'Marion, D.' 9 ? 1 'Barras, F.' 10 ? 2 'Bortoli-German, I.' 11 ? 2 'Brun, E.' 12 ? 2 'Py, B.' 13 ? 2 'Chippaux, M.' 14 ? 2 'Barras, F.' 15 ? 3 'Py, B.' 16 ? 3 'Bortoli-German, I.' 17 ? 3 'Haiech, J.' 18 ? 3 'Chippaux, M.' 19 ? 3 'Barras, F.' 20 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ENDOGLUCANASE Z' _entity.formula_weight 6660.123 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.2.1.4 _entity.pdbx_mutation 'T1M, A2G' _entity.pdbx_fragment 'C-TERMINAL CELLULOSE-BINDING DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name CBDEGZ # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGDCANANVYPNWVSKDWAGGQPTHNEAGQSIVYKGNLYTANWYTASVPGSDSSWTQVGSCN _entity_poly.pdbx_seq_one_letter_code_can MGDCANANVYPNWVSKDWAGGQPTHNEAGQSIVYKGNLYTANWYTASVPGSDSSWTQVGSCN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ASP n 1 4 CYS n 1 5 ALA n 1 6 ASN n 1 7 ALA n 1 8 ASN n 1 9 VAL n 1 10 TYR n 1 11 PRO n 1 12 ASN n 1 13 TRP n 1 14 VAL n 1 15 SER n 1 16 LYS n 1 17 ASP n 1 18 TRP n 1 19 ALA n 1 20 GLY n 1 21 GLY n 1 22 GLN n 1 23 PRO n 1 24 THR n 1 25 HIS n 1 26 ASN n 1 27 GLU n 1 28 ALA n 1 29 GLY n 1 30 GLN n 1 31 SER n 1 32 ILE n 1 33 VAL n 1 34 TYR n 1 35 LYS n 1 36 GLY n 1 37 ASN n 1 38 LEU n 1 39 TYR n 1 40 THR n 1 41 ALA n 1 42 ASN n 1 43 TRP n 1 44 TYR n 1 45 THR n 1 46 ALA n 1 47 SER n 1 48 VAL n 1 49 PRO n 1 50 GLY n 1 51 SER n 1 52 ASP n 1 53 SER n 1 54 SER n 1 55 TRP n 1 56 THR n 1 57 GLN n 1 58 VAL n 1 59 GLY n 1 60 SER n 1 61 CYS n 1 62 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Dickeya _entity_src_gen.pdbx_gene_src_gene CELZ _entity_src_gen.gene_src_species 'Erwinia chrysanthemi' _entity_src_gen.gene_src_strain 3937 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Erwinia chrysanthemi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 198628 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location SECRETED _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene PMIA2 _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location EXTRACELLULAR _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector M/A _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET22 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 TRP 18 18 18 TRP TRP A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 TRP 55 55 55 TRP TRP A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 ASN 62 62 62 ASN ASN A . n # _cell.entry_id 1AIW _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1AIW _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1AIW _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1AIW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1AIW _struct.title 'NMR STRUCTURES OF THE CELLULOSE-BINDING DOMAIN OF THE ENDOGLUCANASE Z FROM ERWINIA CHRYSANTHEMI, 23 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1AIW _struct_keywords.pdbx_keywords 'CELLULOSE DEGRADATION' _struct_keywords.text 'CELLULOSE DEGRADATION, ENDOGLUCANASE, CELLULOSE-BINDING DOMAIN, ERWINIA