data_1AQB # _entry.id 1AQB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1AQB pdb_00001aqb 10.2210/pdb1aqb/pdb WWPDB D_1000171125 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1AQB _pdbx_database_status.recvd_initial_deposition_date 1997-07-28 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zanotti, G.' 1 'Panzalorto, M.' 2 'Marcato, A.' 3 'Malpeli, G.' 4 'Folli, C.' 5 'Berni, R.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of pig plasma retinol-binding protein at 1.65 A resolution.' 'Acta Crystallogr.,Sect.D' 54 1049 1052 1998 ABCRE6 DK 0907-4449 0766 ? 9757135 10.1107/S0907444998002303 1 'Crystal Structure of Liganded and Unliganded Forms of Bovine Plasma Retinol-Binding Protein' J.Biol.Chem. 268 10728 ? 1993 JBCHA3 US 0021-9258 0071 ? ? ? 2 'Crystal Structure of the Trigonal Form of Human Plasma Retinol-Binding Protein at 2.5 A Resolution' J.Mol.Biol. 230 613 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zanotti, G.' 1 ? primary 'Panzalorto, M.' 2 ? primary 'Marcato, A.' 3 ? primary 'Malpeli, G.' 4 ? primary 'Folli, C.' 5 ? primary 'Berni, R.' 6 ? 1 'Zanotti, G.' 7 ? 1 'Berni, R.' 8 ? 1 'Monaco, H.L.' 9 ? 2 'Zanotti, G.' 10 ? 2 'Ottonello, S.' 11 ? 2 'Berni, R.' 12 ? 2 'Monaco, H.L.' 13 ? # _cell.entry_id 1AQB _cell.length_a 45.810 _cell.length_b 53.137 _cell.length_c 72.966 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1AQB _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'RETINOL-BINDING PROTEIN' 21183.656 1 ? ? ? ? 2 non-polymer syn 'CADMIUM ION' 112.411 1 ? ? ? ? 3 non-polymer syn RETINOL 286.452 1 ? ? ? ? 4 water nat water 18.015 124 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name RBP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDENGHMSATAKGRVRLLNNWDVCADMVGTFTDT EDPAKFKMKYWGVASFLQKGNDDHWIIDTDYDTYAVQYSCRLQNLDGTCADSYSFVFARDPHGFSPEVQKIVRQRQEELC LARQYRIITHNGYCDGKSERNIL ; _entity_poly.pdbx_seq_one_letter_code_can ;ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDENGHMSATAKGRVRLLNNWDVCADMVGTFTDT EDPAKFKMKYWGVASFLQKGNDDHWIIDTDYDTYAVQYSCRLQNLDGTCADSYSFVFARDPHGFSPEVQKIVRQRQEELC LARQYRIITHNGYCDGKSERNIL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ARG n 1 3 ASP n 1 4 CYS n 1 5 ARG n 1 6 VAL n 1 7 SER n 1 8 SER n 1 9 PHE n 1 10 ARG n 1 11 VAL n 1 12 LYS n 1 13 GLU n 1 14 ASN n 1 15 PHE n 1 16 ASP n 1 17 LYS n 1 18 ALA n 1 19 ARG n 1 20 PHE n 1 21 SER n 1 22 GLY n 1 23 THR n 1 24 TRP n 1 25 TYR n 1 26 ALA n 1 27 MET n 1 28 ALA n 1 29 LYS n 1 30 LYS n 1 31 ASP n 1 32 PRO n 1 33 GLU n 1 34 GLY n 1 35 LEU n 1 36 PHE n 1 37 LEU n 1 38 GLN n 1 39 ASP n 1 40 ASN n 1 41 ILE n 1 42 VAL n 1 43 ALA n 1 44 GLU n 1 45 PHE n 1 46 SER n 1 47 VAL n 1 48 ASP n 1 49 GLU n 1 50 ASN n 1 51 GLY n 1 52 HIS n 1 53 MET n 1 54 SER n 1 55 ALA n 1 56 THR n 1 57 ALA n 1 58 LYS n 1 59 GLY n 1 60 ARG n 1 61 VAL n 1 62 ARG n 1 63 LEU n 1 64 LEU n 1 65 ASN n 1 66 ASN n 1 67 TRP n 1 68 ASP n 1 69 VAL n 1 70 CYS n 1 71 ALA n 1 72 ASP n 1 73 MET n 1 74 VAL n 1 75 GLY n 1 76 THR n 