data_1APQ # _entry.id 1APQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1APQ pdb_00001apq 10.2210/pdb1apq/pdb WWPDB D_1000171105 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-09-17 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1APQ _pdbx_database_status.recvd_initial_deposition_date 1997-07-22 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bersch, B.' 1 'Hernandez, J.-F.' 2 'Marion, D.' 3 'Arlaud, G.J.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Solution structure of the epidermal growth factor (EGF)-like module of human complement protease C1r, an atypical member of the EGF family. ; Biochemistry 37 1204 1214 1998 BICHAW US 0006-2960 0033 ? 9477945 10.1021/bi971851v 1 'Chemical Synthesis and Characterization of the Egf-Like Module of Human Complement Protease C1R' J.Pept.Res. 49 221 ? 1997 JPERFA DK 1397-002X 2150 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bersch, B.' 1 ? primary 'Hernandez, J.F.' 2 ? primary 'Marion, D.' 3 ? primary 'Arlaud, G.J.' 4 ? 1 'Hernandez, J.-F.' 5 ? 1 'Bersch, B.' 6 ? 1 'Petillot, Y.' 7 ? 1 'Gagnon, J.' 8 ? 1 'Arlaud, G.J.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'COMPLEMENT PROTEASE C1R' _entity.formula_weight 5984.458 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.4.21.41 _entity.pdbx_mutation ? _entity.pdbx_fragment 'EGF-LIKE MODULE' _entity.details 'CALCIUM-BINDING CONSENSUS SEQUENCE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AVDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQAE _entity_poly.pdbx_seq_one_letter_code_can AVDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQAE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 VAL n 1 3 ASP n 1 4 LEU n 1 5 ASP n 1 6 GLU n 1 7 CYS n 1 8 ALA n 1 9 SER n 1 10 ARG n 1 11 SER n 1 12 LYS n 1 13 SER n 1 14 GLY n 1 15 GLU n 1 16 GLU n 1 17 ASP n 1 18 PRO n 1 19 GLN n 1 20 PRO n 1 21 GLN n 1 22 CYS n 1 23 GLN n 1 24 HIS n 1 25 LEU n 1 26 CYS n 1 27 HIS n 1 28 ASN n 1 29 TYR n 1 30 VAL n 1 31 GLY n 1 32 GLY n 1 33 TYR n 1 34 PHE n 1 35 CYS n 1 36 SER n 1 37 CYS n 1 38 ARG n 1 39 PRO n 1 40 GLY n 1 41 TYR n 1 42 GLU n 1 43 LEU n 1 44 GLN n 1 45 GLU n 1 46 ASP n 1 47 ARG n 1 48 HIS n 1 49 SER n 1 50 CYS n 1 51 GLN n 1 52 ALA n 1 53 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 23 23 ALA ALA A . n A 1 2 VAL 2 24 24 VAL VAL A . n A 1 3 ASP 3 25 25 ASP ASP A . n A 1 4 LEU 4 26 26 LEU LEU A . n A 1 5 ASP 5 27 27 ASP ASP A . n A 1 6 GLU 6 28 28 GLU GLU A . n A 1 7 CYS 7 29 29 CYS CYS A . n A 1 8 ALA 8 30 30 ALA ALA A . n A 1 9 SER 9 31 31 SER SER A . n A 1 10 ARG 10 32 32 ARG ARG A . n A 1 11 SER 11 33 33 SER SER A . n A 1 12 LYS 12 34 34 LYS LYS A . n A 1 13 SER 13 35 35 SER SER A . n A 1 14 GLY 14 36 36 GLY GLY A . n A 1 15 GLU 15 37 37 GLU GLU A . n A 1 16 GLU 16 38 38 GLU GLU A . n A 1 17 ASP 17 