data_1ALN # _entry.id 1ALN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ALN pdb_00001aln 10.2210/pdb1aln/pdb WWPDB D_1000170970 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ALN _pdbx_database_status.recvd_initial_deposition_date 1997-06-02 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xiang, S.' 1 'Carter, C.W.' 2 # _citation.id primary _citation.title ;Cytidine deaminase complexed to 3-deazacytidine: a "valence buffer" in zinc enzyme catalysis. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 35 _citation.page_first 1335 _citation.page_last 1341 _citation.year 1996 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 8634261 _citation.pdbx_database_id_DOI 10.1021/bi9525583 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xiang, S.' 1 ? primary 'Short, S.A.' 2 ? primary 'Wolfenden, R.' 3 ? primary 'Carter Jr., C.W.' 4 ? # _cell.entry_id 1ALN _cell.length_a 120.300 _cell.length_b 120.300 _cell.length_c 78.400 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1ALN _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CYTIDINE DEAMINASE' 31569.785 1 3.5.4.5 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 3-DEAZACYTIDINE 242.229 1 ? ? ? ? 4 water nat water 18.015 49 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHPRFQTAFAQLADNLQSALEPILADKYFPALLTGEQVSSLKSATGLDEDALAFALLPLAAACARTPLSNFNVGAIARGV SGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALAAITVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALRDY LPDAFGPKDLEIKTLLMDEQDHGYALTGDALSQAAIAAANRSHMPYSKSPSGVALECKDGRIFSGSYAENAAFNPTLPPL QGALILLNLKGYDYPDIQRAVLAEKADAPLIQWDATSATLKALGCHSIDRVLLA ; _entity_poly.pdbx_seq_one_letter_code_can ;MHPRFQTAFAQLADNLQSALEPILADKYFPALLTGEQVSSLKSATGLDEDALAFALLPLAAACARTPLSNFNVGAIARGV SGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALAAITVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALRDY LPDAFGPKDLEIKTLLMDEQDHGYALTGDALSQAAIAAANRSHMPYSKSPSGVALECKDGRIFSGSYAENAAFNPTLPPL QGALILLNLKGYDYPDIQRAVLAEKADAPLIQWDATSATLKALGCHSIDRVLLA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 PRO n 1 4 ARG n 1 5 PHE n 1 6 GLN n 1 7 THR n 1 8 ALA n 1 9 PHE n 1 10 ALA n 1 11 GLN n 1 12 LEU n 1 13 ALA n 1 14 ASP n 1 15 ASN n 1 16 LEU n 1 17 GLN n 1 18 SER n 1 19 ALA n 1 20 LEU n 1 21 GLU n 1 22 PRO n 1 23 ILE n 1 24 LEU n 1 25 ALA n 1 26 ASP n 1 27 LYS n 1 28 TYR n 1 29 PHE n 1 30 PRO n 1 31 ALA n 1 32 LEU n 1 33 LEU n 1 34 THR n 1 35 GLY n 1 36 GLU n 1 37 GLN n 1 38 VAL n 1 39 SER n 1 40 SER n 1 41 LEU n 1 42 LYS n 1 43 SER n 1 44 ALA n 1 45 THR n 1 46 GLY n 1 47 LEU n 1 48 ASP n 1 49 GLU n 1 50 ASP n 1 51 ALA n 1 52 LEU n 1 53 ALA n 1 54 PHE n 1 55 ALA n 1 56 LEU n 1 57 LEU n 1 58 PRO n 1 59 LEU n 1 60 ALA n 1 61 ALA n 1 62 ALA n 1 63 CYS n 1 64 ALA n 1 65 ARG n 1 66 THR n 1 67 PRO n 1 68 LEU n 1 69 SER n 1 70 ASN n 1 71 PHE n 1 72 ASN n 1 73 VAL n 1 74 GLY n 1 75 ALA n 1 76 ILE n 1 77 ALA n 1 78 ARG n 1 79 GLY n 1 80 VAL n 1 81 SER n 1 82 GLY n 1 83 THR n 1 84 TRP n 1 85 TYR n 1 86 PHE n 1 87 GLY n 1 88 ALA n 1 89 ASN n 1 90 MET n 1 91 GLU n 1 92 PHE n 1 93 ILE n 1 94 GLY n 1 95 ALA n 1 96 THR n 1 97 MET n 1 98 GLN n 1 99 GLN n 1 100 THR n 1 101 VAL n 1 102 HIS n 1 103 ALA n 1 104 GLU n 1 105 GLN n 1 106 SER