data_1ASX # _entry.id 1ASX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ASX pdb_00001asx 10.2210/pdb1asx/pdb WWPDB D_1000171218 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1ASS _pdbx_database_related.details '1ASX CRYSTAL FORM EXHIBITS SEGMENTAL MOVEMENT OF A REGION, CALLED HELICAL PROTRUSION, IN COMPARISON TO PDB ENTRY 1ASS' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ASX _pdbx_database_status.recvd_initial_deposition_date 1997-08-11 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Klumpp, M.' 1 'Baumeister, W.' 2 'Essen, L.-O.' 3 # _citation.id primary _citation.title 'Structure of the substrate binding domain of the thermosome, an archaeal group II chaperonin.' _citation.journal_abbrev 'Cell(Cambridge,Mass.)' _citation.journal_volume 91 _citation.page_first 263 _citation.page_last 270 _citation.year 1997 _citation.journal_id_ASTM CELLB5 _citation.country US _citation.journal_id_ISSN 0092-8674 _citation.journal_id_CSD 0998 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9346243 _citation.pdbx_database_id_DOI '10.1016/S0092-8674(00)80408-0' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Klumpp, M.' 1 ? primary 'Baumeister, W.' 2 ? primary 'Essen, L.O.' 3 ? # _cell.entry_id 1ASX _cell.length_a 79.910 _cell.length_b 79.910 _cell.length_c 70.250 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ASX _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man THERMOSOME 17822.625 1 ? ? 'ALPHA SUBUNIT, APICAL DOMAIN, SUBSTRATE-BINDING DOMAIN' ? 2 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 3 water nat water 18.015 6 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSGIVIDKEKVHSKMPDVVKNAKIALIDSALEIKKTEIEAKVQISDPSKIQDFLNQETNTFKQMVEKIKKSGANVVLCQK GIDDVAQHYLAKEGIYAVRRVKKSDMEKLAKATGAKIVTDLDDLTPSVLGEAETVEERKIGDDRMTFVMGCKNHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSGIVIDKEKVHSKMPDVVKNAKIALIDSALEIKKTEIEAKVQISDPSKIQDFLNQETNTFKQMVEKIKKSGANVVLCQK GIDDVAQHYLAKEGIYAVRRVKKSDMEKLAKATGAKIVTDLDDLTPSVLGEAETVEERKIGDDRMTFVMGCKNHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLY n 1 4 ILE n 1 5 VAL n 1 6 ILE n 1 7 ASP n 1 8 LYS n 1 9 GLU n 1 10 LYS n 1 11 VAL n 1 12 HIS n 1 13 SER n 1 14 LYS n 1 15 MET n 1 16 PRO n 1 17 ASP n 1 18 VAL n 1 19 VAL n 1 20 LYS n 1 21 ASN n 1 22 ALA n 1 23 LYS n 1 24 ILE n 1 25 ALA n 1 26 LEU n 1 27 ILE n 1 28 ASP n 1 29 SER n 1 30 ALA n 1 31 LEU n 1 32 GLU n 1 33 ILE n 1 34 LYS n 1 35 LYS n 1 36 THR n 1 37 GLU n 1 38 ILE n 1 39 GLU n 1 40 ALA n 1 41 LYS n 1 42 VAL n 1 43 GLN n 1 44 ILE n 1 45 SER n 1 46 ASP n 1 47 PRO n 1 48 SER n 1 49 LYS n 1 50 ILE n 1 51 GLN n 1 52 ASP n 1 53 PHE n 1 54 LEU n 1 55 ASN n 1 56 GLN n 1 57 GLU n 1 58 THR n 1 59 ASN n 1 60 THR n 1 61 PHE n 1 62 LYS n 1 63 GLN n 1 64 MET n 1 65 VAL n 1 66 GLU n 1 67 LYS n 1 68 ILE n 1 69 LYS n 1 70 LYS n 1 71 SER n 1 72 GLY n 1 73 ALA n 1 74 ASN n 1 75 VAL n 1 76 VAL n 1 77 LEU n 1 78 CYS n 1 79 GLN n 1 80 LYS n 1 81 GLY n 1 82 ILE n 1 83 ASP n 1 84 ASP n 1 85 VAL n 1 86 ALA n 1 87 GLN n 1 88 HIS n 1 89 TYR n 1 90 LEU n 1 91 ALA n 1 92 LYS n 1 93 GLU n 1 94 GLY n 1 95 ILE n 1 96 TYR n 1 97 ALA n 1 98 VAL n 1 99 ARG n 1 100 ARG n 1 101 VAL n 1 102 LYS n 1 103 LYS n 1 104 SER n 1 105 ASP n 1 106 MET n 1 107 GLU n 1 108 LYS n 1 109 LEU n 1 110 ALA n 1 111 LYS n 1 112 ALA n 1 113 THR n 1 114 GLY n 1 115 ALA n 1 116 LYS n 1 117 ILE n 1 118 VAL n 1 119 THR n 1 120 ASP n 1 121 LEU n 1 122 ASP n 1 123 ASP n 1 124 LEU n 1 125 THR n 1 126 PRO n 1 127 SER n 1 