39 39 ASP ASP A . n A 1 18 PRO 18 40 40 PRO PRO A . n A 1 19 GLN 19 41 41 GLN GLN A . n A 1 20 PRO 20 42 42 PRO PRO A . n A 1 21 GLN 21 43 43 GLN GLN A . n A 1 22 CYS 22 44 44 CYS CYS A . n A 1 23 GLN 23 45 45 GLN GLN A . n A 1 24 HIS 24 46 46 HIS HIS A . n A 1 25 LEU 25 47 47 LEU LEU A . n A 1 26 CYS 26 48 48 CYS CYS A . n A 1 27 HIS 27 49 49 HIS HIS A . n A 1 28 ASN 28 50 50 ASN ASN A . n A 1 29 TYR 29 51 51 TYR TYR A . n A 1 30 VAL 30 52 52 VAL VAL A . n A 1 31 GLY 31 53 53 GLY GLY A . n A 1 32 GLY 32 54 54 GLY GLY A . n A 1 33 TYR 33 55 55 TYR TYR A . n A 1 34 PHE 34 56 56 PHE PHE A . n A 1 35 CYS 35 57 57 CYS CYS A . n A 1 36 SER 36 58 58 SER SER A . n A 1 37 CYS 37 59 59 CYS CYS A . n A 1 38 ARG 38 60 60 ARG ARG A . n A 1 39 PRO 39 61 61 PRO PRO A . n A 1 40 GLY 40 62 62 GLY GLY A . n A 1 41 TYR 41 63 63 TYR TYR A . n A 1 42 GLU 42 64 64 GLU GLU A . n A 1 43 LEU 43 65 65 LEU LEU A . n A 1 44 GLN 44 66 66 GLN GLN A . n A 1 45 GLU 45 67 67 GLU GLU A . n A 1 46 ASP 46 68 68 ASP ASP A . n A 1 47 ARG 47 69 69 ARG ARG A . n A 1 48 HIS 48 70 70 HIS HIS A . n A 1 49 SER 49 71 71 SER SER A . n A 1 50 CYS 50 72 72 CYS CYS A . n A 1 51 GLN 51 73 73 GLN GLN A . n A 1 52 ALA 52 74 74 ALA ALA A . n A 1 53 GLU 53 75 75 GLU GLU A . n # _cell.entry_id 1APQ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1APQ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1APQ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1APQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1APQ _struct.title 'STRUCTURE OF THE EGF-LIKE MODULE OF HUMAN C1R, NMR, 19 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1APQ _struct_keywords.pdbx_keywords COMPLEMENT _struct_keywords.text 'COMPLEMENT, EGF, CALCIUM BINDING, SERINE PROTEASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C1R_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00736 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVFQQFDLEPSEGCFYDYVKISA DKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQ CQHLCHNYVGGYFCSCRPGYELQEDRHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPF DIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKLRYTTEIIKCPQPKTLDEFTI IQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQDDGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKA RIQYYCHEPYYKMQTRAGSRESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVF TNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIAL LELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCA GHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1APQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 53 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00736 _struct_ref_seq.db_align_beg 140 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 192 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 23 _struct_ref_seq.pdbx_auth_seq_align_end 75 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 29 A CYS 48 1_555 ? ? ? ? ? ? ? 