data_1AQG # _entry.id 1AQG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1AQG pdb_00001aqg 10.2210/pdb1aqg/pdb WWPDB D_1000171130 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1AQG _pdbx_database_status.recvd_initial_deposition_date 1997-07-29 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kisselev, O.G.' 1 'Marshall, G.R.' 2 # _citation.id primary _citation.title 'Light-activated rhodopsin induces structural binding motif in G protein alpha subunit.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 95 _citation.page_first 4270 _citation.page_last 4275 _citation.year 1998 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9539726 _citation.pdbx_database_id_DOI 10.1073/pnas.95.8.4270 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kisselev, O.G.' 1 ? primary 'Kao, J.' 2 ? primary 'Ponder, J.W.' 3 ? primary 'Fann, Y.C.' 4 ? primary 'Gautam, N.' 5 ? primary 'Marshall, G.R.' 6 ? # _cell.entry_id 1AQG _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1AQG _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'TRANSDUCIN ALPHA-1 SUBUNIT' _entity.formula_weight 1281.521 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RHODOPSIN BINDING DOMAIN, RESIDUES 340-350' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GT(ALPHA)(340-350)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code IKENLKDCGLF _entity_poly.pdbx_seq_one_letter_code_can IKENLKDCGLF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 LYS n 1 3 GLU n 1 4 ASN n 1 5 LEU n 1 6 LYS n 1 7 ASP n 1 8 CYS n 1 9 GLY n 1 10 LEU n 1 11 PHE n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name cattle _entity_src_nat.pdbx_organism_scientific 'Bos taurus' _entity_src_nat.pdbx_ncbi_taxonomy_id 9913 _entity_src_nat.genus Bos _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue RETINA _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location 'ROD OUTER SEGMENT DISKS' _entity_src_nat.pdbx_organ EYE _entity_src_nat.pdbx_organelle 'ROD OUTER SEGMENT' _entity_src_nat.pdbx_cell 'PHOTORECEPTOR ROD CELL' _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GNAT1_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P04695 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;GAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIV RAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTP GYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMHE SLHLFNSICNHRYFATTSIVLFLNKKDVFSEKIKKAHLSICFPDYNGPNTYEDAGNYIKVQFLELNMRRDVKEIYSHMTC ATDTQNVKFVFDAVTDIIIKENLKDCGLF ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1AQG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 11 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04695 _struct_ref_seq.db_align_beg 339 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 349 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 340 _struct_ref_seq.pdbx_auth_seq_align_end 350 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type TRNOESY _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 274 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? _pdbx_nmr_exptl_sample_conditions.pH_units ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20 mM sodium phosphate, 100 mM KCl, 0.1 mM EDTA, 1 mM DTT, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label sample_1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model UNITY _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1AQG _pdbx_nmr_refine.method 'DISTANCE GEOMETRY/ CONSTRAINED MOLECULAR DYNAMICS/SIMULATED ANNEALING' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1AQG _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement Tinker ? PONDER 1 'structure calculation' Tinker ? PONDER 2 'structure calculation' SYBYL ? Tripos 3 'structure calculation' MOLMOL ? 