data_1ARF # _entry.id 1ARF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.390 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ARF pdb_00001arf 10.2210/pdb1arf/pdb WWPDB D_1000171165 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-01-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 1 4 2024-04-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_struct_conn_angle 10 5 'Structure model' struct_conn 11 5 'Structure model' struct_ref_seq_dif 12 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.value' 15 5 'Structure model' '_struct_conn.pdbx_dist_value' 16 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 17 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 18 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 19 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 20 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 21 5 'Structure model' '_struct_ref_seq_dif.details' 22 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 23 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 24 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ARF _pdbx_database_status.recvd_initial_deposition_date 1993-10-01 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hoffman, R.C.' 1 'Xu, R.X.' 2 'Horvath, S.J.' 3 'Herriott, J.R.' 4 'Klevit, R.E.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structures of DNA-binding mutant zinc finger domains: implications for DNA binding.' 'Protein Sci.' 2 951 965 1993 PRCIEI US 0961-8368 0795 ? 8318900 ? 1 'A Simple Method for the Refinement of Models Derived from NMR Data Demonstrated on a Zinc Finger Domain from Yeast Adr1' J.Magn.Reson. 102 61 ? 1993 JOMRA4 US 0022-2364 0624 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hoffman, R.C.' 1 ? primary 'Horvath, S.J.' 2 ? primary 'Klevit, R.E.' 3 ? 1 'Hoffman, R.C.' 4 ? 1 'Xu, R.X.' 5 ? 1 'Klevit, R.E.' 6 ? 1 'Herriott, J.R.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'YEAST TRANSCRIPTION FACTOR ADR1' 3625.130 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code RSFVCEVCTRAFARQEYLKRHYRSHTNEK _entity_poly.pdbx_seq_one_letter_code_can RSFVCEVCTRAFARQEYLKRHYRSHTNEK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 SER n 1 3 PHE n 1 4 VAL n 1 5 CYS n 1 6 GLU n 1 7 VAL n 1 8 CYS n 1 9 THR n 1 10 ARG n 1 11 ALA n 1 12 PHE n 1 13 ALA n 1 14 ARG n 1 15 GLN n 1 16 GLU n 1 17 TYR n 1 18 LEU n 1 19 LYS n 1 20 ARG n 1 21 HIS n 1 22 TYR n 1 23 ARG n 1 24 SER n 1 25 HIS n 1 26 THR n 1 27 ASN n 1 28 GLU n 1 29 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 102 102 ARG ARG A . n A 1 2 SER 2 103 103 SER SER A . n A 1 3 PHE 3 104 104 PHE PHE A . n A 1 4 VAL 4 105 105 VAL VAL A . n A 1 5 CYS 5 106 106 CYS CYS A . n A 1 6 GLU 6 107 107 GLU GLU A . n A 1 7 VAL 7 108 108 VAL VAL A . n A 1 8 CYS 8 109 109 CYS CYS A . n A 1 9 THR 9 110 110 