2.077 ? ? disulf2 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 44 A CYS 57 1_555 ? ? ? ? ? ? ? 2.073 ? ? disulf3 disulf ? ? A CYS 37 SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 59 A CYS 72 1_555 ? ? ? ? ? ? ? 2.074 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 7 ? CYS A 26 ? CYS A 29 ? 1_555 CYS A 48 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 22 ? CYS A 35 ? CYS A 44 ? 1_555 CYS A 57 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 37 ? CYS A 50 ? CYS A 59 ? 1_555 CYS A 72 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 25 ? TYR A 29 ? LEU A 47 TYR A 51 A 2 GLY A 32 ? SER A 36 ? GLY A 54 SER A 58 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 25 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 47 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id SER _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 36 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id SER _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 58 # _struct_site.id CAB _struct_site.pdbx_evidence_code Unknown _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'PROBABLE CALCIUM BINDING SITE.' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 CAB 5 ASP A 3 ? ASP A 25 . ? 1_555 ? 2 CAB 5 LEU A 4 ? LEU A 26 . ? 1_555 ? 3 CAB 5 GLU A 6 ? GLU A 28 . ? 1_555 ? 4 CAB 5 ASN A 28 ? ASN A 50 . ? 1_555 ? 5 CAB 5 TYR A 29 ? TYR A 51 . ? 1_555 ? # _pdbx_entry_details.entry_id 1APQ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A CYS 48 ? ? CB A CYS 48 ? ? SG A CYS 48 ? ? 121.70 114.20 7.50 1.10 N 2 2 CA A CYS 48 ? ? CB A CYS 48 ? ? SG A CYS 48 ? ? 121.81 114.20 7.61 1.10 N 3 9 CA A CYS 48 ? ? CB A CYS 48 ? ? SG A CYS 48 ? ? 122.32 114.20 8.12 1.10 N 4 12 CA A CYS 48 ? ? CB A CYS 48 ? ? SG A CYS 48 ? ? 121.05 114.20 6.85 1.10 N 5 15 CA A CYS 48 ? ? CB A CYS 48 ? ? SG A CYS 48 ? ? 121.10 114.20 6.90 1.10 N 6 18 CA A CYS 48 ? ? CB A CYS 48 ? ? SG A CYS 48 ? ? 121.03 114.20 6.83 1.10 N 7 19 CA A CYS 48 ? ? CB A CYS 48 ? ? SG A CYS 48 ? ? 122.45 114.20 8.25 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 33 ? ? 53.03 -149.18 2 1 ASP A 39 ? ? -168.71 117.58 3 1 GLN A 43 ? ? -59.33 102.96 4 1 CYS A 44 ? ? 73.61 53.63 5 1 HIS A 46 ? ? -101.64 -83.58 6 1 PRO A 61 ? ? -47.02 156.67 7 1 HIS A 70 ? ? -158.21 -37.50 8 2 VAL A 24 ? ? 76.40 -56.77 9 2 LEU A 26 ? ? -55.50 174.64 10 2 ASP A 27 ? ? 65.93 92.59 11 2 GLU A 28 ? ? -153.07 -60.08 12 2 ARG A 32 ? ? 49.42 -110.84 13 2 LYS A 34 ? ? 67.95 -62.60 14 2 SER A 35 ? ? -151.59 57.15 15 2 GLU A 38 ? ? 76.41 151.90 16 2 ASP A 39 ? ? -154.85 75.78 17 2 PRO A 42 ? ? -17.80 90.21 18 2 GLN A 45 ? ? -6.97 -62.45 19 2 HIS A 46 ? ? -88.00 -79.97 20 2 ARG A 69 ? ? 85.26 43.17 21 3 SER A 35 ? ? 