data_1APO # _entry.id 1APO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1APO WWPDB D_1000171103 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1APO _pdbx_database_status.recvd_initial_deposition_date 1992-04-21 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ullner, M.' 1 'Selander, M.' 2 'Persson, E.' 3 'Stenflo, J.' 4 'Drakenberg, T.' 5 'Teleman, O.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Three-dimensional structure of the apo form of the N-terminal EGF-like module of blood coagulation factor X as determined by NMR spectroscopy and simulated folding. ; Biochemistry 31 5974 5983 1992 BICHAW US 0006-2960 0033 ? 1627540 10.1021/bi00141a004 1 ;1H NMR Assignment and Secondary Structure of the Ca2+-Free Form of the Amino-Terminal Epidermal Growth Factor Like Domain in Coagulation Factor X ; Biochemistry 29 8111 ? 1990 BICHAW US 0006-2960 0033 ? ? ? 2 'Calcium Binding to the Isolated Beta-Hydroxyaspartic Acid-Containing Epidermal Growth Factor-Like Domain of Bovine Factor X' J.Biol.Chem. 264 16897 ? 1989 JBCHA3 US 0021-9258 0071 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ullner, M.' 1 primary 'Selander, M.' 2 primary 'Persson, E.' 3 primary 'Stenflo, J.' 4 primary 'Drakenberg, T.' 5 primary 'Teleman, O.' 6 1 'Selander, M.' 7 1 'Persson, E.' 8 1 'Stenflo, J.' 9 1 'Drakenberg, T.' 10 2 'Persson, E.' 11 2 'Selander, M.' 12 2 'Linse, S.' 13 2 'Drakenberg, T.' 14 2 'Ohlin, A.-K.' 15 # _cell.entry_id 1APO _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1APO _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'EGF-LIKE MODULE OF BLOOD COAGULATION FACTOR X' 4560.949 1 ? ? ? ? 2 non-polymer syn 'HYDROXIDE ION' 17.007 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFEGKNCEFSTR _entity_poly.pdbx_seq_one_letter_code_can KDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFEGKNCEFSTR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 ASP n 1 3 GLY n 1 4 ASP n 1 5 GLN n 1 6 CYS n 1 7 GLU n 1 8 GLY n 1 9 HIS n 1 10 PRO n 1 11 CYS n 1 12 LEU n 1 13 ASN n 1 14 GLN n 1 15 GLY n 1 16 HIS n 1 17 CYS n 1 18 LYS n 1 19 ASP n 1 20 GLY n 1 21 ILE n 1 22 GLY n 1 23 ASP n 1 24 TYR n 1 25 THR n 1 26 CYS n 1 27 THR n 1 28 CYS n 1 29 ALA n 1 30 GLU n 1 31 GLY n 1 32 PHE n 1 33 GLU n 1 34 GLY n 1 35 LYS n 1 36 ASN n 1 37 CYS n 1 38 GLU n 1 39 PHE n 1 40 SER n 1 41 THR n 1 42 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus Bos _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FA10_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00743 