THR THR A . n A 1 10 ARG 10 111 111 ARG ARG A . n A 1 11 ALA 11 112 112 ALA ALA A . n A 1 12 PHE 12 113 113 PHE PHE A . n A 1 13 ALA 13 114 114 ALA ALA A . n A 1 14 ARG 14 115 115 ARG ARG A . n A 1 15 GLN 15 116 116 GLN GLN A . n A 1 16 GLU 16 117 117 GLU GLU A . n A 1 17 TYR 17 118 118 TYR TYR A . n A 1 18 LEU 18 119 119 LEU LEU A . n A 1 19 LYS 19 120 120 LYS LYS A . n A 1 20 ARG 20 121 121 ARG ARG A . n A 1 21 HIS 21 122 122 HIS HIS A . n A 1 22 TYR 22 123 123 TYR TYR A . n A 1 23 ARG 23 124 124 ARG ARG A . n A 1 24 SER 24 125 125 SER SER A . n A 1 25 HIS 25 126 126 HIS HIS A . n A 1 26 THR 26 127 127 THR THR A . n A 1 27 ASN 27 128 128 ASN ASN A . n A 1 28 GLU 28 129 129 GLU GLU A . n A 1 29 LYS 29 130 130 LYS LYS A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 1 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 1ARF _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ARF _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1ARF _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1ARF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1ARF _struct.title 'STRUCTURES OF DNA-BINDING MUTANT ZINC FINGER DOMAINS: IMPLICATIONS FOR DNA BINDING' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ARF _struct_keywords.pdbx_keywords 'TRANSCRIPTION REGULATION' _struct_keywords.text 'TRANSCRIPTION REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ADR1_YEAST _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P07248 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MANVEKPNDCSGFPVVDLNSCFSNGFNNEKQEIEMETDDSPILLMSSSASRENSNTFSVIQRTPDGKIITTNNNMNSKIN KQLDKLPENLRLNGRTPSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNLG ETISHTKKVSRTITKARKNSASSVKFQTPTYGTPDNGNFLNRTTANTRRKASPEANVKRKYLKKLTRRASFSAQSASSYA LPDQSSLEQHPKDRVKFSTPELVPLDLKNPELDSSFDLNMNLDLNLNLDSNFNIALNRSDSSGSTMNLDYKLPESANNYT YSSGSPTRAYVGANTNSKNASFNDADLLSSSYWIKAYNDHLFSVSESDETSPMNSELNDTKLIVPDFKSTIHHLKDSRSS SWTVAIDNNSNNNKVSDNQPDFVDFQELLDNDTLGNDLLETTAVLKEFELLHDDSVSATATSNEIDLSHLNLSNSPISPH KLIYKNKEGTNDDMLISFGLDHPSNREDDLDKLCNMTRDVQAIFSQYLKGEESKRSLEDFLSTSNRKEKPDSGNYTFYGL DCLTLSKISRALPASTVNNNQPSHSIESKLFNEPMRNMCIKVLRYYEKFSHDSSESVMDSNPNLLSKELLMPAVSELNEY LDLFKNNFLPHFPIIHPSLLDLDLDSLQRYTNEDGYDDAENAQLFDRLSQGTDKEYDYEHYQILSISKIVCLPLFMATFG SLHKFGYKSQTIELYEMSRRILHSFLETKRRCRSTTVNDSYQNIWLMQSLILSFMFALVADYLEKIDSSLMKRQLSALCS TIRSNCLPTISANSEKSINNNNEPLTFGSPLQYIIFESKIRCTLMAYDFCQFLKCFFHIKFDLSIKEKDVETIYIPDNES KWASESIICNGHVVQKQNFYDFRNFYYSFTYGHLHSIPEFLGSSMIYYEYDLRKGTKSHVFLDRIDTKRLERSLDTSSYG NDNMAATNKNIAILIDDTIILKNNLMSMRFIKQIDRSFTEKVRKGQIAKIYDSFLNSVRLNFLKNYSVEVLCEFLVALNF SIRNISSLYVEEESDCSQRMNSPELPRIHLNNQALSVFNLQGYYYCFILIIKFLLDFEATPNFKLLRIFIELRSLANSIL LPTLSRLYPQEFSGFPDVVFTQQFINKDNGMLVPGLSANEHHNGASAAVKTKLAKKINVEGLAMFINEILVNSFNDTSFL NMEDPIRNEFSFDNGHRAVTDLPRSAHFLSDTGLEGINFSGLNDSHQTVSTLNLLRYGENHSSKHKNGGKGQGFAEKYQL