28.62 65.93 22 3 GLU A 37 ? ? 66.45 -70.05 23 3 ASP A 39 ? ? 166.44 130.96 24 3 GLN A 43 ? ? 68.13 -1.10 25 3 GLN A 45 ? ? -31.44 -85.66 26 3 HIS A 46 ? ? -124.87 -72.89 27 3 PHE A 56 ? ? -92.93 -72.04 28 3 CYS A 57 ? ? 104.34 167.36 29 3 HIS A 70 ? ? -152.14 -27.41 30 4 GLU A 28 ? ? -36.73 99.27 31 4 ALA A 30 ? ? -120.48 -75.73 32 4 ARG A 32 ? ? 63.28 168.82 33 4 SER A 35 ? ? -68.42 71.40 34 4 ASP A 39 ? ? -155.54 -61.42 35 4 PRO A 42 ? ? -54.95 170.93 36 4 GLN A 43 ? ? -77.51 -111.31 37 4 CYS A 44 ? ? 156.16 164.19 38 4 HIS A 46 ? ? -105.36 -94.12 39 5 GLU A 28 ? ? -39.26 -36.12 40 5 SER A 35 ? ? -150.33 -11.98 41 5 ASP A 39 ? ? -166.20 92.16 42 5 GLN A 43 ? ? -58.92 109.42 43 5 GLN A 45 ? ? -60.44 -96.12 44 5 HIS A 46 ? ? -83.46 -82.36 45 5 GLU A 67 ? ? 73.36 -52.00 46 5 ASP A 68 ? ? 114.13 -24.19 47 6 SER A 33 ? ? -170.76 -63.15 48 6 LYS A 34 ? ? -63.94 77.53 49 6 SER A 35 ? ? -157.25 -68.90 50 6 ASP A 39 ? ? 71.81 80.93 51 6 HIS A 46 ? ? -96.21 -75.19 52 6 PHE A 56 ? ? -112.15 -77.66 53 6 CYS A 57 ? ? 97.03 166.70 54 6 HIS A 70 ? ? -150.09 -45.43 55 7 GLN A 43 ? ? -75.29 39.62 56 7 CYS A 44 ? ? -178.16 135.42 57 7 HIS A 46 ? ? -107.40 -90.58 58 7 TYR A 51 ? ? -173.04 -174.55 59 7 ARG A 69 ? ? 75.05 -32.05 60 8 GLU A 28 ? ? -60.49 70.88 61 8 CYS A 29 ? ? -174.37 -63.59 62 8 LYS A 34 ? ? 61.91 60.53 63 8 ASP A 39 ? ? 71.71 107.46 64 8 PRO A 42 ? ? -73.92 -167.68 65 8 HIS A 46 ? ? -107.83 -76.60 66 8 TYR A 51 ? ? -177.19 -178.72 67 8 GLU A 67 ? ? -58.92 -0.70 68 8 ARG A 69 ? ? 72.66 -27.97 69 9 GLU A 28 ? ? 177.99 93.20 70 9 CYS A 29 ? ? 68.82 -64.00 71 9 GLU A 38 ? ? -176.07 -169.75 72 9 HIS A 46 ? ? -107.06 -84.74 73 9 ASP A 68 ? ? -153.35 -14.56 74 9 ARG A 69 ? ? 73.67 -34.26 75 9 ALA A 74 ? ? -86.31 45.10 76 10 ASP A 25 ? ? 108.52 161.83 77 10 ASP A 27 ? ? -59.27 103.34 78 10 LYS A 34 ? ? -64.34 78.54 79 10 SER A 35 ? ? -156.68 47.57 80 10 GLU A 37 ? ? -37.56 94.12 81 10 CYS A 44 ? ? -59.45 101.62 82 10 HIS A 46 ? ? -95.35 -82.63 83 10 HIS A 70 ? ? -131.51 -42.92 84 11 LEU A 26 ? ? 44.52 -137.55 85 11 ASP A 27 ? ? -100.84 73.32 86 11 ARG A 32 ? ? 47.39 -62.02 87 11 SER A 33 ? ? -171.30 30.01 88 11 SER A 35 ? ? -77.05 48.30 89 11 PRO A 42 ? ? -49.03 105.46 90 11 CYS A 44 ? ? 124.68 94.62 91 11 HIS A 46 ? ? -95.72 -83.76 92 11 TYR A 51 ? ? -177.41 -171.74 93 11 ARG A 69 ? ? 75.95 -39.58 94 12 LEU A 26 ? ? -92.37 -157.96 95 12 CYS A 29 ? ? -103.94 58.68 96 12 SER A 31 ? ? 69.26 -57.58 97 12 ARG A 32 ? ? 69.61 -59.89 98 12 SER A 33 ? ? -164.28 -167.77 99 12 GLU A 38 ? ? 36.15 52.32 100 12 ASP A 39 ? ? -146.12 -59.33 101 12 GLN A 41 ? ? 98.76 138.57 102 12 HIS A 46 ? ? -94.84 -92.72 103 12 ARG A 69 ? ? 76.00 -3.02 104 13 VAL A 24 ? ? 