n 1 107 ALA n 1 108 ILE n 1 109 SER n 1 110 HIS n 1 111 ALA n 1 112 TRP n 1 113 LEU n 1 114 SER n 1 115 GLY n 1 116 GLU n 1 117 LYS n 1 118 ALA n 1 119 LEU n 1 120 ALA n 1 121 ALA n 1 122 ILE n 1 123 THR n 1 124 VAL n 1 125 ASN n 1 126 TYR n 1 127 THR n 1 128 PRO n 1 129 CYS n 1 130 GLY n 1 131 HIS n 1 132 CYS n 1 133 ARG n 1 134 GLN n 1 135 PHE n 1 136 MET n 1 137 ASN n 1 138 GLU n 1 139 LEU n 1 140 ASN n 1 141 SER n 1 142 GLY n 1 143 LEU n 1 144 ASP n 1 145 LEU n 1 146 ARG n 1 147 ILE n 1 148 HIS n 1 149 LEU n 1 150 PRO n 1 151 GLY n 1 152 ARG n 1 153 GLU n 1 154 ALA n 1 155 HIS n 1 156 ALA n 1 157 LEU n 1 158 ARG n 1 159 ASP n 1 160 TYR n 1 161 LEU n 1 162 PRO n 1 163 ASP n 1 164 ALA n 1 165 PHE n 1 166 GLY n 1 167 PRO n 1 168 LYS n 1 169 ASP n 1 170 LEU n 1 171 GLU n 1 172 ILE n 1 173 LYS n 1 174 THR n 1 175 LEU n 1 176 LEU n 1 177 MET n 1 178 ASP n 1 179 GLU n 1 180 GLN n 1 181 ASP n 1 182 HIS n 1 183 GLY n 1 184 TYR n 1 185 ALA n 1 186 LEU n 1 187 THR n 1 188 GLY n 1 189 ASP n 1 190 ALA n 1 191 LEU n 1 192 SER n 1 193 GLN n 1 194 ALA n 1 195 ALA n 1 196 ILE n 1 197 ALA n 1 198 ALA n 1 199 ALA n 1 200 ASN n 1 201 ARG n 1 202 SER n 1 203 HIS n 1 204 MET n 1 205 PRO n 1 206 TYR n 1 207 SER n 1 208 LYS n 1 209 SER n 1 210 PRO n 1 211 SER n 1 212 GLY n 1 213 VAL n 1 214 ALA n 1 215 LEU n 1 216 GLU n 1 217 CYS n 1 218 LYS n 1 219 ASP n 1 220 GLY n 1 221 ARG n 1 222 ILE n 1 223 PHE n 1 224 SER n 1 225 GLY n 1 226 SER n 1 227 TYR n 1 228 ALA n 1 229 GLU n 1 230 ASN n 1 231 ALA n 1 232 ALA n 1 233 PHE n 1 234 ASN n 1 235 PRO n 1 236 THR n 1 237 LEU n 1 238 PRO n 1 239 PRO n 1 240 LEU n 1 241 GLN n 1 242 GLY n 1 243 ALA n 1 244 LEU n 1 245 ILE n 1 246 LEU n 1 247 LEU n 1 248 ASN n 1 249 LEU n 1 250 LYS n 1 251 GLY n 1 252 TYR n 1 253 ASP n 1 254 TYR n 1 255 PRO n 1 256 ASP n 1 257 ILE n 1 258 GLN n 1 259 ARG n 1 260 ALA n 1 261 VAL n 1 262 LEU n 1 263 ALA n 1 264 GLU n 1 265 LYS n 1 266 ALA n 1 267 ASP n 1 268 ALA n 1 269 PRO n 1 270 LEU n 1 271 ILE n 1 272 GLN n 1 273 TRP n 1 274 ASP n 1 275 ALA n 1 276 THR n 1 277 SER n 1 278 ALA n 1 279 THR n 1 280 LEU n 1 281 LYS n 1 282 ALA n 1 283 LEU n 1 284 GLY n 1 285 CYS n 1 286 HIS n 1 287 SER n 1 288 ILE n 1 289 ASP n 1 290 ARG n 1 291 VAL n 1 292 LEU n 1 293 LEU n 1 294 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CDD_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P0ABF6 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MHPRFQTAFAQLADNLQSALEPILADKYFPALLTGEQVSSLKSATGLDEDALAFALLPLAAACARTPLSNFNVGAIARGV SGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALAAITVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALRDY LPDAFGPKDLEIKTLLMDEQDHGYALTGDALSQAAIAAANRSHMPYSKSPSGVALECKDGRIFSGSYAENAAFNPTLPPL QGALILLNLKGYDYPDIQRAVLAEKADAPLIQWDATSATLKALGCHSIDRVLLA ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ALN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 294 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0ABF6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 294 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 294 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CTD non-polymer . 3-DEAZACYTIDINE ? 