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MAGLLHLVLLSTALGGLLRPAGSVFLPRDQAHRVLQRARRANSFLEEVKQGNLERECLEEACSLEEAREVFEDAEQTDEF WSKYKDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFEGKNCEFSTREICSLDNGGCDQFCREERSEVRCSCAHGYVLGDD SKSCVSTERFPCGKFTQGRSRRWAIHTSEDALDASELEHYDPADLSPTESSLDLLGLNRTEPSAGEDGSQVVRIVGGRDC AEGECPWQALLVNEENEGFCGGTILNEFYVLTAAHCLHQAKRFTVRVGDRNTEQEEGNEMAHEVEMTVKHSRFVKETYDF DIAVLRLKTPIRFRRNVAPACLPEKDWAEATLMTQKTGIVSGFGRTHEKGRLSSTLKMLEVPYVDRSTCKLSSSFTITPN MFCAGYDTQPEDACQGDSGGPHVTRFKDTYFVTGIVSWGEGCARKGKFGVYTKVSNFLKWIDKIMKARAGAAGSRGHSEA PATWTVPPPLPL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1APO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 42 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00743 _struct_ref_seq.db_align_beg 85 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 126 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 45 _struct_ref_seq.pdbx_auth_seq_align_end 86 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 OH non-polymer . 'HYDROXIDE ION' ? 'H O -1' 17.007 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # _pdbx_nmr_ensemble.entry_id 1APO _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 13 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _exptl.entry_id 1APO _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1APO _struct.title ;THREE-DIMENSIONAL STRUCTURE OF THE APO FORM OF THE N-TERMINAL EGF-LIKE MODULE OF BLOOD COAGULATION FACTOR X AS DETERMINED BY NMR SPECTROSCOPY AND SIMULATED FOLDING ; _struct.pdbx_descriptor 'EGF-LIKE MODULE OF BLOOD COAGULATION FACTOR X (N-TERMINAL, APO FORM) (NMR, 13 STRUCTURES)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1APO _struct_keywords.pdbx_keywords 'COAGULATION FACTOR' _struct_keywords.text 'COAGULATION FACTOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 17 SG ? ? A CYS 50 A CYS 61 1_555 ? ? ? ? ? ? ? 2.383 ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 55 A CYS 70 1_555 ? ? ? ? ? ? ? 2.379 ? disulf3 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 72 A CYS 81 1_555 ? ? ? ? ? ? ? 2.501 ? covale1 covale ? ? A ASP 19 CB ? ? ? 1_555 B OH . O ? ? A ASP 63 A OH 87 1_555 ? ? ? ? ? ? ? 1.458 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details S1 ? 2 ? S2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 GLY A 15 ? ASP A 19 ? GLY A 59 ASP A 63 S1 2 TYR A 24 ? CYS A 28 ? TYR A 68 CYS A 72 S2 1 PHE A 32 ? GLU A 33 ? PHE A 76 GLU A 77 S2 2 PHE A 39 ? SER A 40 ? PHE A 83 SER A 84 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE OH A 87' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ASP A 19 ? ASP A 63 . ? 