73.44 -51.48 105 13 ARG A 32 ? ? -79.74 48.86 106 13 GLU A 37 ? ? -43.37 106.26 107 13 ASP A 39 ? ? -161.37 77.74 108 13 HIS A 46 ? ? -108.25 -90.09 109 13 TYR A 51 ? ? -171.56 -174.95 110 13 GLU A 67 ? ? -59.52 -9.32 111 13 ARG A 69 ? ? 74.22 -31.65 112 14 GLU A 28 ? ? 34.97 39.60 113 14 CYS A 29 ? ? 55.63 16.21 114 14 LYS A 34 ? ? -50.78 105.70 115 14 GLU A 37 ? ? 52.80 -97.48 116 14 ASP A 39 ? ? -167.11 90.17 117 14 GLN A 41 ? ? -118.68 74.87 118 14 PRO A 42 ? ? -80.74 46.12 119 14 CYS A 44 ? ? 89.79 91.95 120 14 HIS A 46 ? ? -110.15 -87.99 121 15 CYS A 29 ? ? -173.03 38.39 122 15 ARG A 32 ? ? -60.59 84.25 123 15 SER A 33 ? ? -68.64 26.84 124 15 LYS A 34 ? ? -178.70 144.40 125 15 SER A 35 ? ? 64.96 -65.58 126 15 GLU A 38 ? ? -68.60 69.58 127 15 GLN A 41 ? ? 71.39 130.39 128 15 PRO A 42 ? ? -52.04 98.03 129 15 HIS A 46 ? ? -107.31 -70.61 130 15 GLU A 67 ? ? 49.93 71.16 131 15 ARG A 69 ? ? 66.72 63.33 132 15 HIS A 70 ? ? -144.53 -36.13 133 16 SER A 35 ? ? -161.37 -80.57 134 16 GLN A 41 ? ? 31.54 67.68 135 16 PRO A 42 ? ? -71.93 -159.88 136 16 HIS A 46 ? ? -111.64 -77.14 137 16 GLU A 67 ? ? -57.82 -9.17 138 16 ARG A 69 ? ? 82.02 26.19 139 16 HIS A 70 ? ? -147.65 -43.89 140 17 CYS A 29 ? ? 77.72 -48.89 141 17 ALA A 30 ? ? -57.14 -72.60 142 17 ARG A 32 ? ? -47.59 -19.71 143 17 SER A 33 ? ? -154.21 58.21 144 17 LYS A 34 ? ? 64.87 -77.19 145 17 ASP A 39 ? ? -170.15 135.03 146 17 PRO A 42 ? ? -68.99 75.97 147 17 HIS A 46 ? ? -106.86 -68.38 148 17 TYR A 51 ? ? -174.61 -174.26 149 17 SER A 58 ? ? -131.55 -55.87 150 17 CYS A 59 ? ? 105.03 175.07 151 17 HIS A 70 ? ? -141.91 -47.05 152 18 LYS A 34 ? ? 92.26 68.12 153 18 HIS A 46 ? ? -109.56 -87.70 154 18 TYR A 51 ? ? -177.71 -176.25 155 18 ASP A 68 ? ? -171.38 -17.01 156 18 ALA A 74 ? ? -85.14 44.04 157 19 LEU A 26 ? ? -110.20 -152.33 158 19 CYS A 29 ? ? -146.48 53.62 159 19 ALA A 30 ? ? 76.26 -93.02 160 19 ARG A 32 ? ? 69.27 -63.79 161 19 SER A 33 ? ? 72.78 -37.36 162 19 LYS A 34 ? ? -67.08 74.40 163 19 SER A 35 ? ? -58.42 -80.06 164 19 GLU A 37 ? ? -68.42 85.31 165 19 GLU A 38 ? ? -69.15 68.16 166 19 HIS A 46 ? ? -101.60 -79.02 167 19 GLU A 67 ? ? 69.99 -17.81 168 19 ASP A 68 ? ? 75.64 -3.98 169 19 HIS A 70 ? ? -164.25 -47.90 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 TYR A 63 ? ? 0.082 'SIDE CHAIN' 2 3 ARG A 69 ? ? 0.099 'SIDE CHAIN' 3 4 ARG A 60 ? ? 0.080 'SIDE CHAIN' 4 5 TYR A 63 ? ? 0.101 'SIDE CHAIN' 5 6 PHE A 56 ? ? 0.093 'SIDE CHAIN' 6 8 HIS A 46 ? ? 0.095 'SIDE CHAIN' 7 9 TYR A 55 ? ? 0.081 'SIDE CHAIN' 8 12 TYR A 55 ? ? 0.063 'SIDE CHAIN' 9 12 TYR A 63 ? ? 0.089 'SIDE CHAIN' 10 13 TYR A 55 ? ? 0.123 'SIDE CHAIN' 11 13 TYR A 63 ? ? 0.140 'SIDE CHAIN' 12 15 HIS A 46 ? ? 0.099 'SIDE CHAIN' 13 19 TYR A 55 ? ? 0.112 'SIDE CHAIN' 14 19 TYR A 63 ? ? 0.116 'SIDE CHAIN' 15 19 ARG A 69 ? ? 