'C10 H14 N2 O5' 242.229 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1ALN _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 5.187 _exptl_crystal.density_percent_sol 76.289 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.2 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 6.2' # _diffrn.id 1 _diffrn.ambient_temp 297 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS II' _diffrn_detector.pdbx_collection_date 1993-09 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'NI FILTER' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1ALN _reflns.observed_criterion_sigma_I 1. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 2.3 _reflns.number_obs 27432 _reflns.number_all ? _reflns.percent_possible_obs 90.3 _reflns.pdbx_Rmerge_I_obs 0.0650000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 16. _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.5 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.50 _reflns_shell.percent_possible_all 83. _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.8 _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? # _refine.entry_id 1ALN _refine.ls_number_reflns_obs 27432 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 10000000.0 _refine.pdbx_data_cutoff_low_absF 0.001 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 7.0 _refine.ls_d_res_high 2.3 _refine.ls_percent_reflns_obs 90.3 _refine.ls_R_factor_obs 0.1900000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1900000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1CTU' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_overall_phase_error ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2220 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.number_atoms_solvent 49 _refine_hist.number_atoms_total 2287 _refine_hist.d_res_high 2.3 _refine_hist.d_res_low 7.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.8 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARAM19X.PRO1 TOPH19X.PRO 'X-RAY DIFFRACTION' 2 PARAM_SX.DAC TOPH_SX.DAC 'X-RAY DIFFRACTION' 3 PARAMCDA_SX.ZN3 TOPHCDA.ZN3 'X-RAY DIFFRACTION' 4 PARAM_SX.WAT1 TOPH_SX.WAT 'X-RAY DIFFRACTION' # _struct.entry_id 1ALN _struct.title 'CRYSTAL STRUCTURE OF CYTIDINE DEAMINASE COMPLEXED WITH 3-DEAZACYTIDINE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ALN _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'CYTIDINE DEAMINASE, VALENCE BUFFER, ZINC ENZYME, SUBSTRATE, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 3 ? GLN A 11 ? PRO A 3 GLN A 11 5 ? 9 HELX_P HELX_P2 2 ASP A 14 ? GLU A 21 ? ASP A 14 GLU A 21 1 ? 8 HELX_P HELX_P3 3 ILE A 23 ? ALA A 25 ? ILE A 23 ALA A 25 5 ? 3 HELX_P HELX_P4 4 GLY A 35 ? THR A 45 ? GLY A 35 THR A 45 1 ? 11 HELX_P HELX_P5 5 GLU A 49 ? CYS A 63 ? GLU A 49 CYS A 63 1 ? 15 HELX_P HELX_P6 6 MET A 97 ? GLN A 99 ? MET A 97 GLN A 99 5 ? 3 HELX_P HELX_P7 7 ALA A 103 ? LEU A 113 ? ALA A 103 LEU A 113 1 ? 11 HELX_P HELX_P8 8 GLY A 130 ? GLU A 138 ? GLY A 130 GLU A 138 1 ? 9 HELX_P HELX_P9 9 GLY A 142 ? ASP A 144 ? GLY A 142 ASP A 144 5 ? 3 HELX_P HELX_P10 10 LEU A 157 ? TYR A 160 ? LEU A 157 TYR A 160 1 ? 4 HELX_P HELX_P11 11 PRO A 167 ? LEU A 170 ? PRO A 167 LEU A 170 5 ? 4 HELX_P HELX_P12 12 ALA A 190 ? ARG A 201 ? ALA A 190 ARG A 201 1 ? 