1_555 ? 2 AC1 2 GLY A 20 ? GLY A 64 . ? 1_555 ? # _database_PDB_matrix.entry_id 1APO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1APO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_sites_footnote.id _atom_sites_footnote.text 1 'GLU 82 - PHE 83 MODEL 5 OMEGA =211.97 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 2 'GLU 82 - PHE 83 MODEL 11 OMEGA =210.27 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 3 'GLU 82 - PHE 83 MODEL 12 OMEGA =210.45 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 45 45 LYS LYS A . n A 1 2 ASP 2 46 46 ASP ASP A . n A 1 3 GLY 3 47 47 GLY GLY A . n A 1 4 ASP 4 48 48 ASP ASP A . n A 1 5 GLN 5 49 49 GLN GLN A . n A 1 6 CYS 6 50 50 CYS CYS A . n A 1 7 GLU 7 51 51 GLU GLU A . n A 1 8 GLY 8 52 52 GLY GLY A . n A 1 9 HIS 9 53 53 HIS HIS A . n A 1 10 PRO 10 54 54 PRO PRO A . n A 1 11 CYS 11 55 55 CYS CYS A . n A 1 12 LEU 12 56 56 LEU LEU A . n A 1 13 ASN 13 57 57 ASN ASN A . n A 1 14 GLN 14 58 58 GLN GLN A . n A 1 15 GLY 15 59 59 GLY GLY A . n A 1 16 HIS 16 60 60 HIS HIS A . n A 1 17 CYS 17 61 61 CYS CYS A . n A 1 18 LYS 18 62 62 LYS LYS A . n A 1 19 ASP 19 63 63 ASP ASP A . n A 1 20 GLY 20 64 64 GLY GLY A . n A 1 21 ILE 21 65 65 ILE ILE A . n A 1 22 GLY 22 66 66 GLY GLY A . n A 1 23 ASP 23 67 67 ASP ASP A . n A 1 24 TYR 24 68 68 TYR TYR A . n A 1 25 THR 25 69 69 THR THR A . n A 1 26 CYS 26 70 70 CYS CYS A . n A 1 27 THR 27 71 71 THR THR A . n A 1 28 CYS 28 72 72 CYS CYS A . n A 1 29 ALA 29 73 73 ALA ALA A . n A 1 30 GLU 30 74 74 GLU GLU A . n A 1 31 GLY 31 75 75 GLY GLY A . n A 1 32 PHE 32 76 76 PHE PHE A . n A 1 33 GLU 33 77 77 GLU GLU A . n A 1 34 GLY 34 78 78 GLY GLY A . n A 1 35 LYS 35 79 79 LYS LYS A . n A 1 36 ASN 36 80 80 ASN ASN A . n A 1 37 CYS 37 81 81 CYS CYS A . n A 1 38 GLU 38 82 82 GLU GLU A . n A 1 39 PHE 39 83 83 PHE PHE A . n A 1 40 SER 40 84 84 SER SER A . n A 1 41 THR 41 85 85 THR THR A . n A 1 42 ARG 42 86 86 ARG ARG A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id OH _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 87 _pdbx_nonpoly_scheme.auth_seq_num 63 _pdbx_nonpoly_scheme.pdb_mon_id OH _pdbx_nonpoly_scheme.auth_mon_id OH _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-01-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG3 A GLU 77 ? ? HE1 A PHE 83 ? ? 0.92 2 1 CG A GLU 77 ? ? HE1 A PHE 83 ? ? 1.19 3 1 HG3 A GLU 77 ? ? CE1 A PHE 83 ? ? 1.20 4 1 CB A GLU 77 ? ? HE1 A PHE 83 ? ? 