0.101 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1APQ _pdbx_nmr_ensemble.conformers_calculated_total_number 25 _pdbx_nmr_ensemble.conformers_submitted_total_number 19 _pdbx_nmr_ensemble.conformer_selection_criteria 'EXPERIMENTAL ENERGY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type NOESY _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_refine.entry_id 1APQ _pdbx_nmr_refine.method 'SIMULATED ANNEALING, RESTRAINED MOLECULAR DYNAMICS' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE FOLLOWING JOURNAL CITATION : BLACKLEDGE ET AL., J. MOL. BIOL. 245, 661-681 (1995).' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement 'DISCOVER (MODIFICATION OF ST' ST BIOSYM 1 'structure solution' Discover ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 LEU N N N N 158 LEU CA C N S 159 LEU C C N N 160 LEU O O N N 161 LEU CB C N N 162 LEU CG C N N 163 LEU CD1 C N N 164 LEU CD2 C N N 165 LEU OXT O N N 166 LEU H H N N 167 LEU H2 H N N 168 LEU HA H N N 169 LEU HB2 H N N 170 LEU HB3 H N N 171 LEU HG H N N 172 LEU HD11 H N N 173 LEU HD12 H N N 174 LEU HD13 H N N 175 LEU HD21 H N N 176 LEU HD22 H N N 177 LEU HD23 H N N 178 LEU HXT H N N 179 LYS N N N N 180 LYS CA C N S 181 LYS C C N N 182 LYS O O N N 183 LYS CB C N N 184 LYS CG C N N 185 LYS CD C N N 186 LYS CE C N N 187 LYS NZ N N N 188 LYS OXT O N N 189 LYS H H N N 190 LYS H2 H N N 191 LYS HA H N N 192 LYS HB2 H N N 193 LYS HB3 H N N 194 LYS HG2 H N N 195 LYS HG3 H N N 196 LYS HD2 H N N 197 LYS HD3 H N N 198 LYS HE2 H N N 199 LYS HE3 H N N 200 LYS HZ1 H N N 201 LYS HZ2 H N N 202 LYS HZ3 H N N 203 LYS HXT H N N 204 PHE N N N N 205 PHE CA C N S 206 PHE C C N N 207 PHE O O N N 208 PHE CB C N N 209 PHE CG C Y N 210 PHE CD1 C Y N 211 PHE CD2 C Y N 212 PHE CE1 C Y N 213 PHE CE2 C Y N 214 PHE CZ C Y N 215 PHE OXT O N N 216 PHE H H N N 217 PHE H2 H N N 218 PHE HA H N N 219 PHE HB2 H N N 220 PHE HB3 H N N 221 PHE HD1 H N N 222 PHE HD2 H N N 223 PHE HE1 H N N 224 PHE HE2 H N N 225 PHE HZ H N N 226 PHE HXT H N N 227 PRO N N N N 228 PRO CA C N S 229 PRO C C N N 230 PRO O O N N 231 PRO CB C N N 232 PRO CG C N N 233 PRO CD C N N 234 PRO OXT O N N 235 PRO H H N N 236 PRO HA H N N 237 PRO HB2 H N N 238 PRO HB3 H N N 239 PRO HG2 H N N 240 PRO HG3 H N N 241 PRO HD2 H N N 242 PRO HD3 H N N 243 PRO HXT H N N 244 SER N N N N 245 SER CA C N S 246 SER C C N N 247 SER O O N N 248 SER CB C N N 249 SER OG O N N 250 SER OXT O N N 251 SER H H N N 252 SER H2 H N N 253 SER HA H N N 254 SER HB2 H N N 255 SER HB3 H N N 256 SER HG H N N 257 SER HXT H N N 258 TYR N N N N 259 TYR CA C N S 260 TYR C C N N 261 TYR O O N N 262 TYR CB C N N 263 TYR CG C Y N 264 TYR CD1 C Y N 265 TYR CD2 C Y N 266 TYR CE1 C Y N 267 TYR CE2 C Y N 268 TYR CZ C Y N 269 TYR OH O N N 270 TYR OXT O N N 271 TYR H H N N 272 TYR H2 H N N 273 TYR HA H N N 274 TYR HB2 H N N 275 TYR HB3 H N N 276 TYR HD1 H N N 277 TYR HD2 H N N 278 TYR HE1 H N N 279 TYR HE2 H N N 280 TYR HH H N N 