12 HELX_P HELX_P13 13 PRO A 239 ? LEU A 249 ? PRO A 239 LEU A 249 1 ? 11 HELX_P HELX_P14 14 TYR A 254 ? ASP A 256 ? TYR A 254 ASP A 256 5 ? 3 HELX_P HELX_P15 15 TRP A 273 ? LEU A 283 ? TRP A 273 LEU A 283 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 102 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 102 A ZN 296 1_555 ? ? ? ? ? ? ? 2.384 ? ? metalc2 metalc ? ? A CYS 129 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 129 A ZN 296 1_555 ? ? ? ? ? ? ? 2.395 ? ? metalc3 metalc ? ? A CYS 132 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 132 A ZN 296 1_555 ? ? ? ? ? ? ? 2.180 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 D HOH . O ? ? A ZN 296 A HOH 700 1_555 ? ? ? ? ? ? ? 2.083 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 84 ? ALA A 88 ? TRP A 84 ALA A 88 A 2 GLY A 74 ? GLY A 79 ? GLY A 74 GLY A 79 A 3 LEU A 119 ? VAL A 124 ? LEU A 119 VAL A 124 A 4 ARG A 146 ? LEU A 149 ? ARG A 146 LEU A 149 B 1 ILE A 222 ? SER A 226 ? ILE A 222 SER A 226 B 2 SER A 211 ? CYS A 217 ? SER A 211 CYS A 217 B 3 ILE A 257 ? GLU A 264 ? ILE A 257 GLU A 264 B 4 ILE A 288 ? LEU A 292 ? ILE A 288 LEU A 292 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 85 ? O TYR A 85 N ALA A 77 ? N ALA A 77 A 2 3 O ILE A 76 ? O ILE A 76 N THR A 123 ? N THR A 123 A 3 4 O ILE A 122 ? O ILE A 122 N ARG A 146 ? N ARG A 146 B 1 2 O PHE A 223 ? O PHE A 223 N LEU A 215 ? N LEU A 215 B 2 3 O GLY A 212 ? O GLY A 212 N ALA A 263 ? N ALA A 263 B 3 4 O ALA A 260 ? O ALA A 260 N ASP A 289 ? N ASP A 289 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details ZN Unknown ? ? ? ? 4 'ZN BINDING SITE.' AC1 Software A ZN 296 ? 4 'BINDING SITE FOR RESIDUE ZN A 296' AC2 Software A CTD 295 ? 14 'BINDING SITE FOR RESIDUE CTD A 295' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 ZN 4 HIS A 102 ? HIS A 102 . ? 1_555 ? 2 ZN 4 CYS A 129 ? CYS A 129 . ? 1_555 ? 3 ZN 4 CYS A 132 ? CYS A 132 . ? 1_555 ? 4 ZN 4 CTD C . ? CTD A 295 . ? 1_555 ? 5 AC1 4 HIS A 102 ? HIS A 102 . ? 1_555 ? 6 AC1 4 CYS A 129 ? CYS A 129 . ? 1_555 ? 7 AC1 4 CYS A 132 ? CYS A 132 . ? 1_555 ? 8 AC1 4 HOH D . ? HOH A 700 . ? 1_555 ? 9 AC2 14 PHE A 71 ? PHE A 71 . ? 1_555 ? 10 AC2 14 VAL A 73 ? VAL A 73 . ? 1_555 ? 11 AC2 14 ASN A 89 ? ASN A 89 . ? 1_555 ? 12 AC2 14 GLU A 91 ? GLU A 91 . ? 1_555 ? 13 AC2 14 THR A 100 ? THR A 100 . ? 1_555 ? 14 AC2 14 VAL A 101 ? VAL A 101 . ? 1_555 ? 15 AC2 14 HIS A 102 ? HIS A 102 . ? 1_555 ? 16 AC2 14 ALA A 103 ? ALA A 103 . ? 1_555 ? 17 AC2 14 GLU A 104 ? GLU A 104 . ? 1_555 ? 18 AC2 14 TYR A 126 ? TYR A 126 . ? 1_555 ? 19 AC2 14 THR A 127 ? THR A 127 . ? 1_555 ? 20 AC2 14 PHE A 165 ? PHE A 165 . ? 4_555 ? 21 AC2 14 ALA A 231 ? ALA A 231 . ? 4_555 ? 22 AC2 14 HOH D . ? HOH A 700 . ? 