1 77 PHE n 1 78 THR n 1 79 ASP n 1 80 THR n 1 81 GLU n 1 82 ASP n 1 83 PRO n 1 84 ALA n 1 85 LYS n 1 86 PHE n 1 87 LYS n 1 88 MET n 1 89 LYS n 1 90 TYR n 1 91 TRP n 1 92 GLY n 1 93 VAL n 1 94 ALA n 1 95 SER n 1 96 PHE n 1 97 LEU n 1 98 GLN n 1 99 LYS n 1 100 GLY n 1 101 ASN n 1 102 ASP n 1 103 ASP n 1 104 HIS n 1 105 TRP n 1 106 ILE n 1 107 ILE n 1 108 ASP n 1 109 THR n 1 110 ASP n 1 111 TYR n 1 112 ASP n 1 113 THR n 1 114 TYR n 1 115 ALA n 1 116 VAL n 1 117 GLN n 1 118 TYR n 1 119 SER n 1 120 CYS n 1 121 ARG n 1 122 LEU n 1 123 GLN n 1 124 ASN n 1 125 LEU n 1 126 ASP n 1 127 GLY n 1 128 THR n 1 129 CYS n 1 130 ALA n 1 131 ASP n 1 132 SER n 1 133 TYR n 1 134 SER n 1 135 PHE n 1 136 VAL n 1 137 PHE n 1 138 ALA n 1 139 ARG n 1 140 ASP n 1 141 PRO n 1 142 HIS n 1 143 GLY n 1 144 PHE n 1 145 SER n 1 146 PRO n 1 147 GLU n 1 148 VAL n 1 149 GLN n 1 150 LYS n 1 151 ILE n 1 152 VAL n 1 153 ARG n 1 154 GLN n 1 155 ARG n 1 156 GLN n 1 157 GLU n 1 158 GLU n 1 159 LEU n 1 160 CYS n 1 161 LEU n 1 162 ALA n 1 163 ARG n 1 164 GLN n 1 165 TYR n 1 166 ARG n 1 167 ILE n 1 168 ILE n 1 169 THR n 1 170 HIS n 1 171 ASN n 1 172 GLY n 1 173 TYR n 1 174 CYS n 1 175 ASP n 1 176 GLY n 1 177 LYS n 1 178 SER n 1 179 GLU n 1 180 ARG n 1 181 ASN n 1 182 ILE n 1 183 LEU n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'domestic pig' _entity_src_nat.pdbx_organism_scientific 'Sus scrofa domestica' _entity_src_nat.pdbx_ncbi_taxonomy_id 9825 _entity_src_nat.genus Sus _entity_src_nat.species 'Sus scrofa' _entity_src_nat.strain domestica _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location PLASMA _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RETBP_PIG _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P27485 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MEWVWALVLLAALGSAQAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDENGHMSATAKGRVR LLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYDTYAVQYSCRLQNLDGTCADSYSFVFARDPH GFSPEVQKIVRQRQEELCLARQYRIITHNGYCDGKSERNIL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1AQB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P27485 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 201 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CD non-polymer . 'CADMIUM ION' ? 'Cd 2' 112.411 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RTL non-polymer . RETINOL ? 'C20 H30 O' 286.452 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1AQB _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.1 _exptl_crystal.density_percent_sol 41. _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.8 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;SITTING DROP VAPOR DIFFUSION METHOD, AT A FINAL PROTEIN CONCENTRATION OF 8 MG/ML IN THE PRESENCE OF 8% 2-METHYL-2,4-PENTANEDIOL, 3 MM CADMIUM ACETATE, 0.1 M TRIS-ACETATE, PH=6.8, vapor diffusion - sitting drop ; # _diffrn.id 1 _diffrn.ambient_temp 300 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'AREA DETECTOR' _diffrn_detector.type SIEMENS _diffrn_detector.pdbx_collection_date 1996-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GRAPHITE(002)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'MACSCIENCE M18X' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1AQB _reflns.observed_criterion_sigma_I 0. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 55. _reflns.d_resolution_high 1.65 _reflns.number_obs 20127 _reflns.number_all ? _reflns.percent_possible_obs 91. _reflns.pdbx_Rmerge_I_obs 0.064 _reflns.pdbx_Rsym_value 0.064 _reflns.pdbx_netI_over_sigmaI 8. _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.2 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.65 _reflns_shell.d_res_low 1.72 _reflns_shell.percent_possible_all 56. _reflns_shell.Rmerge_I_obs 0.19 _reflns_shell.pdbx_Rsym_value 0.19 _reflns_shell.meanI_over_sigI_obs 4. _reflns_shell.pdbx_redundancy 2.5 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1AQB _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all 20090 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 55. _refine.ls_d_res_high 1.65 _refine.ls_percent_reflns_obs 90.5 _refine.ls_R_factor_obs 0.1844 _refine.ls_R_factor_all 0.1942 _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free 0.2372 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 1001 _refine.ls_number_parameters 6308 _refine.ls_number_restraints 5678 _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'MOEWS & KRETSINGER' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details 'NO RESTRAINTS WERE APPLIED ON THE PLANARITY OF RETINOL MOLECULE' _refine.pdbx_starting_model 1HBP _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'ENGH AND HUBER' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details 'EVERY 20TH REFLECTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1AQB _refine_analyze.Luzzati_coordinate_error_obs ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues 3 _refine_analyze.occupancy_sum_hydrogen 5272. _refine_analyze.occupancy_sum_non_hydrogen 6284. _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1428 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.number_atoms_solvent 124 _refine_hist.number_atoms_total 1574 _refine_hist.d_res_high 1.65 _refine_hist.d_res_low 55. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function s_bond_d 0.03 ? ? ? 'X-RAY DIFFRACTION' ? s_angle_d 0.03 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_dist 0.03 ? ? ? 'X-RAY DIFFRACTION' ? s_from_restr_planes 0.2 ? ? ? 'X-RAY DIFFRACTION' ? s_zero_chiral_vol 0.2 ? ? ? 'X-RAY DIFFRACTION' ? s_non_zero_chiral_vol 0.2 ? ? ? 'X-RAY DIFFRACTION' ? s_anti_bump_dis_restr 0.01 ? ? ? 'X-RAY DIFFRACTION' ? s_rigid_bond_adp_cmpnt 0.0 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_adp_cmpnt 0.0 ? ? ? 'X-RAY DIFFRACTION' ? s_approx_iso_adps 0.0 ? ? ? 