1.52 5 1 CG A GLU 77 ? ? CE1 A PHE 83 ? ? 2.09 6 3 O A LEU 56 ? ? H A GLY 59 ? ? 1.56 7 5 HG3 A GLU 77 ? ? HE1 A PHE 83 ? ? 1.23 8 5 O A GLU 77 ? ? N A GLU 82 ? ? 2.13 9 9 O A LYS 62 ? ? O A OH 87 ? ? 2.19 10 10 HG3 A GLU 77 ? ? HE1 A PHE 83 ? ? 1.03 11 10 CG A GLU 77 ? ? HE1 A PHE 83 ? ? 1.47 12 10 HG3 A GLU 77 ? ? CE1 A PHE 83 ? ? 1.50 13 10 H A GLU 77 ? ? O A PHE 83 ? ? 1.58 14 11 HG3 A GLU 77 ? ? HE1 A PHE 83 ? ? 1.04 15 11 CG A GLU 77 ? ? HE1 A PHE 83 ? ? 1.37 16 11 HG3 A GLU 77 ? ? CE1 A PHE 83 ? ? 1.44 17 12 HG3 A GLU 77 ? ? HE1 A PHE 83 ? ? 0.91 18 12 CG A GLU 77 ? ? HE1 A PHE 83 ? ? 1.27 19 12 HG3 A GLU 77 ? ? CE1 A PHE 83 ? ? 1.30 20 12 O A ASP 48 ? ? N A CYS 50 ? ? 2.17 21 12 CG A GLU 77 ? ? CE1 A PHE 83 ? ? 2.18 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A PHE 83 ? ? CG A PHE 83 ? ? 1.396 1.509 -0.113 0.017 N 2 1 CG A PHE 83 ? ? CD1 A PHE 83 ? ? 1.215 1.383 -0.168 0.015 N 3 2 CG A HIS 53 ? ? ND1 A HIS 53 ? ? 1.275 1.369 -0.094 0.015 N 4 2 CG A HIS 60 ? ? ND1 A HIS 60 ? ? 1.275 1.369 -0.094 0.015 N 5 3 CG A HIS 53 ? ? ND1 A HIS 53 ? ? 1.246 1.369 -0.123 0.015 N 6 3 CG A HIS 60 ? ? ND1 A HIS 60 ? ? 1.270 1.369 -0.099 0.015 N 7 4 CG A HIS 53 ? ? ND1 A HIS 53 ? ? 1.273 1.369 -0.096 0.015 N 8 4 CG A HIS 60 ? ? ND1 A HIS 60 ? ? 1.255 1.369 -0.114 0.015 N 9 5 CG A HIS 60 ? ? ND1 A HIS 60 ? ? 1.272 1.369 -0.097 0.015 N 10 5 CG A PHE 83 ? ? CD1 A PHE 83 ? ? 1.212 1.383 -0.171 0.015 N 11 6 CG A HIS 53 ? ? ND1 A HIS 53 ? ? 1.266 1.369 -0.103 0.015 N 12 6 CG A HIS 60 ? ? ND1 A HIS 60 ? ? 1.273 1.369 -0.096 0.015 N 13 7 CG A HIS 53 ? ? ND1 A HIS 53 ? ? 1.266 1.369 -0.103 0.015 N 14 7 CG A HIS 60 ? ? ND1 A HIS 60 ? ? 1.269 1.369 -0.100 0.015 N 15 7 CD A GLU 82 ? ? OE2 A GLU 82 ? ? 1.182 1.252 -0.070 0.011 N 16 8 CG A HIS 53 ? ? ND1 A HIS 53 ? ? 1.271 1.369 -0.098 0.015 N 17 8 CG A HIS 60 ? ? ND1 A HIS 60 ? ? 1.264 1.369 -0.105 0.015 N 18 9 CG A HIS 53 ? ? ND1 A HIS 53 ? ? 1.262 1.369 -0.107 0.015 N 19 10 CG A HIS 53 ? ? ND1 A HIS 53 ? ? 1.270 1.369 -0.099 0.015 N 20 10 CB A PHE 83 ? ? CG A PHE 83 ? ? 1.376 1.509 -0.133 0.017 N 21 10 CG A PHE 83 ? ? CD1 A PHE 83 ? ? 1.156 1.383 -0.227 0.015 N 22 11 N A GLY 47 ? ? CA A GLY 47 ? ? 1.356 1.456 -0.100 0.015 N 23 11 CG A HIS 53 ? ? ND1 A HIS 53 ? ? 1.264 1.369 -0.105 0.015 N 24 11 CG A HIS 60 ? ? ND1 A HIS 60 ? ? 1.257 1.369 -0.112 0.015 N 25 11 CB A PHE 83 ? ? CG A PHE 83 ? ? 1.384 1.509 -0.125 0.017 N 26 11 CG A PHE 83 ? ? CD1 A PHE 83 ? ? 1.192 1.383 -0.191 0.015 N 27 12 CG A HIS 53 ? ? ND1 A HIS 53 ? ? 