1_555 ? # _database_PDB_matrix.entry_id 1ALN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ALN _atom_sites.fract_transf_matrix[1][1] 0.008313 _atom_sites.fract_transf_matrix[1][2] 0.004799 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009599 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012755 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 HIS 2 2 2 HIS HIS A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 MET 90 90 90 MET MET A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 TRP 112 112 112 TRP TRP A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 TYR 126 126 126 TYR TYR A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 CYS 129 129 129 CYS CYS A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 CYS 132 132 132 CYS CYS A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 MET 136 136 136 MET MET A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 HIS 148 148 148 HIS HIS A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 TYR 160 160 160 TYR TYR A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 PRO 162 162 162 PRO PRO A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 PRO 167 167 167 PRO PRO A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 LYS 173 173 173 LYS LYS A . n A 1 174 THR 174 174 174 THR THR A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 MET 177 177 177 MET MET A . n A 1 178 ASP 178 178 178 ASP ASP A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 HIS 182 182 182 HIS HIS A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 TYR 184 184 184 TYR TYR A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 THR 187 187 187 THR THR A . n A 1 188 GLY 188 188 188 GLY GLY A . n A 1 189 ASP 189 189 189 ASP ASP A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 GLN 193 193 193 GLN GLN A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 ASN 200 200 200 ASN ASN A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 SER 202 202 202 SER SER A . n A 1 203 HIS 203 203 203 HIS HIS A . n A 1 204 MET 204 204 204 MET MET A . n A 1 205 PRO 205 205 205 PRO PRO A . n A 1 206 TYR 206 206 206 TYR TYR A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 LYS 208 208 208 LYS LYS A . n A 1 209 SER 209 209 209 SER SER A . n A 1 210 PRO 210 210 210 PRO PRO A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 GLU 216 216 216 GLU GLU A . n A 1 217 CYS 217 217 217 CYS CYS A . n A 1 218 LYS 218 218 218 LYS LYS A . n A 1 219 ASP 219 219 219 ASP ASP A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 ARG 221 221 221 ARG ARG A . n A 1 222 ILE 222 222 222 ILE ILE A . n A 1 223 PHE 223 223 223 PHE PHE A . n A 1 224 SER 224 224 224 SER SER A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 SER 226 226 226 SER SER A . n A 1 227 TYR 227 227 227 TYR TYR A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 GLU 229 229 229 GLU GLU A . n A 1 230 ASN 230 230 230 ASN ASN A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 ALA 232 232 232 ALA ALA A . n A 1 233 PHE 233 233 233 PHE PHE A . n A 1 234 ASN 234 234 234 ASN ASN A . n A 1 235 PRO 235 235 235 PRO PRO A . n A 1 236 THR 236 236 236 THR THR A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 PRO 238 238 238 PRO PRO A . n A 1 239 PRO 239 239 239 PRO PRO A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 GLN 241 241 241 GLN GLN A . n A 1 242 GLY 242 242 242 GLY GLY A . n A 1 243 ALA 243 243 243 ALA ALA A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 ILE 245 245 245 ILE ILE A . n A 1 246 LEU 246 246 246 LEU LEU A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 ASN 248 248 248 ASN ASN A . n A 1 249 LEU 249 249 249 LEU LEU A . n A 1 250 LYS 250 250 