'X-RAY DIFFRACTION' ? # _pdbx_refine.entry_id 1AQB _pdbx_refine.R_factor_all_no_cutoff 0.1942 _pdbx_refine.R_factor_obs_no_cutoff 0.1844 _pdbx_refine.free_R_factor_no_cutoff 0.2372 _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff 5.0 _pdbx_refine.free_R_val_test_set_ct_no_cutoff 1001 _pdbx_refine.R_factor_all_4sig_cutoff 0.165 _pdbx_refine.R_factor_obs_4sig_cutoff 0.1568 _pdbx_refine.free_R_factor_4sig_cutoff 0.2156 _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff 4.5 _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff 895 _pdbx_refine.number_reflns_obs_4sig_cutoff 16680 _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.free_R_error_no_cutoff ? # _struct.entry_id 1AQB _struct.title 'RETINOL-BINDING PROTEIN (RBP) FROM PIG PLASMA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1AQB _struct_keywords.pdbx_keywords 'RETINOL TRANSPORT' _struct_keywords.text 'RETINOL TRANSPORT, RETINOIDS, VITAMIN A, CADMIUM ION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 6 ? SER A 8 ? VAL A 6 SER A 8 4 ? 3 HELX_P HELX_P2 2 PRO A 146 ? GLU A 158 ? PRO A 146 GLU A 158 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 160 SG ? ? A CYS 4 A CYS 160 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 70 SG ? ? ? 1_555 A CYS 174 SG ? ? A CYS 70 A CYS 174 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf3 disulf ? ? A CYS 120 SG ? ? ? 1_555 A CYS 129 SG ? ? A CYS 120 A CYS 129 1_555 ? ? ? ? ? ? ? 2.017 ? ? metalc1 metalc ? ? A GLU 33 OE1 ? ? ? 3_554 B CD . CD ? ? A GLU 33 A CD 184 1_555 ? ? ? ? ? ? ? 2.353 ? ? metalc2 metalc ? ? A GLU 33 OE2 ? ? ? 3_554 B CD . CD ? ? A GLU 33 A CD 184 1_555 ? ? ? ? ? ? ? 2.494 ? ? metalc3 metalc ? ? A ASP 140 OD1 ? ? ? 1_555 B CD . CD ? ? A ASP 140 A CD 184 1_555 ? ? ? ? ? ? ? 2.402 ? ? metalc4 metalc ? ? A ASP 140 OD2 ? ? ? 1_555 B CD . CD ? ? A ASP 140 A CD 184 1_555 ? ? ? ? ? ? ? 2.520 ? ? metalc5 metalc ? ? A HIS 142 ND1 ? ? ? 1_555 B CD . CD ? ? A HIS 142 A CD 184 1_555 ? ? ? ? ? ? ? 2.349 ? ? metalc6 metalc ? ? B CD . CD ? ? ? 1_555 D HOH . O ? ? A CD 184 A HOH 350 3_554 ? ? ? ? ? ? ? 2.311 ? ? metalc7 metalc ? ? B CD . CD ? ? ? 1_555 D HOH . O ? ? A CD 184 A HOH 351 3_554 ? ? ? ? ? ? ? 2.379 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S1 2 3 ? anti-parallel S1 3 4 ? anti-parallel S1 4 5 ? anti-parallel S1 5 6 ? anti-parallel S1 6 7 ? anti-parallel S1 7 8 ? anti-parallel S1 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 GLY A 22 ? LYS A 30 ? GLY A 22 LYS A 30 S1 2 ASP A 39 ? ASP A 48 ? ASP A 39 ASP A 48 S1 3 HIS A 52 ? LEU A 63 ? HIS A 52 LEU A 63 S1 4 TRP A 67 ? THR A 78 ? TRP A 67 THR A 78 S1 5 LYS A 85 ? GLY A 92 ? LYS A 85 GLY A 92 S1 6 LYS A 99 ? ASP A 110 ? LYS A 99 ASP A 110 S1 7 TYR A 114 ? ASN A 124 ? TYR A 114 ASN A 124 S1 8 CYS A 129 ? ARG A 139 ? CYS A 129 ARG A 139 S1 9 GLY A 22 ? LYS A 30 ? GLY A 22 LYS A 30 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 N ALA A 26 ? N ALA A 26 O ILE A 41 ? O ILE A 41 S1 2 3 N ASP A 48 ? N ASP A 48 O HIS A 52 ? O HIS A 52 S1 3 4 N LEU A 63 ? N LEU A 63 O TRP A 67 ? O TRP A 67 S1 4 5 O THR A 78 ? O THR A 78 N LYS A 87 ? N LYS A 87 S1 5 6 O TYR A 90 ? O TYR A 90 N GLY A 100 ? N GLY A 100 S1 6 7 N ASP A 110 ? N ASP A 110 O TYR A 114 ? O TYR A 114 S1 7 8 O LEU A 122 ? O LEU A 122 N ALA A 130 ? N ALA A 130 S1 8 9 O ALA A 138 ? O ALA A 138 N TYR A 25 ? N TYR A 25 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CD 184 ? 