SLKYVTIAKLFFTNVKENYIHCHMLDKMASDFHTLENHLKGNS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ARF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 29 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07248 _struct_ref_seq.db_align_beg 102 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 102 _struct_ref_seq.pdbx_auth_seq_align_end 130 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1ARF _struct_ref_seq_dif.mon_id TYR _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 17 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P07248 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 118 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 118 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AAA _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 15 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 25 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 116 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 126 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details 'ALPHA AND 3/10 HELICAL H-BONDS' _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 5 SG ? ? A ZN 1 A CYS 106 1_555 ? ? ? ? ? ? ? 2.312 ? ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 8 SG ? ? A ZN 1 A CYS 109 1_555 ? ? ? ? ? ? ? 2.279 ? ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 21 NE2 ? ? A ZN 1 A HIS 122 1_555 ? ? ? ? ? ? ? 1.991 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 25 NE2 ? ? A ZN 1 A HIS 126 1_555 ? ? ? ? ? ? ? 2.002 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 5 ? A CYS 106 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 8 ? A CYS 109 ? 1_555 117.6 ? 2 SG ? A CYS 5 ? A CYS 106 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 NE2 ? A HIS 21 ? A HIS 122 ? 1_555 102.2 ? 3 SG ? A CYS 8 ? A CYS 109 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 NE2 ? A HIS 21 ? A HIS 122 ? 1_555 88.4 ? 4 SG ? A CYS 5 ? A CYS 106 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 NE2 ? A HIS 25 ? A HIS 126 ? 1_555 103.0 ? 5 SG ? A CYS 8 ? A CYS 109 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 NE2 ? A HIS 25 ? A HIS 126 ? 1_555 137.7 ? 6 NE2 ? A HIS 21 ? A HIS 122 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 NE2 ? A HIS 25 ? A HIS 126 ? 1_555 94.3 ? # _struct_sheet.id BBB _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id BBB _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id BBB 1 PHE A 3 ? CYS A 5 ? PHE A 104 CYS A 106 BBB 2 THR A 9 ? PHE A 12 ? THR A 110 PHE A 113 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 1 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 1' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 5 ? CYS A 106 . ? 1_555 ? 2 AC1 5 VAL A 7 ? VAL A 108 . ? 1_555 ? 3 AC1 5 CYS A 8 ? CYS A 109 . ? 1_555 ? 4 AC1 5 HIS A 21 ? HIS A 122 . ? 1_555 ? 