CHRYSANTHEMI' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GUNZ_ERWCH _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P07103 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MPLSYLDKNPVIDSKKHALRKKLFLSCAYFGLSLACLSSNAWASVEPLSVNGNKIYAGEKAKSFAGNSLFWSNNGWGGEK FYTADTVASLKKDWKSSIVRAAMGVQESGGYLQDPAGNKAKVERVVDAAIANDMYAIIGWHSHSAENNRSEAIRFFQEMA RKYGNKPNVIYEIYNEPLQVSWSNTIKPYAEAVISAIRAIDPDNLIIVGTPSWSQNVDEASRDPINAKNIAYTLHFYAGT HGESLRNKARQALNNGIALFVTEWGTVNADGNGGVNQTETDAWVTFMRDNNISNANWALNDKNEGASTYYPDSKNLTESG KKVKSIIQSWPYKAGSAASATTDPSTDTTTDTTVDEPTTTDTPATADCANANVYPNWVSKDWAGGQPTHNEAGQSIVYKG NLYTANWYTASVPGSDSSWTQVGSCN ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1AIW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 62 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07103 _struct_ref_seq.db_align_beg 367 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 426 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 62 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 4 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 61 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 4 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 61 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.086 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 4 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 61 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 4 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 61 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 1 1.93 2 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 2 -0.12 3 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 3 -0.28 4 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 4 0.79 5 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 5 -0.57 6 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 6 1.36 7 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 7 1.11 8 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 8 1.26 9 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 9 0.12 10 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 10 -0.16 11 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 11 0.41 12 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 12 0.58 13 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 13 -0.03 14 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 14 -0.58 15 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 15 0.59 16 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 16 0.31 17 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 17 0.28 18 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 18 0.81 19 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 19 -1.04 20 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 20 0.55 21 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 21 0.88 22 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 22 1.57 23 TYR 10 A . ? TYR 10 A PRO 11 A ? PRO 11 A 23 0.26 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 31 ? TYR A 34 ? SER A 31 TYR A 34 A 2 ASN A 37 ? ALA A 41 ? ASN A 37 ALA A 41 A 3 TRP A 55 ? SER A 60 ? TRP A 55 SER A 60 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 32 ? O ILE A 32 N TYR A 39 ? N TYR A 39 A 2 3 O LEU A 38 ? O LEU A 38 N GLY A 59 ? N GLY A 59 # _struct_site.id S1 _struct_site.pdbx_evidence_code Unknown _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'PUTATIVE CELLULOSE-BINDING SITE.' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 S1 2 TRP A 43 ? TRP A 43 . ? 1_555 ? 2 S1 2 TYR A 44 ? TYR A 44 . ? 1_555 ? # _pdbx_entry_details.entry_id 1AIW _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 7 CA A TRP 43 ? ? CB A TRP 43 ? ? CG A TRP 43 ? ? 130.01 113.70 16.31 1.90 N 2 21 CA A VAL 33 ? ? CB A VAL 33 ? ? CG2 A VAL 33 ? ? 120.58 110.90 9.68 1.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 4 ? ? -125.58 -60.12 2 1 ALA A 5 ? ? 161.64 -66.40 3 1 ASN A 6 ? ? -154.11 25.42 4 1 PRO A 11 ? ? -89.93 33.82 5 1 ASP A 17 ? ? 154.47 -43.06 6 1 THR A 24 ? ? -150.46 -12.38 7 1 HIS A 25 ? ? 179.06 174.29 8 1 LYS A 35 ? ? 39.09 81.77 9 1 TRP A 43 ? ? -143.07 -69.85 10 1 ALA A 46 ? ? -143.01 32.01 11 1 SER A 47 ? ? -84.02 -103.86 12 1 ASP A 52 ? ? 42.51 -111.20 13 1 SER A 53 ? ? 59.65 -72.24 14 1 SER A 54 ? ? -173.65 38.65 15 2 ALA A 5 ? ? -20.59 -51.45 16 2 ASN A 8 ? ? -29.51 105.13 17 2 PRO A 11 ? ? -99.61 43.25 18 2 ASP A 17 ? ? 162.92 -42.97 19 2 THR A 24 ? ? -152.23 -17.43 20 2 HIS A 25 ? ? 177.31 150.48 21 2 TYR A 34 ? ? 174.66 147.18 22 2 TRP A 43 ? ? -145.13 -141.27 23 2 ASP A 52 ? ? -170.19 -79.88 24 3 CYS A 4 ? ? -68.71 80.97 25 3 PRO A 11 ? ? -97.03 33.11 26 3 SER A 15 ? ? -90.81 -72.17 27 3 LYS A 16 ? ? 48.83 -157.03 28 3 GLN A 22 ? ? -55.87 103.48 29 3 LYS A 35 ? ? 30.52 83.76 30 3 TRP A 43 ? ? -140.39 -72.15 31 3 ALA A 46 ? ? -142.96 40.05 32 3 VAL A 48 ? ? -36.76 110.90 33 3 SER A 51 ? ? -81.13 47.76 34 3 ASP A 52 ? ? -164.92 -117.27 35 4 CYS A 4 ? ? 45.68 27.70 36 4 ASN A 8 ? ? -54.76 98.40 37 4 PRO A 11 ? ? -91.70 31.93 38 4 TRP A 13 ? ? -49.91 164.03 39 4 ASP A 17 ? ? 168.26 -44.63 40 4 TRP A 18 ? ? -58.08 178.30 41 4 THR A 24 ? ? -151.09 4.52 42 4 TYR A 34 ? ? -172.10 141.93 43 4 LYS A 35 ? ? 24.64 73.05 44 4 TRP A 43 ? ? -142.57 -74.18 45 4 TYR A 44 ? ? -160.21 119.58 46 4 ASP A 52 ? ? -145.07 -43.41 47 5 PRO A 11 ? ? -95.81 30.20 48 5 TRP A 13 ? ? -49.69 159.36 49 5 THR A 24 ? ? -141.66 -7.62 50 5 HIS A 25 ? ? 176.00 170.77 51 5 ALA A 28 ? ? -38.40 128.20 52 5 TYR A 34 ? ? -138.12 -62.55 53 5 TRP A 43 ? ? -142.52 -70.05 54 5 THR A 45 ? ? -173.32 147.78 55 5 ASP A 52 ? ? 41.47 -109.06 56 5 SER A 53 ? ? 58.27 -82.43 57 5 SER A 54 ? ? -150.77 28.32 58 6 ALA A 5 ? ? 166.65 -63.79 59 6 ASN A 6 ? ? -157.91 28.11 60 6 ASN A 8 ? ? -63.63 98.03 61 6 PRO A 11 ? ? -94.33 31.42 62 6 HIS A 25 ? ? 173.62 171.83 63 6 TYR A 34 ? ? -131.97 -60.84 64 6 TRP A 43 ? ? -138.61 -70.85 65 6 ASP A 52 ? ? 43.11 -125.78 66 6 SER A 53 ? ? 53.38 -132.25 67 6 SER A 54 ? ? -69.49 -80.56 68 6 TRP A 55 ? ? -7.95 97.84 69 7 ASN A 8 ? ? -66.35 94.97 70 7 PRO A 11 ? ? -95.54 32.59 71 7 LYS A 16 ? ? 