5 'BINDING SITE FOR RESIDUE CD A 184' AC2 Software A RTL 185 ? 6 'BINDING SITE FOR RESIDUE RTL A 185' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLU A 33 ? GLU A 33 . ? 3_554 ? 2 AC1 5 ASP A 140 ? ASP A 140 . ? 1_555 ? 3 AC1 5 HIS A 142 ? HIS A 142 . ? 1_555 ? 4 AC1 5 HOH D . ? HOH A 350 . ? 3_554 ? 5 AC1 5 HOH D . ? HOH A 351 . ? 3_554 ? 6 AC2 6 LEU A 35 ? LEU A 35 . ? 1_555 ? 7 AC2 6 MET A 88 ? MET A 88 . ? 1_555 ? 8 AC2 6 LEU A 97 ? LEU A 97 . ? 1_555 ? 9 AC2 6 GLN A 98 ? GLN A 98 . ? 1_555 ? 10 AC2 6 PHE A 135 ? PHE A 135 . ? 1_555 ? 11 AC2 6 HOH D . ? HOH A 387 . ? 1_555 ? # _database_PDB_matrix.entry_id 1AQB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1AQB _atom_sites.fract_transf_matrix[1][1] 0.021829 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018819 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013705 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CD N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 TRP 67 67 67 TRP TRP A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 TRP 91 91 91 TRP TRP A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 TRP 105 105 105 TRP TRP A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 CYS 120 120 120 CYS CYS A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 CYS 129 129 129 CYS CYS A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 GLN 154 154 154 GLN GLN A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 CYS 160 160 160 CYS CYS A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 GLN 164 164 164 GLN GLN A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 HIS 170 170 170 HIS HIS A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 TYR 173 173 173 TYR TYR A . n A 1 174 CYS 174 174 174 CYS CYS A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 GLY 176 176 ? ? ? A . n A 1 177 LYS 177 177 ? ? ? A . n A 1 178 SER 178 178 ? ? ? A . n A 1 179 GLU 179 179 ? ? ? A . n A 1 180 ARG 180 180 ? ? ? A . n A 1 181 ASN 181 181 ? ? ? A . n A 1 182 ILE 182 182 ? ? ? A . n A 1 183 LEU 183 183 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CD 1 184 178 CD CD A . C 3 RTL 1 185 177 RTL RTL A . D 4 HOH 1 300 300 HOH HOH A . D 4 HOH 2 301 301 HOH HOH A . D 4 HOH 3 302 302 HOH HOH A . D 4 HOH 4 303 303 HOH HOH A . D 4 HOH 5 304 304 HOH HOH A . D 4 HOH 6 305 305 HOH HOH A . D 4 HOH 7 306 306 HOH HOH A . D 4 HOH 8 307 307 HOH HOH A . D 4 HOH 9 308 308 HOH HOH A . D 4 HOH 10 309 309 HOH HOH A . D 4 HOH 11 310 310 HOH HOH A . D 4 HOH 12 311 311 HOH HOH A . D 4 HOH 13 312 312 HOH HOH A . D 4 HOH 14 313 313 HOH HOH A . D 4 HOH 15 314 314 HOH HOH A . D 4 HOH 16 315 315 HOH HOH A . D 4 HOH 17 316 316 HOH HOH A . D 4 HOH 18 317 317 HOH HOH