5 AC1 5 HIS A 25 ? HIS A 126 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A CYS 106 ? ? O A ARG 111 ? ? 1.51 2 2 O A GLN 116 ? ? H A LYS 120 ? ? 1.46 3 3 O A GLN 116 ? ? H A LYS 120 ? ? 1.45 4 3 O A ARG 121 ? ? H A ARG 124 ? ? 1.55 5 3 O A HIS 122 ? ? HG A SER 125 ? ? 1.56 6 4 O A CYS 109 ? ? HG1 A THR 110 ? ? 1.22 7 4 O A GLN 116 ? ? H A LYS 120 ? ? 1.44 8 4 O A ARG 121 ? ? H A ARG 124 ? ? 1.44 9 4 O A TYR 118 ? ? H A HIS 122 ? ? 1.58 10 4 O A CYS 109 ? ? OG1 A THR 110 ? ? 1.63 11 4 O A ARG 124 ? ? OG1 A THR 127 ? ? 2.15 12 5 O A CYS 106 ? ? H A THR 110 ? ? 1.29 13 5 O A GLN 116 ? ? H A LYS 120 ? ? 1.57 14 5 O A CYS 106 ? ? N A THR 110 ? ? 2.13 15 6 O A GLN 116 ? ? H A LYS 120 ? ? 1.42 16 6 O A HIS 122 ? ? HG A SER 125 ? ? 1.56 17 7 O A GLN 116 ? ? H A LYS 120 ? ? 1.41 18 7 O A TYR 118 ? ? H A HIS 122 ? ? 1.54 19 7 O A ARG 121 ? ? H A ARG 124 ? ? 1.56 20 8 O A GLN 116 ? ? H A LYS 120 ? ? 1.43 21 8 O A CYS 106 ? ? H A THR 110 ? ? 1.44 22 8 O A ARG 121 ? ? H A ARG 124 ? ? 1.59 23 8 O A CYS 109 ? ? OG1 A THR 110 ? ? 1.77 24 8 O A CYS 106 ? ? N A THR 110 ? ? 2.17 25 9 O A GLN 116 ? ? H A LYS 120 ? ? 1.42 26 9 H A CYS 106 ? ? O A ARG 111 ? ? 1.53 27 9 O A ARG 121 ? ? H A ARG 124 ? ? 1.54 28 10 O A GLN 116 ? ? H A LYS 120 ? ? 1.46 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 103 ? ? -57.63 -172.48 2 1 THR A 110 ? ? 41.39 23.48 3 2 SER A 103 ? ? -61.49 -146.82 4 2 CYS A 109 ? ? -92.54 -61.71 5 2 THR A 110 ? ? 138.01 -17.27 6 2 ASN A 128 ? ? -175.21 83.18 7 2 GLU A 129 ? ? -25.68 96.02 8 3 THR A 110 ? ? 99.67 39.42 9 3 PHE A 113 ? ? -120.23 -87.59 10 3 ALA A 114 ? ? 175.18 -54.27 11 3 ASN A 128 ? ? 177.64 98.69 12 4 SER A 103 ? ? -46.85 174.08 13 4 VAL A 108 ? ? -96.44 -63.22 14 4 THR A 110 ? ? 123.61 4.23 15 4 PHE A 113 ? ? -132.54 -95.26 16 4 ALA A 114 ? ? -175.94 -60.62 17 4 THR A 127 ? ? -107.73 -76.58 18 4 ASN A 128 ? ? -26.16 -61.62 19 4 GLU A 129 ? ? -13.21 115.80 20 5 GLU A 107 ? ? -49.39 -14.85 21 5 VAL A 108 ? ? -78.02 -73.77 22 5 THR A 127 ? ? -92.11 -73.20 23 5 ASN A 128 ? ? -174.83 116.92 24 6 VAL A 108 ? ? -99.64 -64.70 25 6 THR A 110 ? ? 136.98 -5.85 26 6 PHE A 113 ? ? -122.05 -85.13 27 6 ALA A 114 ? ? 172.04 -54.21 28 6 ASN A 128 ? ? 177.07 91.44 29 6 GLU A 129 ? ? -9.37 114.95 30 7 SER A 103 ? ? -48.06 173.89 31 7 THR A 110 ? ? 132.62 -3.21 32 7 PHE A 113 ? ? -132.42 -96.27 33 7 ALA A 114 ? ? -177.80 -58.15 34 7 THR A 127 ? ? 173.98 112.50 35 7 ASN A 128 ? ? -134.90 -142.07 36 8 THR A 110 ? ? 90.06 30.16 37 8 PHE A 113 ? ? -122.99 -88.27 38 8 ALA A 114 ? ? 174.34 -53.65 39 8 ASN A 128 ? ? 172.54 121.17 40 9 PHE A 104 ? ? -4.66 118.65 41 9 GLU A 107 ? ? -77.86 20.18 42 9 PHE A 113 ? ? -132.69 -96.69 43 9 ALA A 114 ? ? -175.77 -56.73 44 9 ASN A 128 ? ? 170.43 -83.81 45 10 PHE A 104 ? ? -6.66 99.17 46 10 THR A 110 ? ? 