128 VAL n 1 129 LEU n 1 130 GLY n 1 131 GLU n 1 132 ALA n 1 133 GLU n 1 134 THR n 1 135 VAL n 1 136 GLU n 1 137 GLU n 1 138 ARG n 1 139 LYS n 1 140 ILE n 1 141 GLY n 1 142 ASP n 1 143 ASP n 1 144 ARG n 1 145 MET n 1 146 THR n 1 147 PHE n 1 148 VAL n 1 149 MET n 1 150 GLY n 1 151 CYS n 1 152 LYS n 1 153 ASN n 1 154 HIS n 1 155 HIS n 1 156 HIS n 1 157 HIS n 1 158 HIS n 1 159 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermoplasma _entity_src_gen.pdbx_gene_src_gene THSA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermoplasma acidophilum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2303 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc 25905 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location CYTOPLASM _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene THSA _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PRSET6A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code THSA_THEAC _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P48424 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MMTGQVPILVLKEGTQREQGKNAQRNNIEAAKAIADAVRTTLGPKGMDKMLVDSIGDIIISNDGATILKEMDVEHPTAKM IVEVSKAQDTAVGDGTTTAVVLSGELLKQAETLLDQGVHPTVISNGYRLAVNEARKIIDEIAEKSTDDATLRKIALTALS GKNTGLSNDFLADLVVKAVNAVAEVRDGKTIVDTANIKVDKKNGGSVNDTQFISGIVIDKEKVHSKMPDVVKNAKIALID SALEIKKTEIEAKVQISDPSKIQDFLNQETNTFKQMVEKIKKSGANVVLCQKGIDDVAQHYLAKEGIYAVRRVKKSDMEK LAKATGAKIVTDLDDLTPSVLGEAETVEERKIGDDRMTFVMGCKNPKAVSILIRGGTDHVVSEVERALNDAIRVVAITKE DGKFLWGGGAVEAELAMRLAKYANSVGGREQLAIEAFAKALEIIPRTLAENAGIDPINTLIKLKAEHEKGRISVGVDLDN NGVGDMKAKGVVDPLRVKTHALESAVEVATMILRIDDVIASKKSTPPSGQGGQGQGMPGGGMPEY ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ASX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 153 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P48424 _struct_ref_seq.db_align_beg 214 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 365 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 153 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1ASX _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.63 _exptl_crystal.density_percent_sol 70. _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 3.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 3.5' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1997-03 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GRAPHITE(002)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1ASX _reflns.observed_criterion_sigma_I -3. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 19. _reflns.d_resolution_high 2.8 _reflns.number_obs 6335 _reflns.number_all ? _reflns.percent_possible_obs 94.8 _reflns.pdbx_Rmerge_I_obs 0.0640000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 20.6 _reflns.B_iso_Wilson_estimate 39.9 _reflns.pdbx_redundancy 2.7 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.8 _reflns_shell.d_res_low ? _reflns_shell.percent_possible_all 71.8 _reflns_shell.Rmerge_I_obs 0.1450000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 6.9 _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1ASX _refine.ls_number_reflns_obs 6205 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 1000000. _refine.pdbx_data_cutoff_low_absF 0.001 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10. _refine.ls_d_res_high 2.8 _refine.ls_percent_reflns_obs 94.8 _refine.ls_R_factor_obs 0.2220000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2220000 _refine.ls_R_factor_R_free 0.2720000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 