A . D 4 HOH 19 318 318 HOH HOH A . D 4 HOH 20 319 319 HOH HOH A . D 4 HOH 21 320 320 HOH HOH A . D 4 HOH 22 321 321 HOH HOH A . D 4 HOH 23 322 322 HOH HOH A . D 4 HOH 24 323 323 HOH HOH A . D 4 HOH 25 324 324 HOH HOH A . D 4 HOH 26 325 325 HOH HOH A . D 4 HOH 27 326 326 HOH HOH A . D 4 HOH 28 327 327 HOH HOH A . D 4 HOH 29 328 328 HOH HOH A . D 4 HOH 30 329 329 HOH HOH A . D 4 HOH 31 330 330 HOH HOH A . D 4 HOH 32 331 331 HOH HOH A . D 4 HOH 33 332 332 HOH HOH A . D 4 HOH 34 333 333 HOH HOH A . D 4 HOH 35 334 334 HOH HOH A . D 4 HOH 36 335 335 HOH HOH A . D 4 HOH 37 336 336 HOH HOH A . D 4 HOH 38 337 337 HOH HOH A . D 4 HOH 39 338 338 HOH HOH A . D 4 HOH 40 339 339 HOH HOH A . D 4 HOH 41 340 340 HOH HOH A . D 4 HOH 42 341 341 HOH HOH A . D 4 HOH 43 342 342 HOH HOH A . D 4 HOH 44 343 343 HOH HOH A . D 4 HOH 45 344 344 HOH HOH A . D 4 HOH 46 345 345 HOH HOH A . D 4 HOH 47 346 346 HOH HOH A . D 4 HOH 48 347 347 HOH HOH A . D 4 HOH 49 348 348 HOH HOH A . D 4 HOH 50 349 349 HOH HOH A . D 4 HOH 51 350 350 HOH HOH A . D 4 HOH 52 351 351 HOH HOH A . D 4 HOH 53 352 352 HOH HOH A . D 4 HOH 54 353 353 HOH HOH A . D 4 HOH 55 354 354 HOH HOH A . D 4 HOH 56 355 355 HOH HOH A . D 4 HOH 57 356 356 HOH HOH A . D 4 HOH 58 357 357 HOH HOH A . D 4 HOH 59 358 358 HOH HOH A . D 4 HOH 60 359 359 HOH HOH A . D 4 HOH 61 360 360 HOH HOH A . D 4 HOH 62 361 361 HOH HOH A . D 4 HOH 63 362 362 HOH HOH A . D 4 HOH 64 363 363 HOH HOH A . D 4 HOH 65 364 364 HOH HOH A . D 4 HOH 66 365 365 HOH HOH A . D 4 HOH 67 366 366 HOH HOH A . D 4 HOH 68 367 367 HOH HOH A . D 4 HOH 69 368 368 HOH HOH A . D 4 HOH 70 369 369 HOH HOH A . D 4 HOH 71 370 370 HOH HOH A . D 4 HOH 72 371 371 HOH HOH A . D 4 HOH 73 372 372 HOH HOH A . D 4 HOH 74 373 373 HOH HOH A . D 4 HOH 75 374 374 HOH HOH A . D 4 HOH 76 375 375 HOH HOH A . D 4 HOH 77 376 376 HOH HOH A . D 4 HOH 78 377 377 HOH HOH A . D 4 HOH 79 378 378 HOH HOH A . D 4 HOH 80 379 379 HOH HOH A . D 4 HOH 81 380 380 HOH HOH A . D 4 HOH 82 381 381 HOH HOH A . D 4 HOH 83 382 382 HOH HOH A . D 4 HOH 84 383 383 HOH HOH A . D 4 HOH 85 384 384 HOH HOH A . D 4 HOH 86 385 385 HOH HOH A . D 4 HOH 87 386 386 HOH HOH A . D 4 HOH 88 387 387 HOH HOH A . D 4 HOH 89 388 388 HOH HOH A . D 4 HOH 90 389 389 HOH HOH A . D 4 HOH 91 390 390 HOH HOH A . D 4 HOH 92 391 391 HOH HOH A . D 4 HOH 93 392 392 HOH HOH A . D 4 HOH 94 393 393 HOH HOH A . D 4 HOH 95 394 394 HOH HOH A . D 4 HOH 96 395 395 HOH HOH A . D 4 HOH 97 396 396 HOH HOH A . D 4 HOH 98 397 397 HOH HOH A . D 4 HOH 99 398 398 HOH HOH A . D 4 HOH 100 399 399 HOH HOH A . D 4 HOH 101 400 400 HOH HOH A . D 4 HOH 102 401 401 HOH HOH A . D 4 HOH 103 402 402 HOH HOH A . D 4 HOH 104 403 403 HOH HOH A . D 4 HOH 105 404 404 HOH HOH A . D 4 HOH 106 405 405 HOH HOH A . D 4 HOH 107 406 406 HOH HOH A . D 4 HOH 108 407 407 HOH HOH A . D 4 HOH 109 408 408 HOH HOH A . D 4 HOH 110 409 409 HOH HOH A . D 4 HOH 111 410 410 HOH HOH A . D 4 HOH 112 411 411 HOH HOH A . D 4 HOH 113 412 412 HOH HOH A . D 4 HOH 114 413 413 HOH HOH A . D 4 HOH 115 414 414 HOH HOH A . D 4 HOH 116 415 415 HOH HOH A . D 4 HOH 117 416 416 HOH HOH A . D 4 HOH 118 417 417 HOH HOH A . D 4 HOH 119 418 418 HOH HOH A . D 4 HOH 120 419 419 HOH HOH A . D 4 HOH 121 420 420 HOH HOH A . D 4 HOH 122 421 421 HOH HOH A . D 4 HOH 123 422 422 HOH HOH A . D 4 HOH 124 423 423 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 33 ? A GLU 33 ? 