32.89 78.86 47 10 ASN A 128 ? ? -177.96 98.95 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 111 ? ? 0.279 'SIDE CHAIN' 2 1 ARG A 115 ? ? 0.100 'SIDE CHAIN' 3 1 ARG A 121 ? ? 0.202 'SIDE CHAIN' 4 1 ARG A 124 ? ? 0.238 'SIDE CHAIN' 5 2 ARG A 102 ? ? 0.298 'SIDE CHAIN' 6 2 ARG A 111 ? ? 0.126 'SIDE CHAIN' 7 2 ARG A 115 ? ? 0.143 'SIDE CHAIN' 8 2 ARG A 124 ? ? 0.142 'SIDE CHAIN' 9 3 ARG A 102 ? ? 0.116 'SIDE CHAIN' 10 3 ARG A 111 ? ? 0.292 'SIDE CHAIN' 11 3 ARG A 115 ? ? 0.299 'SIDE CHAIN' 12 4 ARG A 102 ? ? 0.170 'SIDE CHAIN' 13 4 ARG A 111 ? ? 0.272 'SIDE CHAIN' 14 4 ARG A 115 ? ? 0.278 'SIDE CHAIN' 15 4 ARG A 121 ? ? 0.288 'SIDE CHAIN' 16 4 ARG A 124 ? ? 0.238 'SIDE CHAIN' 17 5 ARG A 102 ? ? 0.258 'SIDE CHAIN' 18 5 ARG A 115 ? ? 0.289 'SIDE CHAIN' 19 5 ARG A 124 ? ? 0.295 'SIDE CHAIN' 20 6 ARG A 102 ? ? 0.237 'SIDE CHAIN' 21 6 ARG A 111 ? ? 0.296 'SIDE CHAIN' 22 6 ARG A 115 ? ? 0.291 'SIDE CHAIN' 23 6 ARG A 121 ? ? 0.231 'SIDE CHAIN' 24 7 ARG A 111 ? ? 0.299 'SIDE CHAIN' 25 7 ARG A 115 ? ? 0.267 'SIDE CHAIN' 26 7 ARG A 121 ? ? 0.236 'SIDE CHAIN' 27 7 ARG A 124 ? ? 0.257 'SIDE CHAIN' 28 8 ARG A 102 ? ? 0.193 'SIDE CHAIN' 29 8 ARG A 111 ? ? 0.298 'SIDE CHAIN' 30 8 ARG A 121 ? ? 0.274 'SIDE CHAIN' 31 8 ARG A 124 ? ? 0.261 'SIDE CHAIN' 32 9 ARG A 102 ? ? 0.080 'SIDE CHAIN' 33 9 ARG A 111 ? ? 0.185 'SIDE CHAIN' 34 9 ARG A 115 ? ? 0.256 'SIDE CHAIN' 35 9 ARG A 124 ? ? 0.203 'SIDE CHAIN' 36 10 ARG A 111 ? ? 0.294 'SIDE CHAIN' 37 10 ARG A 115 ? ? 0.163 'SIDE CHAIN' 38 10 ARG A 121 ? ? 0.251 'SIDE CHAIN' 39 10 ARG A 124 ? ? 0.291 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1ARF _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 HIS N N N N 111 HIS CA C N S 112 HIS C C N N 113 HIS O O N N 114 HIS CB C N N 115 HIS CG C Y N 116 HIS ND1 N Y N 117 HIS CD2 C Y N 118 HIS CE1 C Y N 119 HIS NE2 N Y N 120 HIS OXT O N N 121 HIS H H N N 122 HIS H2 H N N 123 HIS HA H N N 124 HIS HB2 H N N 125 HIS HB3 H N N 126 HIS HD1 H N N 127 HIS HD2 H N N 128 HIS HE1 H N N 129 HIS HE2 H N N 130 HIS HXT H N N 131 LEU N N N N 132 LEU CA C N S 133 LEU C C N N 134 LEU O O N N 135 LEU CB C N N 136 LEU CG C N N 137 LEU CD1 C N N 138 LEU CD2 C N N 139 LEU OXT O N N 140 LEU H H N N 141 LEU H2 H N N 142 LEU HA H N N 143 LEU HB2 H N N 144 LEU HB3 H N N 145 LEU HG H N N 146 LEU HD11 H N N 147 LEU HD12 H N N 148 LEU HD13 H N N 149 LEU HD21 H N N 150 LEU HD22 H N N 151 LEU HD23 H N N 152 LEU HXT H N N 153 LYS N N N N 154 LYS CA C N S 155 LYS C C N N 156 LYS O O N N 157 LYS CB C N N 158 LYS CG C N N 159 LYS CD C N N 160 LYS CE C N N 161 LYS NZ N N N 162 LYS OXT O N N 163 LYS H H N N 164 LYS H2 H N N 165 LYS HA H N N 166 LYS HB2 H N N 167 LYS HB3 H N N 168 LYS HG2 H N N 169 LYS HG3 H N N 170 LYS HD2 H N N 171 LYS HD3 H N N 172 LYS HE2 H N N 173 LYS HE3 H N N 174 LYS HZ1 H N N 175 LYS HZ2 H N N 176 LYS HZ3 H N N 177 