59.34 -80.25 72 7 ASP A 17 ? ? 149.06 -45.50 73 7 PRO A 23 ? ? -39.67 138.78 74 7 HIS A 25 ? ? 172.87 164.81 75 7 TYR A 34 ? ? -176.60 135.27 76 7 TRP A 43 ? ? -143.71 -72.94 77 7 SER A 51 ? ? -75.94 49.99 78 7 ASP A 52 ? ? 42.98 -140.74 79 7 SER A 53 ? ? 44.11 -106.91 80 8 PRO A 11 ? ? -93.82 35.43 81 8 HIS A 25 ? ? 177.36 167.97 82 8 TYR A 34 ? ? -152.13 -108.24 83 8 TRP A 43 ? ? -141.73 -73.88 84 8 TYR A 44 ? ? -160.49 119.39 85 8 ASP A 52 ? ? 42.34 -146.32 86 8 SER A 53 ? ? 40.78 -100.45 87 8 CYS A 61 ? ? -122.68 -69.71 88 9 ALA A 5 ? ? 163.89 -61.46 89 9 ASN A 6 ? ? -151.14 4.09 90 9 ASN A 8 ? ? -58.57 100.84 91 9 PRO A 11 ? ? -94.80 32.86 92 9 ASP A 17 ? ? 159.98 -45.34 93 9 THR A 24 ? ? -151.19 2.87 94 9 ALA A 28 ? ? -35.69 123.96 95 9 LYS A 35 ? ? 35.87 73.90 96 9 TRP A 43 ? ? -144.87 -72.82 97 9 ASP A 52 ? ? 45.18 -119.44 98 9 SER A 53 ? ? 66.43 -63.91 99 9 SER A 54 ? ? -178.51 32.64 100 10 CYS A 4 ? ? 15.25 69.55 101 10 TRP A 13 ? ? -48.34 160.35 102 10 SER A 15 ? ? -170.37 -167.91 103 10 ASP A 17 ? ? 159.23 -39.74 104 10 HIS A 25 ? ? 177.68 164.08 105 10 TYR A 34 ? ? -138.65 -138.28 106 10 LYS A 35 ? ? -64.27 84.42 107 10 TRP A 43 ? ? -139.35 -70.75 108 10 ASP A 52 ? ? 51.98 -138.17 109 10 SER A 53 ? ? 57.33 -139.55 110 10 SER A 54 ? ? -62.41 -74.97 111 10 TRP A 55 ? ? -19.54 114.35 112 11 ALA A 5 ? ? 150.53 -60.69 113 11 ASN A 6 ? ? -151.59 32.01 114 11 ASN A 8 ? ? -61.19 98.26 115 11 TYR A 10 ? ? -39.67 132.97 116 11 HIS A 25 ? ? 178.86 156.71 117 11 TYR A 34 ? ? -151.54 -92.94 118 11 TRP A 43 ? ? -146.66 -140.66 119 11 SER A 47 ? ? -83.39 -133.93 120 11 SER A 51 ? ? -77.02 44.37 121 11 ASP A 52 ? ? 42.13 -149.66 122 11 SER A 53 ? ? 50.59 -76.84 123 12 ALA A 5 ? ? 161.35 -67.23 124 12 ASN A 6 ? ? -156.51 26.15 125 12 TYR A 10 ? ? -38.07 131.04 126 12 ASP A 17 ? ? 167.56 -49.08 127 12 THR A 24 ? ? -141.07 -28.24 128 12 TRP A 43 ? ? -132.09 -79.37 129 12 ALA A 46 ? ? -150.29 34.24 130 12 SER A 47 ? ? -88.64 -100.47 131 12 ASP A 52 ? ? 50.94 -128.21 132 12 SER A 53 ? ? 72.45 -47.99 133 12 SER A 54 ? ? 178.47 -64.33 134 12 TRP A 55 ? ? -11.91 121.54 135 13 ALA A 5 ? ? 157.01 -57.60 136 13 ASN A 6 ? ? -149.74 -5.60 137 13 ASN A 8 ? ? -54.31 103.85 138 13 PRO A 11 ? ? -98.25 36.29 139 13 LYS A 16 ? ? 57.29 -178.84 140 13 TRP A 18 ? ? -158.21 -74.33 141 13 ALA A 19 ? ? -161.87 -52.60 142 13 THR A 24 ? ? -154.20 -29.15 143 13 HIS A 25 ? ? 164.59 169.46 144 13 ALA A 28 ? ? -38.08 122.40 145 13 LYS A 35 ? ? 40.36 76.21 146 13 TRP A 43 ? ? -143.46 -70.68 147 13 THR A 45 ? ? -171.67 147.46 148 13 VAL A 48 ? ? -36.31 110.58 149 13 ASP A 52 ? ? -78.85 -111.76 150 14 ASP A 3 ? ? 39.20 -126.29 151 14 ASN A 6 ? ? -162.47 -45.21 152 14 PRO A 11 ? ? -95.54 36.82 153 14 THR A 24 ? ? -150.73 -4.89 154 14 HIS A 25 ? ? 165.59 167.00 155 14 LYS A 35 ? ? 33.16 74.20 156 14 TRP A 43 ? ? -133.50 -71.47 157 14 ALA A 46 ? ? -149.56 21.12 158 14 ASP A 52 ? ? 