3_554 CD ? B CD . ? A CD 184 ? 1_555 OE2 ? A GLU 33 ? A GLU 33 ? 3_554 53.2 ? 2 OE1 ? A GLU 33 ? A GLU 33 ? 3_554 CD ? B CD . ? A CD 184 ? 1_555 OD1 ? A ASP 140 ? A ASP 140 ? 1_555 135.1 ? 3 OE2 ? A GLU 33 ? A GLU 33 ? 3_554 CD ? B CD . ? A CD 184 ? 1_555 OD1 ? A ASP 140 ? A ASP 140 ? 1_555 162.3 ? 4 OE1 ? A GLU 33 ? A GLU 33 ? 3_554 CD ? B CD . ? A CD 184 ? 1_555 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 82.2 ? 5 OE2 ? A GLU 33 ? A GLU 33 ? 3_554 CD ? B CD . ? A CD 184 ? 1_555 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 131.2 ? 6 OD1 ? A ASP 140 ? A ASP 140 ? 1_555 CD ? B CD . ? A CD 184 ? 1_555 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 52.9 ? 7 OE1 ? A GLU 33 ? A GLU 33 ? 3_554 CD ? B CD . ? A CD 184 ? 1_555 ND1 ? A HIS 142 ? A HIS 142 ? 1_555 134.8 ? 8 OE2 ? A GLU 33 ? A GLU 33 ? 3_554 CD ? B CD . ? A CD 184 ? 1_555 ND1 ? A HIS 142 ? A HIS 142 ? 1_555 86.3 ? 9 OD1 ? A ASP 140 ? A ASP 140 ? 1_555 CD ? B CD . ? A CD 184 ? 1_555 ND1 ? A HIS 142 ? A HIS 142 ? 1_555 89.6 ? 10 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 CD ? B CD . ? A CD 184 ? 1_555 ND1 ? A HIS 142 ? A HIS 142 ? 1_555 142.0 ? 11 OE1 ? A GLU 33 ? A GLU 33 ? 3_554 CD ? B CD . ? A CD 184 ? 1_555 O ? D HOH . ? A HOH 350 ? 3_554 96.2 ? 12 OE2 ? A GLU 33 ? A GLU 33 ? 3_554 CD ? B CD . ? A CD 184 ? 1_555 O ? D HOH . ? A HOH 350 ? 3_554 79.2 ? 13 OD1 ? A ASP 140 ? A ASP 140 ? 1_555 CD ? B CD . ? A CD 184 ? 1_555 O ? D HOH . ? A HOH 350 ? 3_554 84.0 ? 14 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 CD ? B CD . ? A CD 184 ? 1_555 O ? D HOH . ? A HOH 350 ? 3_554 88.2 ? 15 ND1 ? A HIS 142 ? A HIS 142 ? 1_555 CD ? B CD . ? A CD 184 ? 1_555 O ? D HOH . ? A HOH 350 ? 3_554 94.5 ? 16 OE1 ? A GLU 33 ? A GLU 33 ? 3_554 CD ? B CD . ? A CD 184 ? 1_555 O ? D HOH . ? A HOH 351 ? 3_554 73.7 ? 17 OE2 ? A GLU 33 ? A GLU 33 ? 3_554 CD ? B CD . ? A CD 184 ? 1_555 O ? D HOH . ? A HOH 351 ? 3_554 94.8 ? 18 OD1 ? A ASP 140 ? A ASP 140 ? 1_555 CD ? B CD . ? A CD 184 ? 1_555 O ? D HOH . ? A HOH 351 ? 3_554 102.6 ? 19 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 CD ? B CD . ? A CD 184 ? 1_555 O ? D HOH . ? A HOH 351 ? 3_554 89.8 ? 20 ND1 ? A HIS 142 ? A HIS 142 ? 1_555 CD ? B CD . ? A CD 184 ? 1_555 O ? D HOH . ? A HOH 351 ? 3_554 93.1 ? 21 O ? D HOH . ? A HOH 350 ? 3_554 CD ? B CD . ? A CD 184 ? 1_555 O ? D HOH . ? A HOH 351 ? 3_554 169.