250 LYS LYS A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 TYR 252 252 252 TYR TYR A . n A 1 253 ASP 253 253 253 ASP ASP A . n A 1 254 TYR 254 254 254 TYR TYR A . n A 1 255 PRO 255 255 255 PRO PRO A . n A 1 256 ASP 256 256 256 ASP ASP A . n A 1 257 ILE 257 257 257 ILE ILE A . n A 1 258 GLN 258 258 258 GLN GLN A . n A 1 259 ARG 259 259 259 ARG ARG A . n A 1 260 ALA 260 260 260 ALA ALA A . n A 1 261 VAL 261 261 261 VAL VAL A . n A 1 262 LEU 262 262 262 LEU LEU A . n A 1 263 ALA 263 263 263 ALA ALA A . n A 1 264 GLU 264 264 264 GLU GLU A . n A 1 265 LYS 265 265 265 LYS LYS A . n A 1 266 ALA 266 266 266 ALA ALA A . n A 1 267 ASP 267 267 267 ASP ASP A . n A 1 268 ALA 268 268 268 ALA ALA A . n A 1 269 PRO 269 269 269 PRO PRO A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 ILE 271 271 271 ILE ILE A . n A 1 272 GLN 272 272 272 GLN GLN A . n A 1 273 TRP 273 273 273 TRP TRP A . n A 1 274 ASP 274 274 274 ASP ASP A . n A 1 275 ALA 275 275 275 ALA ALA A . n A 1 276 THR 276 276 276 THR THR A . n A 1 277 SER 277 277 277 SER SER A . n A 1 278 ALA 278 278 278 ALA ALA A . n A 1 279 THR 279 279 279 THR THR A . n A 1 280 LEU 280 280 280 LEU LEU A . n A 1 281 LYS 281 281 281 LYS LYS A . n A 1 282 ALA 282 282 282 ALA ALA A . n A 1 283 LEU 283 283 283 LEU LEU A . n A 1 284 GLY 284 284 284 GLY GLY A . n A 1 285 CYS 285 285 285 CYS CYS A . n A 1 286 HIS 286 286 286 HIS HIS A . n A 1 287 SER 287 287 287 SER SER A . n A 1 288 ILE 288 288 288 ILE ILE A . n A 1 289 ASP 289 289 289 ASP ASP A . n A 1 290 ARG 290 290 290 ARG ARG A . n A 1 291 VAL 291 291 291 VAL VAL A . n A 1 292 LEU 292 292 292 LEU LEU A . n A 1 293 LEU 293 293 293 LEU LEU A . n A 1 294 ALA 294 294 294 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 296 296 ZN ZN A . C 3 CTD 1 295 295 CTD CTD A . D 4 HOH 1 503 503 HOH HOH A . D 4 HOH 2 505 505 HOH HOH A . D 4 HOH 3 506 506 HOH HOH A . D 4 HOH 4 509 509 HOH HOH A . D 4 HOH 5 511 511 HOH HOH A . D 4 HOH 6 515 515 HOH HOH A . D 4 HOH 7 516 516 HOH HOH A . D 4 HOH 8 517 517 HOH HOH A . D 4 HOH 9 518 518 HOH HOH A . D 4 HOH 10 522 522 HOH HOH A . D 4 HOH 11 525 525 HOH HOH A . D 4 HOH 12 526 526 HOH HOH A . D 4 HOH 13 527 527 HOH HOH A . D 4 HOH 14 528 528 HOH HOH A . D 4 HOH 15 531 531 HOH HOH A . D 4 HOH 16 533 533 HOH HOH A . D 4 HOH 17 536 536 HOH HOH A . D 4 HOH 18 538 538 HOH HOH A . D 4 HOH 19 539 539 HOH HOH A . D 4 HOH 20 540 540 HOH HOH A . D 4 HOH 21 541 541 HOH HOH A . D 4 HOH 22 542 542 HOH HOH A . D 4 HOH 23 550 550 HOH HOH A . D 4 HOH 24 555 555 HOH HOH A . D 4 HOH 25 557 557 HOH HOH A . D 4 HOH 26 558 558 HOH HOH A . D 4 HOH 27 560 560 HOH HOH A . D 4 HOH 28 561 561 HOH HOH A . D 4 HOH 29 562 562 HOH HOH A . D 4 HOH 30 563 563 HOH HOH A . D 4 HOH 31 564 564 HOH HOH A . D 4 HOH 32 565 565 HOH HOH A . D 4 HOH 33 566 566 HOH HOH A . D 4 HOH 34 568 568 HOH HOH A . D 4 HOH 35 569 569 HOH HOH A . D 4 HOH 36 573 573 HOH HOH A . D 4 HOH 37 575 575 HOH HOH A . D 4 HOH 38 601 601 HOH HOH A . D 4 HOH 39 602 602 HOH HOH A . D 4 HOH 40 603 603 HOH HOH A . D 4 HOH 41 604 604 HOH HOH A . D 4 HOH 42 605 605 HOH HOH A . D 4 HOH 43 607 607 HOH HOH A . D 4 HOH 44 610 610 HOH HOH A . D 4 HOH 45 611 611 HOH HOH A . D 4 HOH 46 613 613 HOH HOH A . D 4 HOH 47 615 615 HOH HOH A . D 4 HOH 48 616 616 HOH HOH A . D 4 HOH 49 700 700 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5390 ? 