47.20 -126.70 159 14 SER A 53 ? ? 65.07 -40.87 160 14 SER A 54 ? ? 179.34 -69.82 161 14 TRP A 55 ? ? -8.91 112.98 162 15 ALA A 5 ? ? 155.98 -61.04 163 15 ASN A 6 ? ? -151.10 0.85 164 15 ASN A 8 ? ? -61.52 94.00 165 15 PRO A 11 ? ? -93.87 33.47 166 15 THR A 24 ? ? -157.74 9.74 167 15 TRP A 43 ? ? -132.91 -78.01 168 15 ASP A 52 ? ? 43.81 -131.43 169 15 SER A 53 ? ? 67.70 -54.77 170 15 SER A 54 ? ? -172.45 -61.57 171 15 TRP A 55 ? ? -18.68 140.79 172 16 CYS A 4 ? ? -9.95 84.98 173 16 ASP A 17 ? ? 174.75 -40.55 174 16 THR A 24 ? ? -152.37 -17.46 175 16 HIS A 25 ? ? 179.38 164.19 176 16 LYS A 35 ? ? 39.45 78.58 177 16 TRP A 43 ? ? -131.38 -75.42 178 16 ASP A 52 ? ? 55.94 -133.20 179 16 SER A 53 ? ? 59.52 -152.88 180 16 TRP A 55 ? ? -13.50 119.85 181 17 ALA A 5 ? ? 167.85 -55.76 182 17 ASN A 6 ? ? -152.16 -2.68 183 17 ASN A 8 ? ? -39.50 106.85 184 17 PRO A 11 ? ? -93.27 34.42 185 17 PRO A 23 ? ? -38.74 159.38 186 17 THR A 24 ? ? -151.11 2.93 187 17 HIS A 25 ? ? 178.16 172.24 188 17 LYS A 35 ? ? 41.18 81.74 189 17 TRP A 43 ? ? -148.96 -65.16 190 17 THR A 45 ? ? -174.32 144.29 191 17 SER A 53 ? ? 163.57 -49.43 192 17 SER A 54 ? ? -146.56 11.06 193 18 ALA A 5 ? ? 167.24 -58.02 194 18 ASN A 6 ? ? -152.15 32.32 195 18 ASN A 8 ? ? -32.54 97.77 196 18 PRO A 11 ? ? -92.21 36.12 197 18 ASP A 17 ? ? -158.07 -50.22 198 18 THR A 24 ? ? -151.86 -7.92 199 18 TRP A 43 ? ? -138.89 -146.00 200 18 SER A 53 ? ? -47.24 164.92 201 19 CYS A 4 ? ? -37.12 92.66 202 19 PRO A 11 ? ? -99.37 31.17 203 19 TRP A 13 ? ? -48.59 152.41 204 19 LYS A 16 ? ? -110.48 -166.50 205 19 PRO A 23 ? ? -37.79 147.75 206 19 LYS A 35 ? ? 38.23 77.30 207 19 TRP A 43 ? ? -139.14 -71.97 208 19 ASP A 52 ? ? -109.50 -167.14 209 20 ASP A 3 ? ? -66.91 80.79 210 20 CYS A 4 ? ? -7.66 85.95 211 20 PRO A 11 ? ? -91.48 31.08 212 20 ALA A 19 ? ? -65.43 73.70 213 20 HIS A 25 ? ? 176.40 164.76 214 20 TYR A 34 ? ? -155.32 -66.64 215 20 TRP A 43 ? ? -148.70 -140.76 216 20 ALA A 46 ? ? -141.34 43.17 217 20 VAL A 48 ? ? -31.32 105.02 218 20 ASP A 52 ? ? -80.65 -97.37 219 21 ASP A 3 ? ? -179.29 149.29 220 21 ALA A 5 ? ? -39.80 -39.47 221 21 THR A 24 ? ? -146.02 -19.35 222 21 HIS A 25 ? ? 177.85 166.05 223 21 TRP A 43 ? ? -144.69 -67.46 224 21 THR A 45 ? ? -176.36 145.42 225 21 ALA A 46 ? ? -149.92 45.55 226 21 SER A 47 ? ? -106.96 -105.56 227 21 SER A 53 ? ? 89.00 179.28 228 22 ASP A 3 ? ? -26.51 -49.67 229 22 ALA A 5 ? ? 151.88 -61.17 230 22 ASN A 6 ? ? -151.68 2.80 231 22 ASN A 8 ? ? -69.65 97.76 232 22 TRP A 13 ? ? -58.10 176.14 233 22 LYS A 16 ? ? 53.51 -167.26 234 22 THR A 24 ? ? -150.92 -12.66 235 22 HIS A 25 ? ? 178.60 164.07 236 22 TYR A 34 ? ? -138.98 -126.56 237 22 TRP A 43 ? ? -134.18 -73.77 238 22 ALA A 46 ? ? -147.97 37.00 239 22 SER A 47 ? ? -94.70 -103.93 240 22 ASP A 52 ? ? 51.69 -132.19 241 22 SER A 53 ? ? 57.70 -150.58 242 22 TRP A 55 ? ? -20.06 130.66 243 23 ASP A 3 ? ? -16.44 -57.45 244 23 ALA A 5 ? ? 104.87 -42.12 245 23 ASN A 6 ? ? -146.61 40.82 246 23 ASN A 8 ? ? -48.83 107.30 247 23 PRO A 11 ? ? -96.90 35.97 248 23 TRP A 18 ? ? 