6.3 _refine.ls_number_reflns_R_free 390 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 36.0 _refine.aniso_B[1][1] 20.55 _refine.aniso_B[2][2] 20.55 _refine.aniso_B[3][3] 34.00 _refine.aniso_B[1][2] 14.18 _refine.aniso_B[1][3] 0.0 _refine.aniso_B[2][3] 0.0 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method RFREE _refine.details ? _refine.pdbx_starting_model 'GLOBULAR DOMAIN PORTION OF CRYSTAL FORM A (PDB ENTRY 1ASS)' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details 'CONCENTRIC SHELLS' _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1ASX _refine_analyze.Luzzati_coordinate_error_obs 0.35 _refine_analyze.Luzzati_sigma_a_obs 0.39 _refine_analyze.Luzzati_d_res_low_obs 5.0 _refine_analyze.Luzzati_coordinate_error_free 0.44 _refine_analyze.Luzzati_sigma_a_free 0.41 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1175 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 1186 _refine_hist.d_res_high 2.8 _refine_hist.d_res_low 10. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.011 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.575 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 23.93 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.351 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.d_res_high 2.80 _refine_ls_shell.d_res_low 2.90 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.R_factor_R_work ? _refine_ls_shell.percent_reflns_obs 71.8 _refine_ls_shell.R_factor_R_free ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 2 ? ? 'X-RAY DIFFRACTION' # _struct.entry_id 1ASX _struct.title 'APICAL DOMAIN OF THE CHAPERONIN FROM THERMOPLASMA ACIDOPHILUM' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ASX _struct_keywords.pdbx_keywords CHAPERONIN _struct_keywords.text 'CHAPERONIN, HSP60, THERMOSOME, TCP1, GROEL, THERMOPLASMA ACIDOPHILUM, ATP-BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 35 ? GLN A 43 ? LYS A 35 GLN A 43 1 ? 9 HELX_P HELX_P2 2 PRO A 47 ? LYS A 67 ? PRO A 47 LYS A 67 5 ? 21 HELX_P HELX_P3 3 LYS A 69 ? SER A 71 ? LYS A 69 SER A 71 5 ? 3 HELX_P HELX_P4 4 ASP A 84 ? LYS A 92 ? ASP A 84 LYS A 92 1 ? 9 HELX_P HELX_P5 5 LYS A 103 ? THR A 113 ? LYS A 103 THR A 113 1 ? 11 HELX_P HELX_P6 6 LEU A 121 ? ASP A 123 ? LEU A 121 ASP A 123 5 ? 3 HELX_P HELX_P7 7 PRO A 126 ? VAL A 128 ? PRO A 126 VAL A 128 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? parallel B 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 4 ? ILE A 6 ? ILE A 4 ILE A 6 A 2 ASP A 143 ? MET A 149 ? ASP A 143 MET A 149 A 3 THR A 134 ? ILE A 140 ? THR A 134 ILE A 140 A 4 VAL A 18 ? LYS A 20 ? VAL A 18 LYS A 20 B 1 GLY A 130 ? ALA A 132 ? GLY A 130 ALA A 132 B 2 ALA A 22 ? ILE A 27 ? ALA A 22 ILE A 27 B 3 VAL A 75 ? CYS A 78 ? VAL A 75 CYS A 78 B 4 TYR A 96 ? VAL A 98 ? TYR A 96 VAL A 98 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 4 ? O ILE A 4 N VAL A 148 ? N VAL A 148 A 2 3 O ASP A 143 ? O ASP A 143 N ILE A 140 ? N ILE A 140 A 3 4 O VAL A 135 ? O VAL A 135 N VAL A 19 ? N VAL A 19 B 1 2 O GLY A 130 ? O GLY A 130 N ILE A 24 ? N ILE A 24 B 2 3 O ALA A 25 ? O ALA A 25 N VAL A 75 ? N VAL A 75 B 3 4 O VAL A 76 ? O VAL A 76 N TYR A 96 ? N TYR A 96 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id PO4 _struct_site.pdbx_auth_seq_id 160 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'BINDING SITE FOR RESIDUE PO4 A 160' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 GLU A 32 ? GLU A 32 . ? 1_555 ? 