LYS HXT H N N 178 PHE N N N N 179 PHE CA C N S 180 PHE C C N N 181 PHE O O N N 182 PHE CB C N N 183 PHE CG C Y N 184 PHE CD1 C Y N 185 PHE CD2 C Y N 186 PHE CE1 C Y N 187 PHE CE2 C Y N 188 PHE CZ C Y N 189 PHE OXT O N N 190 PHE H H N N 191 PHE H2 H N N 192 PHE HA H N N 193 PHE HB2 H N N 194 PHE HB3 H N N 195 PHE HD1 H N N 196 PHE HD2 H N N 197 PHE HE1 H N N 198 PHE HE2 H N N 199 PHE HZ H N N 200 PHE HXT H N N 201 SER N N N N 202 SER CA C N S 203 SER C C N N 204 SER O O N N 205 SER CB C N N 206 SER OG O N N 207 SER OXT O N N 208 SER H H N N 209 SER H2 H N N 210 SER HA H N N 211 SER HB2 H N N 212 SER HB3 H N N 213 SER HG H N N 214 SER HXT H N N 215 THR N N N N 216 THR CA C N S 217 THR C C N N 218 THR O O N N 219 THR CB C N R 220 THR OG1 O N N 221 THR CG2 C N N 222 THR OXT O N N 223 THR H H N N 224 THR H2 H N N 225 THR HA H N N 226 THR HB H N N 227 THR HG1 H N N 228 THR HG21 H N N 229 THR HG22 H N N 230 THR HG23 H N N 231 THR HXT H N N 232 TYR N N N N 233 TYR CA C N S 234 TYR C C N N 235 TYR O O N N 236 TYR CB C N N 237 TYR CG C Y N 238 TYR CD1 C Y N 239 TYR CD2 C Y N 240 TYR CE1 C Y N 241 TYR CE2 C Y N 242 TYR CZ C Y N 243 TYR OH O N N 244 TYR OXT O N N 245 TYR H H N N 246 TYR H2 H N N 247 TYR HA H N N 248 TYR HB2 H N N 249 TYR HB3 H N N 250 TYR HD1 H N N 251 TYR HD2 H N N 252 TYR HE1 H N N 253 TYR HE2 H N N 254 TYR HH H N N 255 TYR HXT H N N 256 VAL N N N N 257 VAL CA C N S 258 VAL C C N N 259 VAL O O N N 260 VAL CB C N N 261 VAL CG1 C N N 262 VAL CG2 C N N 263 VAL OXT O N N 264 VAL H H N N 265 VAL H2 H N N 266 VAL HA H N N 267 VAL HB H N N 268 VAL HG11 H N N 269 VAL HG12 H N N 270 VAL HG13 H N N 271 VAL HG21 H N N 272 VAL HG22 H N N 273 VAL HG23 H N N 274 VAL HXT H N N 275 ZN ZN ZN N N 276 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 HIS N CA sing N N 105 HIS N H sing N N 106 HIS N H2 sing N N 107 HIS CA C sing N N 108 HIS CA CB sing N N 109 HIS CA HA sing N N 110 HIS C O doub N N 111 HIS C OXT sing N N 112 HIS CB CG sing N N 113 HIS CB HB2 sing N N 114 HIS CB HB3 sing N N 115 HIS CG ND1 sing Y N 116 HIS CG CD2 doub Y N 117 HIS ND1 CE1 doub Y N 118 HIS ND1 HD1 sing N N 119 HIS CD2 NE2 sing Y N 120 HIS CD2 HD2 sing N N 121 HIS CE1 NE2 sing Y N 122 HIS CE1 HE1 sing N N 123 HIS NE2 HE2 sing N N 124 HIS OXT HXT sing N N 125 LEU N CA sing N N 126 LEU N H sing N N 127 LEU N H2 sing N N 128 LEU CA C sing N N 129 LEU CA CB sing N N 130 LEU CA HA sing N N 131 LEU C O doub N N 132 LEU C OXT sing N N 133 LEU CB CG sing N N 134 LEU CB HB2 sing N N 135 LEU CB HB3 sing N N 136 LEU CG CD1 sing N N 137 LEU CG CD2 sing N N 138 LEU CG HG sing N N 139 LEU CD1 HD11 sing N N 140 LEU CD1 HD12 sing N N 141 LEU CD1 HD13 sing N N 142 LEU CD2 HD21 sing N N 143 LEU CD2 HD22 sing N N 144 LEU CD2 HD23 sing N N 145 LEU OXT HXT sing N N 146 LYS N CA sing N N 147 LYS N H sing N N 