281 TYR HXT H N N 282 VAL N N N N 283 VAL CA C N S 284 VAL C C N N 285 VAL O O N N 286 VAL CB C N N 287 VAL CG1 C N N 288 VAL CG2 C N N 289 VAL OXT O N N 290 VAL H H N N 291 VAL H2 H N N 292 VAL HA H N N 293 VAL HB H N N 294 VAL HG11 H N N 295 VAL HG12 H N N 296 VAL HG13 H N N 297 VAL HG21 H N N 298 VAL HG22 H N N 299 VAL HG23 H N N 300 VAL HXT H N N 301 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 PHE N CA sing N N 195 PHE N H sing N N 196 PHE N H2 sing N N 197 PHE CA C sing N N 198 PHE CA CB sing N N 199 PHE CA HA sing N N 200 PHE C O doub N N 201 PHE C OXT sing N N 202 PHE CB CG sing N N 203 PHE CB HB2 sing N N 204 PHE CB HB3 sing N N 205 PHE CG CD1 doub Y N 206 PHE CG CD2 sing Y N 207 PHE CD1 CE1 sing Y N 208 PHE CD1 HD1 sing N N 209 PHE CD2 CE2 doub Y N 210 PHE CD2 HD2 sing N N 211 PHE CE1 CZ doub Y N 212 PHE CE1 HE1 sing N N 213 PHE CE2 CZ sing Y N 214 PHE CE2 HE2 sing N N 215 PHE CZ HZ sing N N 216 PHE OXT HXT sing N N 217 PRO N CA sing N N 218 PRO N CD sing N N 219 PRO N H sing N N 220 PRO CA C sing N N 221 PRO CA CB sing N N 222 PRO CA HA sing N N 223 PRO C O doub N N 224 PRO C OXT sing N N 225 PRO CB CG sing N N 226 PRO CB HB2 sing N N 227 PRO CB HB3 sing N N 228 PRO CG CD sing N N 229 PRO CG HG2 sing N N 230 PRO CG HG3 sing N N 231 PRO CD HD2 sing N N 232 PRO CD HD3 sing N N 233 PRO OXT HXT sing N N 234 SER N CA sing N N 235 SER N H sing N N 236 SER N H2 sing N N 237 SER CA C sing N N 238 SER CA CB sing N N 239 SER CA HA sing N N 240 SER C O doub N N 241 SER C OXT sing N N 242 SER CB OG sing N N 243 SER CB HB2 sing N N 244 SER CB HB3 sing N N 245 SER OG HG sing N N 246 SER OXT HXT sing N N 247 TYR N CA sing N N 248 TYR N H sing N N 249 TYR N H2 sing N N 250 TYR CA C sing N N 251 TYR CA CB sing N N 252 TYR CA HA sing N N 253 TYR C O doub N N 254 TYR C OXT sing N N 255 TYR CB CG sing N N 256 TYR CB HB2 sing N N 257 TYR CB HB3 sing N N 258 TYR CG CD1 doub Y N 259 TYR CG CD2 sing Y N 260 TYR CD1 CE1 sing Y N 261 TYR CD1 HD1 sing N N 262 TYR CD2 CE2 doub Y N 263 TYR CD2 HD2 sing N N 264 TYR CE1 CZ doub Y N 265 TYR CE1 HE1 sing N N 266 TYR CE2 CZ sing Y N 267 TYR CE2 HE2 sing N N 268 TYR CZ OH sing N N 269 TYR OH HH sing N N 270 TYR OXT HXT sing N N 271 VAL N CA sing N N 272 VAL N H sing N N 273 VAL N H2 sing N N 274 VAL CA C sing N N 275 VAL CA CB sing N N 276 VAL CA HA sing N N 277 VAL C O doub N N 278 VAL C OXT sing N N 279 VAL CB CG1 sing N N 280 VAL CB CG2 sing N N 281 VAL CB HB sing N N 282 VAL CG1 HG11 sing N N 283 VAL CG1 HG12 sing N N 284 VAL CG1 HG13 sing N N 285 VAL CG2 HG21 sing N N 286 VAL CG2 HG22 sing N N 287 VAL CG2 HG23 sing N N 288 VAL OXT HXT sing N N 289 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AMX-600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1APQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_