1.276 1.369 -0.093 0.015 N 28 12 CG A HIS 60 ? ? ND1 A HIS 60 ? ? 1.278 1.369 -0.091 0.015 N 29 12 CG A PHE 83 ? ? CD1 A PHE 83 ? ? 1.194 1.383 -0.189 0.015 N 30 13 CG A HIS 53 ? ? ND1 A HIS 53 ? ? 1.276 1.369 -0.093 0.015 N 31 13 NE A ARG 86 ? ? CZ A ARG 86 ? ? 1.219 1.326 -0.107 0.013 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 ND1 A HIS 53 ? ? CG A HIS 53 ? ? CD2 A HIS 53 ? ? 117.37 108.80 8.57 1.40 N 2 1 ND1 A HIS 60 ? ? CG A HIS 60 ? ? CD2 A HIS 60 ? ? 117.61 108.80 8.81 1.40 N 3 1 CB A PHE 83 ? ? CG A PHE 83 ? ? CD2 A PHE 83 ? ? 126.40 120.80 5.60 0.70 N 4 1 CB A PHE 83 ? ? CG A PHE 83 ? ? CD1 A PHE 83 ? ? 106.78 120.80 -14.02 0.70 N 5 2 ND1 A HIS 53 ? ? CG A HIS 53 ? ? CD2 A HIS 53 ? ? 117.35 108.80 8.55 1.40 N 6 2 ND1 A HIS 60 ? ? CG A HIS 60 ? ? CD2 A HIS 60 ? ? 118.45 108.80 9.65 1.40 N 7 3 ND1 A HIS 53 ? ? CG A HIS 53 ? ? CD2 A HIS 53 ? ? 117.89 108.80 9.09 1.40 N 8 3 CB A HIS 60 ? ? CG A HIS 60 ? ? ND1 A HIS 60 ? ? 112.43 121.40 -8.97 1.30 N 9 3 NE A ARG 86 ? ? CZ A ARG 86 ? ? NH2 A ARG 86 ? ? 116.53 120.30 -3.77 0.50 N 10 4 ND1 A HIS 53 ? ? CG A HIS 53 ? ? CD2 A HIS 53 ? ? 117.58 108.80 8.78 1.40 N 11 5 ND1 A HIS 53 ? ? CG A HIS 53 ? ? CD2 A HIS 53 ? ? 117.40 108.80 8.60 1.40 N 12 5 CB A HIS 53 ? ? CG A HIS 53 ? ? ND1 A HIS 53 ? ? 112.04 121.40 -9.36 1.30 N 13 5 CB A HIS 60 ? ? CG A HIS 60 ? ? ND1 A HIS 60 ? ? 113.52 121.40 -7.88 1.30 N 14 5 CB A PHE 83 ? ? CG A PHE 83 ? ? CD2 A PHE 83 ? ? 126.93 120.80 6.13 0.70 N 15 5 CB A PHE 83 ? ? CG A PHE 83 ? ? CD1 A PHE 83 ? ? 106.60 120.80 -14.20 0.70 N 16 6 ND1 A HIS 53 ? ? CG A HIS 53 ? ? CD2 A HIS 53 ? ? 118.61 108.80 9.81 1.40 N 17 6 CB A HIS 53 ? ? CG A HIS 53 ? ? ND1 A HIS 53 ? ? 113.42 121.40 -7.98 1.30 N 18 6 ND1 A HIS 60 ? ? CG A HIS 60 ? ? CD2 A HIS 60 ? ? 117.56 108.80 8.76 1.40 N 19 7 ND1 A HIS 53 ? ? CG A HIS 53 ? ? CD2 A HIS 53 ? ? 117.24 108.80 8.44 1.40 N 20 7 ND1 A HIS 60 ? ? CG A HIS 60 ? ? CD2 A HIS 60 ? ? 117.58 108.80 8.78 1.40 N 21 8 ND1 A HIS 53 ? ? CG A HIS 53 ? ? CD2 A HIS 53 ? ? 118.26 108.80 9.46 1.40 N 22 8 CD A ARG 86 ? ? NE A ARG 86 ? ? CZ A ARG 86 ? ? 114.89 123.60 -8.71 1.40 N 23 8 NE A ARG 86 ? ? CZ A ARG 86 ? ? NH1 A ARG 86 ? ? 126.52 120.30 6.22 0.50 N 24 9 CB A HIS 53 ? ? CG A HIS 53 ? ? ND1 A HIS 53 ? ? 113.27 121.40 -8.13 1.30 N 25 9 ND1 A HIS 60 ? ? CG A HIS 60 ? ? CD2 A HIS 60 ? ? 117.97 108.80 9.17 1.40 N 26 10 ND1 A HIS 53 ? ? CG A HIS 53 ? ? CD2 A HIS 53 ? ? 117.34 108.80 8.54 1.40 N 27 10 ND1 A HIS 60 ? ? CG A HIS 60 ? ? CD2 A HIS 60 ? ? 117.60 108.80 8.80 1.40 N 28 10 CB A PHE 83 ? ? CG A PHE 83 ? ? CD2 A PHE 83 ? ? 