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-01-28 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-04-04 5 'Structure model' 1 4 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 5 'Structure model' 'Database references' 5 5 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' diffrn_source 2 5 'Structure model' database_2 3 5 'Structure model' pdbx_initial_refinement_model 4 5 'Structure model' pdbx_struct_conn_angle 5 5 'Structure model' struct_conn 6 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_diffrn_source.type' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 18 5 'Structure model' '_pdbx_struct_conn_angle.value' 19 5 'Structure model' '_struct_conn.pdbx_dist_value' 20 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 21 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 22 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 23 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 24 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 25 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 26 5 'Structure model' '_struct_conn.ptnr1_symmetry' 27 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 28 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 29 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 30 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 31 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 32 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 33 5 'Structure model' '_struct_conn.ptnr2_symmetry' 34 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 35 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 36 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SAINT 'data scaling' . ? 1 SAINT 'data reduction' . ? 2 SHELXL-93 'model building' . ? 3 X-PLOR 'model building' . ? 4 SHELXL-93 refinement . ? 5 X-PLOR refinement . ? 6 SHELXL-93 phasing . ? 7 X-PLOR phasing . ? 8 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLN _pdbx_validate_close_contact.auth_seq_id_1 154 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 158 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.16 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A SER 21 ? ? OG A SER 21 ? B 1.138 1.418 -0.280 0.013 N 2 1 CD A GLU 44 ? ? OE1 A GLU 44 ? ? 1.328 1.252 0.076 0.011 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 66 ? ? 91.25 3.60 2 1 TYR A 111 ? ? 68.02 -29.43 3 1 THR A 113 ? ? -132.20 -49.09 4 1 CYS A 160 ? ? 71.23 33.14 5 1 ASN A 171 ? ? -140.90 34.48 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 5 ? ? 0.109 'SIDE CHAIN' 2 1 ARG A 10 ? ? 0.123 'SIDE CHAIN' 3 1 ARG A 62 ? ? 0.094 'SIDE CHAIN' 4 1 ARG A 153 ? ? 0.281 'SIDE CHAIN' 5 1 ARG A 155 ? ? 0.145 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 176 ? A GLY 176 2 1 Y 1 A LYS 177 ? A LYS 177 3 1 Y 1 A SER 178 ? A SER 178 4 1 Y 1 A GLU 179 ? A GLU 179 5 1 Y 1 A ARG 180 ? A ARG 180 6 1 Y 1 A ASN 181 ? A ASN 181 7 1 Y 1 A ILE 182 ? A ILE 182 8 1 Y 1 A LEU 183 ? A LEU 183 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CADMIUM ION' CD 3 RETINOL RTL 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1HBP _pdbx_initial_refinement_model.details ? #