21.24 166.40 249 23 ALA A 19 ? ? 120.69 57.30 250 23 THR A 24 ? ? -142.91 -17.79 251 23 TRP A 43 ? ? -139.91 -75.85 252 23 SER A 51 ? ? -66.36 -71.57 253 23 ASP A 52 ? ? -146.14 -32.67 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 10 ? ? 0.077 'SIDE CHAIN' 2 1 TYR A 44 ? ? 0.102 'SIDE CHAIN' 3 2 TYR A 34 ? ? 0.102 'SIDE CHAIN' 4 2 TYR A 44 ? ? 0.095 'SIDE CHAIN' 5 3 TYR A 34 ? ? 0.121 'SIDE CHAIN' 6 4 TYR A 39 ? ? 0.064 'SIDE CHAIN' 7 6 TYR A 39 ? ? 0.094 'SIDE CHAIN' 8 7 TYR A 39 ? ? 0.098 'SIDE CHAIN' 9 7 TYR A 44 ? ? 0.096 'SIDE CHAIN' 10 8 TYR A 39 ? ? 0.092 'SIDE CHAIN' 11 10 TYR A 44 ? ? 0.097 'SIDE CHAIN' 12 11 TYR A 44 ? ? 0.111 'SIDE CHAIN' 13 12 TYR A 39 ? ? 0.068 'SIDE CHAIN' 14 16 TYR A 44 ? ? 0.096 'SIDE CHAIN' 15 17 TYR A 44 ? ? 0.124 'SIDE CHAIN' 16 18 TYR A 10 ? ? 0.069 'SIDE CHAIN' 17 18 TYR A 34 ? ? 0.069 'SIDE CHAIN' 18 19 TYR A 44 ? ? 0.069 'SIDE CHAIN' 19 21 TYR A 34 ? ? 0.074 'SIDE CHAIN' 20 22 TYR A 10 ? ? 0.081 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1AIW _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 23 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 4.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 DQF-COSY 1 2 1 TOCSY 1 3 1 NOESY 1 # _pdbx_nmr_refine.entry_id 1AIW _pdbx_nmr_refine.method 'SIMULATED ANNEALING, RESTRAINED MOLECULAR DYNAMICS' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement Discover ? BIOSYM 1 'structure solution' 'BIOSYM DISCOVER' DISCOVER ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 MET N N N N 200 MET CA C N S 201 MET C C N N 202 MET O O N N 203 MET CB C N N 204 MET CG C N N 205 MET SD S N N 206 MET CE C N N 207 MET OXT O N N 208 MET H H N N 209 MET H2 H N N 210 MET HA H N N 211 MET HB2 H N N 212 MET HB3 H N N 213 MET HG2 H N N 214 MET HG3 H N N 215 MET HE1 H N N 216 MET HE2 H N N 217 MET HE3 H N N 218 MET HXT H N N 219 PRO N N N N 220 PRO CA C N S 221 PRO C C N N 222 PRO O O N N 223 PRO CB C N N 224 PRO CG C N N 225 PRO CD C N N 226 PRO OXT O N N 227 PRO H H N N 228 PRO HA H N N 229 PRO HB2 H N N 230 PRO HB3 H N N 231 PRO HG2 H N N 232 PRO HG3 H N N 233 PRO HD2 H N N 234 PRO HD3 H N N 235 PRO HXT H N N 236 SER N N N N 237 SER CA C N S 238 SER C C N N 239 SER O O N N 240 SER CB C N N 241 SER OG O N N 242 SER OXT O N N 243 SER H H N N 244 SER H2 H N N 245 SER HA H N N 246 SER HB2 H N N 247 SER HB3 H N N 248 SER HG H N N 249 SER HXT H N N 250 THR N N N N 251 THR CA C N S 252 THR C C N N 253 THR O O N N 254 THR CB C N R 255 THR OG1 O N N 256 THR CG2 C N N 257 THR OXT O N N 258 THR H H N N 259 THR H2 H N N 260 THR HA H N N 261 THR HB H N N 262 THR HG1 H N N 263 THR HG21 H N N 264 THR HG22 H N N 265 THR HG23 H N N 266 THR HXT H N N 267 TRP N N N N 268 TRP CA C N S 269 TRP C C N N 270 TRP O O N N 271 TRP CB C N N 272 TRP CG C Y N 273 TRP CD1 C Y N 274 TRP CD2 C Y N 275 TRP NE1 N Y N 276 TRP CE2 C Y N 277 TRP CE3 C Y N 278 TRP CZ2 C Y N 279 TRP CZ3 C Y N 280 TRP CH2 C Y