127.08 120.80 6.28 0.70 N 29 10 CB A PHE 83 ? ? CG A PHE 83 ? ? CD1 A PHE 83 ? ? 104.65 120.80 -16.15 0.70 N 30 10 NE A ARG 86 ? ? CZ A ARG 86 ? ? NH2 A ARG 86 ? ? 116.62 120.30 -3.68 0.50 N 31 11 ND1 A HIS 60 ? ? CG A HIS 60 ? ? CD2 A HIS 60 ? ? 117.92 108.80 9.12 1.40 N 32 11 CB A PHE 83 ? ? CG A PHE 83 ? ? CD2 A PHE 83 ? ? 125.61 120.80 4.81 0.70 N 33 11 CB A PHE 83 ? ? CG A PHE 83 ? ? CD1 A PHE 83 ? ? 106.79 120.80 -14.01 0.70 N 34 12 CB A PHE 83 ? ? CG A PHE 83 ? ? CD1 A PHE 83 ? ? 107.08 120.80 -13.72 0.70 N 35 13 CB A ASP 46 ? ? CG A ASP 46 ? ? OD2 A ASP 46 ? ? 112.75 118.30 -5.55 0.90 N 36 13 NH1 A ARG 86 ? ? CZ A ARG 86 ? ? NH2 A ARG 86 ? ? 112.54 119.40 -6.86 1.10 N 37 13 NE A ARG 86 ? ? CZ A ARG 86 ? ? NH1 A ARG 86 ? ? 123.81 120.30 3.51 0.50 N 38 13 NE A ARG 86 ? ? CZ A ARG 86 ? ? NH2 A ARG 86 ? ? 123.56 120.30 3.26 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 49 ? ? 46.53 7.05 2 1 HIS A 53 ? ? 9.25 91.99 3 1 GLN A 58 ? ? 46.83 26.86 4 1 LYS A 62 ? ? -90.00 -141.60 5 1 ILE A 65 ? ? -88.76 30.08 6 1 ASP A 67 ? ? 73.81 137.21 7 1 TYR A 68 ? ? -78.25 -165.16 8 1 GLU A 77 ? ? -155.03 -146.31 9 2 ASP A 48 ? ? -97.15 52.56 10 2 CYS A 50 ? ? -143.22 19.88 11 2 HIS A 53 ? ? 51.29 90.33 12 2 GLN A 58 ? ? 49.73 29.20 13 2 TYR A 68 ? ? -77.40 -166.19 14 2 CYS A 81 ? ? 86.48 18.67 15 2 THR A 85 ? ? 43.87 19.95 16 3 ASP A 48 ? ? -110.64 58.73 17 3 HIS A 53 ? ? 10.61 92.63 18 3 CYS A 81 ? ? 82.51 17.44 19 4 HIS A 53 ? ? -173.12 96.67 20 4 LYS A 62 ? ? -123.30 -144.35 21 4 ASP A 67 ? ? -176.58 141.14 22 5 HIS A 53 ? ? -172.30 94.48 23 5 GLU A 77 ? ? -155.84 -146.72 24 5 THR A 85 ? ? 37.14 28.55 25 6 GLN A 49 ? ? 42.21 6.78 26 6 HIS A 53 ? ? 44.48 84.20 27 6 ILE A 65 ? ? 36.27 36.49 28 6 ASP A 67 ? ? 67.57 116.78 29 6 TYR A 68 ? ? -76.70 -169.90 30 6 THR A 85 ? ? 40.03 20.87 31 7 HIS A 53 ? ? 13.98 88.47 32 7 THR A 85 ? ? 46.10 22.95 33 8 GLN A 49 ? ? 43.29 4.91 34 8 CYS A 50 ? ? -112.53 54.97 35 8 GLU A 51 ? ? -40.61 163.93 36 8 HIS A 53 ? ? -174.26 93.03 37 8 LYS A 62 ? ? -103.29 -132.75 38 8 THR A 85 ? ? 44.29 16.15 39 9 ASP A 48 ? ? -166.43 29.73 40 9 CYS A 50 ? ? -163.87 14.32 41 9 HIS A 53 ? ? 39.65 91.50 42 9 ASP A 63 ? ? 63.22 146.28 43 9 ALA A 73 ? ? 115.88 162.28 44 9 CYS A 81 ? ? 94.10 26.94 45 9 THR A 85 ? ? 47.54 5.33 46 10 ASP A 48 ? ? -119.44 66.67 47 10 CYS A 50 ? ? -145.23 -22.75 48 10 HIS A 53 ? ? 44.30 82.18 49 10 ASP A 67 ? ? 68.08 153.51 50 10 GLU A 77 ? ? -143.20 -145.86 51 10 THR A 85 ? ? -178.29 -49.08 52 11 ASP A 46 ? ? -100.20 -65.56 53 11 HIS A 53 ? ? 