148 LYS N H2 sing N N 149 LYS CA C sing N N 150 LYS CA CB sing N N 151 LYS CA HA sing N N 152 LYS C O doub N N 153 LYS C OXT sing N N 154 LYS CB CG sing N N 155 LYS CB HB2 sing N N 156 LYS CB HB3 sing N N 157 LYS CG CD sing N N 158 LYS CG HG2 sing N N 159 LYS CG HG3 sing N N 160 LYS CD CE sing N N 161 LYS CD HD2 sing N N 162 LYS CD HD3 sing N N 163 LYS CE NZ sing N N 164 LYS CE HE2 sing N N 165 LYS CE HE3 sing N N 166 LYS NZ HZ1 sing N N 167 LYS NZ HZ2 sing N N 168 LYS NZ HZ3 sing N N 169 LYS OXT HXT sing N N 170 PHE N CA sing N N 171 PHE N H sing N N 172 PHE N H2 sing N N 173 PHE CA C sing N N 174 PHE CA CB sing N N 175 PHE CA HA sing N N 176 PHE C O doub N N 177 PHE C OXT sing N N 178 PHE CB CG sing N N 179 PHE CB HB2 sing N N 180 PHE CB HB3 sing N N 181 PHE CG CD1 doub Y N 182 PHE CG CD2 sing Y N 183 PHE CD1 CE1 sing Y N 184 PHE CD1 HD1 sing N N 185 PHE CD2 CE2 doub Y N 186 PHE CD2 HD2 sing N N 187 PHE CE1 CZ doub Y N 188 PHE CE1 HE1 sing N N 189 PHE CE2 CZ sing Y N 190 PHE CE2 HE2 sing N N 191 PHE CZ HZ sing N N 192 PHE OXT HXT sing N N 193 SER N CA sing N N 194 SER N H sing N N 195 SER N H2 sing N N 196 SER CA C sing N N 197 SER CA CB sing N N 198 SER CA HA sing N N 199 SER C O doub N N 200 SER C OXT sing N N 201 SER CB OG sing N N 202 SER CB HB2 sing N N 203 SER CB HB3 sing N N 204 SER OG HG sing N N 205 SER OXT HXT sing N N 206 THR N CA sing N N 207 THR N H sing N N 208 THR N H2 sing N N 209 THR CA C sing N N 210 THR CA CB sing N N 211 THR CA HA sing N N 212 THR C O doub N N 213 THR C OXT sing N N 214 THR CB OG1 sing N N 215 THR CB CG2 sing N N 216 THR CB HB sing N N 217 THR OG1 HG1 sing N N 218 THR CG2 HG21 sing N N 219 THR CG2 HG22 sing N N 220 THR CG2 HG23 sing N N 221 THR OXT HXT sing N N 222 TYR N CA sing N N 223 TYR N H sing N N 224 TYR N H2 sing N N 225 TYR CA C sing N N 226 TYR CA CB sing N N 227 TYR CA HA sing N N 228 TYR C O doub N N 229 TYR C OXT sing N N 230 TYR CB CG sing N N 231 TYR CB HB2 sing N N 232 TYR CB HB3 sing N N 233 TYR CG CD1 doub Y N 234 TYR CG CD2 sing Y N 235 TYR CD1 CE1 sing Y N 236 TYR CD1 HD1 sing N N 237 TYR CD2 CE2 doub Y N 238 TYR CD2 HD2 sing N N 239 TYR CE1 CZ doub Y N 240 TYR CE1 HE1 sing N N 241 TYR CE2 CZ sing Y N 242 TYR CE2 HE2 sing N N 243 TYR CZ OH sing N N 244 TYR OH HH sing N N 245 TYR OXT HXT sing N N 246 VAL N CA sing N N 247 VAL N H sing N N 248 VAL N H2 sing N N 249 VAL CA C sing N N 250 VAL CA CB sing N N 251 VAL CA HA sing N N 252 VAL C O doub N N 253 VAL C OXT sing N N 254 VAL CB CG1 sing N N 255 VAL CB CG2 sing N N 256 VAL CB HB sing N N 257 VAL CG1 HG11 sing N N 258 VAL CG1 HG12 sing N N 259 VAL CG1 HG13 sing N N 260 VAL CG2 HG21 sing N N 261 VAL CG2 HG22 sing N N 262 VAL CG2 HG23 sing N N 263 VAL OXT HXT sing N N 264 # _atom_sites.entry_id 1ARF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_