N 281 TRP OXT O N N 282 TRP H H N N 283 TRP H2 H N N 284 TRP HA H N N 285 TRP HB2 H N N 286 TRP HB3 H N N 287 TRP HD1 H N N 288 TRP HE1 H N N 289 TRP HE3 H N N 290 TRP HZ2 H N N 291 TRP HZ3 H N N 292 TRP HH2 H N N 293 TRP HXT H N N 294 TYR N N N N 295 TYR CA C N S 296 TYR C C N N 297 TYR O O N N 298 TYR CB C N N 299 TYR CG C Y N 300 TYR CD1 C Y N 301 TYR CD2 C Y N 302 TYR CE1 C Y N 303 TYR CE2 C Y N 304 TYR CZ C Y N 305 TYR OH O N N 306 TYR OXT O N N 307 TYR H H N N 308 TYR H2 H N N 309 TYR HA H N N 310 TYR HB2 H N N 311 TYR HB3 H N N 312 TYR HD1 H N N 313 TYR HD2 H N N 314 TYR HE1 H N N 315 TYR HE2 H N N 316 TYR HH H N N 317 TYR HXT H N N 318 VAL N N N N 319 VAL CA C N S 320 VAL C C N N 321 VAL O O N N 322 VAL CB C N N 323 VAL CG1 C N N 324 VAL CG2 C N N 325 VAL OXT O N N 326 VAL H H N N 327 VAL H2 H N N 328 VAL HA H N N 329 VAL HB H N N 330 VAL HG11 H N N 331 VAL HG12 H N N 332 VAL HG13 H N N 333 VAL HG21 H N N 334 VAL HG22 H N N 335 VAL HG23 H N N 336 VAL HXT H N N 337 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 ILE N CA sing N N 124 ILE N H sing N N 125 ILE N H2 sing N N 126 ILE CA C sing N N 127 ILE CA CB sing N N 128 ILE CA HA sing N N 129 ILE C O doub N N 130 ILE C OXT sing N N 131 ILE CB CG1 sing N N 132 ILE CB CG2 sing N N 133 ILE CB HB sing N N 134 ILE CG1 CD1 sing N N 135 ILE CG1 HG12 sing N N 136 ILE CG1 HG13 sing N N 137 ILE CG2 HG21 sing N N 138 ILE CG2 HG22 sing N N 139 ILE CG2 HG23 sing N N 140 ILE CD1 HD11 sing N N 141 ILE CD1 HD12 sing N N 142 ILE CD1 HD13 sing N N 143 ILE OXT HXT sing N N 144 LEU N CA sing N N 145 LEU N H sing N N 146 LEU N H2 sing N N 147 LEU CA C sing N N 148 LEU CA CB sing N N 149 LEU CA HA sing N N 150 LEU C O doub N N 151 LEU C OXT sing N N 152 LEU CB CG sing N N 153 LEU CB HB2 sing N N 154 LEU CB HB3 sing N N 155 LEU CG CD1 sing N N 156 LEU CG CD2 sing N N 157 LEU CG HG sing N N 158 LEU CD1 HD11 sing N N 159 LEU CD1 HD12 sing N N 160 LEU CD1 HD13 sing N N 161 LEU CD2 HD21 sing N N 162 LEU CD2 HD22 sing N N 163 LEU CD2 HD23 sing N N 164 LEU OXT HXT sing N N 165 LYS N CA sing N N 166 LYS N H sing N N 167 LYS N H2 sing N N 168 LYS CA C sing N N 169 LYS CA CB sing N N 170 LYS CA HA sing N N 171 LYS C O doub N N 172 LYS C OXT sing N N 173 LYS CB CG sing N N 174 LYS CB HB2 sing N N 175 LYS CB HB3 sing N N 176 LYS CG CD sing N N 177 LYS CG HG2 sing N N 178 LYS CG HG3 sing N N 179 LYS CD CE sing N N 180 LYS CD HD2 sing N N 181 LYS CD HD3 sing N N 182 LYS CE NZ sing N N 183 LYS CE HE2 sing N N 184 LYS CE HE3 sing N N 185 LYS NZ HZ1 sing N N 186 LYS NZ HZ2 sing N N 187 LYS NZ HZ3 sing N N 188 LYS OXT HXT sing N N 189 MET N CA sing N N 190 MET N H sing N N 191 MET N H2 sing N N 192 MET CA C sing N N 193 MET CA CB sing N N 194 MET CA HA sing N N 195 MET C O doub N N 196 MET C OXT sing N N 197 MET CB CG sing N N 198 MET CB HB2 sing N N 199 MET CB HB3 sing N N 200 MET CG SD sing N N 201 MET CG HG2 sing N N 202 MET CG HG3 sing N N 203 MET SD CE sing N N 204 MET CE HE1 sing N N 205 MET