1 MORE -98 ? 1 'SSA (A^2)' 19280 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 102 ? A HIS 102 ? 1_555 ZN ? B ZN . ? A ZN 296 ? 1_555 SG ? A CYS 129 ? A CYS 129 ? 1_555 103.3 ? 2 ND1 ? A HIS 102 ? A HIS 102 ? 1_555 ZN ? B ZN . ? A ZN 296 ? 1_555 SG ? A CYS 132 ? A CYS 132 ? 1_555 113.2 ? 3 SG ? A CYS 129 ? A CYS 129 ? 1_555 ZN ? B ZN . ? A ZN 296 ? 1_555 SG ? A CYS 132 ? A CYS 132 ? 1_555 107.4 ? 4 ND1 ? A HIS 102 ? A HIS 102 ? 1_555 ZN ? B ZN . ? A ZN 296 ? 1_555 O ? D HOH . ? A HOH 700 ? 1_555 113.7 ? 5 SG ? A CYS 129 ? A CYS 129 ? 1_555 ZN ? B ZN . ? A ZN 296 ? 1_555 O ? D HOH . ? A HOH 700 ? 1_555 104.3 ? 6 SG ? A CYS 132 ? A CYS 132 ? 1_555 ZN ? B ZN . ? A ZN 296 ? 1_555 O ? D HOH . ? A HOH 700 ? 1_555 113.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-09-17 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2016-09-28 5 'Structure model' 1 4 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' Other 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' Other 8 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_database_status 3 5 'Structure model' pdbx_initial_refinement_model 4 5 'Structure model' struct_conn 5 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_database_status.process_site' 4 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 17 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 18 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.0 ? 1 X-PLOR refinement 3.0 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 X-PLOR phasing 3.0 ? 5 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE2 A HIS 2 ? ? CD2 A HIS 2 ? ? 1.303 1.373 -0.070 0.011 N 2 1 NE2 A HIS 148 ? ? CD2 A HIS 148 ? ? 1.299 1.373 -0.074 0.011 N 3 1 NE2 A HIS 155 ? ? CD2 A HIS 155 ? ? 1.304 1.373 -0.069 0.011 N 4 1 NE2 A HIS 182 ? ? CD2 A HIS 182 ? ? 1.291 1.373 -0.082 0.011 N 5 1 NE2 A HIS 286 ? ? CD2 A HIS 286 ? ? 1.306 1.373 -0.067 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH2 A ARG 65 ? ? 115.35 120.30 -4.95 0.50 N 2 1 NE A ARG 78 ? ? CZ A ARG 78 ? ? NH2 A ARG 78 ? ? 115.80 120.30 -4.50 0.50 N 3 1 CD1 A TRP 84 ? ? CG A TRP 84 ? ? CD2 A TRP 84 ? ? 112.08 106.30 5.78 0.80 N 4 1 CE2 A TRP 84 ? ? CD2 A TRP 84 ? ? CG A TRP 84 ? ? 102.20 107.30 -5.10 0.80 N 5 1 CD1 A TRP 112 ? ? CG A TRP 112 ? ? CD2 A TRP 112 ? ? 112.05 106.30 5.75 0.80 N 6 1 CE2 A TRP 112 ? ? CD2 A TRP 112 ? ? CG A TRP 112 ? ? 102.33 107.30 -4.97 0.80 N 7 1 NE A ARG 201 ? ? CZ A ARG 201 ? ? NH1 A ARG 201 ? ? 123.63 120.30 3.33 0.50 N 8 1 CD1 A TRP 273 ? ? CG A TRP 273 ? ? CD2 A TRP 273 ? ? 112.94 106.30 6.64 0.80 N 9 1 CE2 A TRP 273 ? ? CD2 A TRP 273 ? ? CG A TRP 273 ? ? 101.16 107.30 -6.14 0.80 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 30 ? ? -77.70 20.99 2 1 ALA A 95 ? ? -101.86 -146.63 3 1 MET A 177 ? ? 86.21 1.91 4 1 MET A 204 ? ? -141.62 49.43 5 1 PHE A 233 ? ? 57.34 -69.06 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 3-DEAZACYTIDINE CTD 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1CTU _pdbx_initial_refinement_model.details 'PDB ENTRY 1CTU' #