'Koradi, Billeter and Wuthrich' 4 # _exptl.entry_id 1AQG _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1AQG _struct.title 'NMR STRUCTURE OF THE RHODOPSIN-BOUND C-TERMINAL PEPTIDE OF THE TRANSDUCIN ALPHA-SUBUNIT, 20 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1AQG _struct_keywords.pdbx_keywords TRANSDUCER _struct_keywords.text 'TRANSDUCER, TRANSDUCIN, RHODOPSIN, GTP-BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id H1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 3 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 7 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 342 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 346 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1AQG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1AQG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 340 340 ILE ILE A . n A 1 2 LYS 2 341 341 LYS LYS A . n A 1 3 GLU 3 342 342 GLU GLU A . n A 1 4 ASN 4 343 343 ASN ASN A . n A 1 5 LEU 5 344 344 LEU LEU A . n A 1 6 LYS 6 345 345 LYS LYS A . n A 1 7 ASP 7 346 346 ASP ASP A . n A 1 8 CYS 8 347 347 CYS CYS A . n A 1 9 GLY 9 348 348 GLY GLY A . n A 1 10 LEU 10 349 349 LEU LEU A . n A 1 11 PHE 11 350 350 PHE PHE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-07-29 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Experimental preparation' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_ensemble 4 4 'Structure model' pdbx_nmr_exptl_sample 5 4 'Structure model' pdbx_nmr_sample_details 6 4 'Structure model' pdbx_nmr_software 7 4 'Structure model' pdbx_nmr_spectrometer 8 4 'Structure model' pdbx_struct_assembly 9 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_ensemble.conformer_selection_criteria' 5 4 'Structure model' '_pdbx_nmr_sample_details.contents' 6 4 'Structure model' '_pdbx_nmr_sample_details.label' 7 4 'Structure model' '_pdbx_nmr_sample_details.solvent_system' 8 4 'Structure model' '_pdbx_nmr_sample_details.type' 9 4 'Structure model' '_pdbx_nmr_software.authors' 10 4 'Structure model' '_pdbx_nmr_software.classification' 11 4 'Structure model' '_pdbx_nmr_software.name' 12 4 'Structure model' '_pdbx_nmr_spectrometer.manufacturer' 13 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal VNMR 'model building' . ? 1 VNMR phasing . ? 2 # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate' 20 ? mM 'natural abundance' 1 KCl 100 ? mM 'natural abundance' 1 EDTA 0.1 ? mM 'natural abundance' 1 DTT 1 ? mM 'natural abundance' 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HZ3 A LYS 345 ? ? OD1 A ASP 346 ? ? 1.54 2 5 HZ3 A LYS 345 ? ? OD1 A ASP 346 ? ? 1.56 3 14 HZ3 A LYS 345 ? ? OD1 A ASP 346 ? ? 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 343 ? ? -57.40 -8.46 2 1 CYS A 347 ? ? -135.91 -62.25 3 1 LEU A 349 ? ? -135.48 -83.80 4 2 CYS A 347 ? ? -103.13 -61.15 5 2 LEU A 349 ? ? -118.55 -81.33 6 3 ASN A 343 ? ? -56.99 -9.42 7 3 CYS A 347 ? ? -138.68 -63.86 8 3 LEU A 349 ? ? -138.94 -82.67 9 4 LEU A 349 ? ? -134.96 -82.62 10 5 LEU A 349 ? ? -101.20 -63.61 11 6 ASN A 343 ? ? -57.87 -8.92 12 6 LEU A 344 ? ? -131.42 -44.49 13 6 LEU A 349 ? ? -140.14 -88.36 14 7 LEU A 344 ? ? -132.25 -44.36 15 7 LEU A 349 ? ? -137.88 -93.42 16 8 CYS A 347 ? ? -107.46 -61.64 17 8 LEU A 349 ? ? -118.94 -74.24 18 9 LEU A 344 ? ? -132.56 -43.46 19 9 LEU A 349 ? ? -138.26 -88.56 20 10 ASN A 343 ? ? -57.92 -9.11 21 10 LEU A 344 ? ? -131.06 -42.74 22 10 CYS A 347 ? ? -122.91 -61.77 23 10 LEU A 349 ? ? -138.67 -85.31 24 11 LEU A 344 ? ? -134.35 -43.35 25 11 LEU A 349 ? ? -139.18 -90.63 26 12 LEU A 349 ? ? -121.14 -77.52 27 13 ASN A 343 ? ? -57.32 -5.50 28 13 CYS A 347 ? ? -137.32 -64.54 29 13 LEU A 349 ? ? -138.13 -84.05 30 14 CYS A 347 ? ? -107.08 -61.40 31 14 LEU A 349 ? ? -118.08 -77.35 32 15 ASN A 343 ? ? -58.10 -7.17 33 15 LEU A 344 ? ? -132.78 -43.48 34 15 LEU A 349 ? ? -139.44 -88.58 35 16 ASN A 343 ? ? -57.52 -8.17 36 16 LEU A 344 ? ? -131.95 -40.17 37 16 CYS A 347 ? ? -120.92 -61.46 38 16 LEU A 349 ? ? -130.37 -82.83 39 17 LEU A 349 ? ? -112.55 -72.19 40 18 LEU A 349 ? ? -111.91 -70.17 41 19 CYS A 347 ? ? -105.20 -61.04 42 19 LEU A 349 ? ? -120.86 -82.57 43 20 LEU A 349 ? ? -120.19 -86.32 #