CE HE2 sing N N 206 MET CE HE3 sing N N 207 MET OXT HXT sing N N 208 PRO N CA sing N N 209 PRO N CD sing N N 210 PRO N H sing N N 211 PRO CA C sing N N 212 PRO CA CB sing N N 213 PRO CA HA sing N N 214 PRO C O doub N N 215 PRO C OXT sing N N 216 PRO CB CG sing N N 217 PRO CB HB2 sing N N 218 PRO CB HB3 sing N N 219 PRO CG CD sing N N 220 PRO CG HG2 sing N N 221 PRO CG HG3 sing N N 222 PRO CD HD2 sing N N 223 PRO CD HD3 sing N N 224 PRO OXT HXT sing N N 225 SER N CA sing N N 226 SER N H sing N N 227 SER N H2 sing N N 228 SER CA C sing N N 229 SER CA CB sing N N 230 SER CA HA sing N N 231 SER C O doub N N 232 SER C OXT sing N N 233 SER CB OG sing N N 234 SER CB HB2 sing N N 235 SER CB HB3 sing N N 236 SER OG HG sing N N 237 SER OXT HXT sing N N 238 THR N CA sing N N 239 THR N H sing N N 240 THR N H2 sing N N 241 THR CA C sing N N 242 THR CA CB sing N N 243 THR CA HA sing N N 244 THR C O doub N N 245 THR C OXT sing N N 246 THR CB OG1 sing N N 247 THR CB CG2 sing N N 248 THR CB HB sing N N 249 THR OG1 HG1 sing N N 250 THR CG2 HG21 sing N N 251 THR CG2 HG22 sing N N 252 THR CG2 HG23 sing N N 253 THR OXT HXT sing N N 254 TRP N CA sing N N 255 TRP N H sing N N 256 TRP N H2 sing N N 257 TRP CA C sing N N 258 TRP CA CB sing N N 259 TRP CA HA sing N N 260 TRP C O doub N N 261 TRP C OXT sing N N 262 TRP CB CG sing N N 263 TRP CB HB2 sing N N 264 TRP CB HB3 sing N N 265 TRP CG CD1 doub Y N 266 TRP CG CD2 sing Y N 267 TRP CD1 NE1 sing Y N 268 TRP CD1 HD1 sing N N 269 TRP CD2 CE2 doub Y N 270 TRP CD2 CE3 sing Y N 271 TRP NE1 CE2 sing Y N 272 TRP NE1 HE1 sing N N 273 TRP CE2 CZ2 sing Y N 274 TRP CE3 CZ3 doub Y N 275 TRP CE3 HE3 sing N N 276 TRP CZ2 CH2 doub Y N 277 TRP CZ2 HZ2 sing N N 278 TRP CZ3 CH2 sing Y N 279 TRP CZ3 HZ3 sing N N 280 TRP CH2 HH2 sing N N 281 TRP OXT HXT sing N N 282 TYR N CA sing N N 283 TYR N H sing N N 284 TYR N H2 sing N N 285 TYR CA C sing N N 286 TYR CA CB sing N N 287 TYR CA HA sing N N 288 TYR C O doub N N 289 TYR C OXT sing N N 290 TYR CB CG sing N N 291 TYR CB HB2 sing N N 292 TYR CB HB3 sing N N 293 TYR CG CD1 doub Y N 294 TYR CG CD2 sing Y N 295 TYR CD1 CE1 sing Y N 296 TYR CD1 HD1 sing N N 297 TYR CD2 CE2 doub Y N 298 TYR CD2 HD2 sing N N 299 TYR CE1 CZ doub Y N 300 TYR CE1 HE1 sing N N 301 TYR CE2 CZ sing Y N 302 TYR CE2 HE2 sing N N 303 TYR CZ OH sing N N 304 TYR OH HH sing N N 305 TYR OXT HXT sing N N 306 VAL N CA sing N N 307 VAL N H sing N N 308 VAL N H2 sing N N 309 VAL CA C sing N N 310 VAL CA CB sing N N 311 VAL CA HA sing N N 312 VAL C O doub N N 313 VAL C OXT sing N N 314 VAL CB CG1 sing N N 315 VAL CB CG2 sing N N 316 VAL CB HB sing N N 317 VAL CG1 HG11 sing N N 318 VAL CG1 HG12 sing N N 319 VAL CG1 HG13 sing N N 320 VAL CG2 HG21 sing N N 321 VAL CG2 HG22 sing N N 322 VAL CG2 HG23 sing N N 323 VAL OXT HXT sing N N 324 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AMX 600' _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1AIW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_