50.52 86.13 54 11 TYR A 68 ? ? -78.56 -164.71 55 11 GLU A 77 ? ? -154.73 -151.95 56 12 GLN A 49 ? ? 41.99 6.58 57 12 HIS A 53 ? ? 48.08 90.74 58 12 GLU A 74 ? ? -50.62 109.85 59 12 GLU A 77 ? ? -157.15 -145.52 60 13 ASP A 48 ? ? -96.09 39.26 61 13 CYS A 50 ? ? -154.69 23.07 62 13 HIS A 53 ? ? 49.84 83.12 63 13 ASP A 67 ? ? 73.13 134.62 64 13 ALA A 73 ? ? 119.75 165.29 65 13 CYS A 81 ? ? 92.18 27.25 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 5 GLU A 82 ? ? PHE A 83 ? ? -148.03 2 11 GLU A 82 ? ? PHE A 83 ? ? -149.73 3 12 GLU A 82 ? ? PHE A 83 ? ? -149.55 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 LYS A 45 ? ? 10.17 2 4 LYS A 45 ? ? 10.05 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 HIS A 53 ? ? 0.138 'SIDE CHAIN' 2 1 HIS A 60 ? ? 0.176 'SIDE CHAIN' 3 1 TYR A 68 ? ? 0.090 'SIDE CHAIN' 4 1 PHE A 83 ? ? 0.325 'SIDE CHAIN' 5 2 HIS A 53 ? ? 0.155 'SIDE CHAIN' 6 2 HIS A 60 ? ? 0.107 'SIDE CHAIN' 7 2 TYR A 68 ? ? 0.109 'SIDE CHAIN' 8 3 HIS A 53 ? ? 0.124 'SIDE CHAIN' 9 3 HIS A 60 ? ? 0.178 'SIDE CHAIN' 10 3 TYR A 68 ? ? 0.132 'SIDE CHAIN' 11 4 HIS A 53 ? ? 0.162 'SIDE CHAIN' 12 4 HIS A 60 ? ? 0.170 'SIDE CHAIN' 13 4 TYR A 68 ? ? 0.108 'SIDE CHAIN' 14 5 HIS A 53 ? ? 0.166 'SIDE CHAIN' 15 5 HIS A 60 ? ? 0.158 'SIDE CHAIN' 16 5 TYR A 68 ? ? 0.107 'SIDE CHAIN' 17 5 PHE A 83 ? ? 0.320 'SIDE CHAIN' 18 6 HIS A 53 ? ? 0.158 'SIDE CHAIN' 19 6 HIS A 60 ? ? 0.177 'SIDE CHAIN' 20 6 TYR A 68 ? ? 0.075 'SIDE CHAIN' 21 7 HIS A 53 ? ? 0.154 'SIDE CHAIN' 22 7 HIS A 60 ? ? 0.152 'SIDE CHAIN' 23 7 TYR A 68 ? ? 0.098 'SIDE CHAIN' 24 8 HIS A 53 ? ? 0.159 'SIDE CHAIN' 25 8 HIS A 60 ? ? 0.157 'SIDE CHAIN' 26 8 TYR A 68 ? ? 0.109 'SIDE CHAIN' 27 9 HIS A 53 ? ? 0.174 'SIDE CHAIN' 28 9 HIS A 60 ? ? 0.157 'SIDE CHAIN' 29 9 TYR A 68 ? ? 0.112 'SIDE CHAIN' 30 10 HIS A 53 ? ? 0.172 'SIDE CHAIN' 31 10 HIS A 60 ? ? 0.165 'SIDE CHAIN' 32 10 TYR A 68 ? ? 0.110 'SIDE CHAIN' 33 10 PHE A 76 ? ? 0.078 'SIDE CHAIN' 34 10 PHE A 83 ? ? 0.300 'SIDE CHAIN' 35 11 HIS A 53 ? ? 0.160 'SIDE CHAIN' 36 11 HIS A 60 ? ? 0.140 'SIDE CHAIN' 37 11 TYR A 68 ? ? 0.062 'SIDE CHAIN' 38 11 PHE A 83 ? ? 0.316 'SIDE CHAIN' 39 12 HIS A 53 ? ? 0.166 'SIDE CHAIN' 40 12 HIS A 60 ? ? 0.165 'SIDE CHAIN' 41 12 TYR A 68 ? ? 0.086 'SIDE CHAIN' 42 12 PHE A 83 ? ? 0.320 'SIDE CHAIN' 43 13 HIS A 53 ? ? 0.156 'SIDE CHAIN' 44 13 HIS A 60 ? ? 0.157 'SIDE CHAIN' 45 13 TYR A 68 ? ? 0.143 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'HYDROXIDE ION' _pdbx_entity_nonpoly.comp_id OH #