2 AC1 7 ILE A 33 ? ILE A 33 . ? 1_555 ? 3 AC1 7 PRO A 47 ? PRO A 47 . ? 4_556 ? 4 AC1 7 SER A 48 ? SER A 48 . ? 4_556 ? 5 AC1 7 ILE A 50 ? ILE A 50 . ? 4_556 ? 6 AC1 7 GLN A 51 ? GLN A 51 . ? 4_556 ? 7 AC1 7 ASP A 83 ? ASP A 83 . ? 1_555 ? # _database_PDB_matrix.entry_id 1ASX _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ASX _atom_sites.fract_transf_matrix[1][1] 0.012514 _atom_sites.fract_transf_matrix[1][2] 0.007225 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014450 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014235 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 MET 106 106 106 MET MET A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 MET 145 145 145 MET MET A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 MET 149 149 149 MET MET A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 CYS 151 151 151 CYS CYS A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 ASN 153 153 ? ? ? A . n A 1 154 HIS 154 154 ? ? ? A . n A 1 155 HIS 155 155 ? ? ? A . n A 1 156 HIS 156 156 ? ? ? A . n A 1 157 HIS 157 157 ? ? ? A . n A 1 158 HIS 158 158 ? ? ? A . n A 1 159 HIS 159 159 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PO4 1 160 7 PO4 PO4 A . C 3 HOH 1 161 1 HOH HOH A . C 3 HOH 2 162 2 HOH HOH A . C 3 HOH 3 163 3 HOH HOH A . C 3 HOH 4 164 4 HOH HOH A . C 3 HOH 5 165 5 HOH HOH A . C 3 HOH 6 166 6 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2610 ? 1 MORE -27 ? 1 'SSA (A^2)' 15140 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 70.2500000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-12-03 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_initial_refinement_model 3 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 4 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 5 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SOLOMON phasing . ? 1 X-PLOR 'model building' 3.851 ? 2 X-PLOR refinement 3.851 ? 3 DENZO 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 X-PLOR phasing 3.851 ? 6 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLY _pdbx_validate_rmsd_angle.auth_seq_id_1 3 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 GLY _pdbx_validate_rmsd_angle.auth_seq_id_2 3 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 GLY _pdbx_validate_rmsd_angle.auth_seq_id_3 3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 130.49 _pdbx_validate_rmsd_angle.angle_target_value 113.10 _pdbx_validate_rmsd_angle.angle_deviation 17.39 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 7 ? ? -71.69 26.10 2 1 SER A 13 ? ? -56.95 -90.05 3 1 LYS A 14 ? ? -65.96 27.25 4 1 ASN A 21 ? ? 62.54 62.43 5 1 LEU A 31 ? ? -97.76 52.66 6 1 LYS A 80 ? ? -106.19 -166.91 7 1 CYS A 151 ? ? -59.82 106.27 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A LYS 34 ? CD ? A LYS 34 CD 2 1 Y 0 A LYS 34 ? CE ? A LYS 34 CE 3 1 Y 0 A LYS 34 ? NZ ? A LYS 34 NZ 4 1 Y 0 A GLN 56 ? CD ? A GLN 56 CD 5 1 Y 0 A GLN 56 ? OE1 ? A GLN 56 OE1 6 1 Y 0 A GLN 56 ? NE2 ? A GLN 56 NE2 7 1 Y 0 A LYS 69 ? CD ? A LYS 69 CD 8 1 Y 0 A LYS 69 ? CE ? A LYS 69 CE 9 1 Y 0 A LYS 69 ? NZ ? A LYS 69 NZ 10 1 Y 0 A LYS 70 ? CG ? A LYS 70 CG 11 1 Y 0 A LYS 70 ? CD ? A LYS 70 CD 12 1 Y 0 A LYS 70 ? CE ? A LYS 70 CE 13 1 Y 0 A LYS 70 ? NZ ? A LYS 70 NZ 14 1 Y 0 A LYS 103 ? CD ? A LYS 103 CD 15 1 Y 0 A LYS 103 ? CE ? A LYS 103 CE 16 1 Y 0 A LYS 103 ? NZ ? A LYS 103 NZ 17 1 Y 0 A LYS 116 ? CD ? A LYS 116 CD 18 1 Y 0 A LYS 116 ? CE ? A LYS 116 CE 19 1 Y 0 A LYS 116 ? NZ ? A LYS 116 NZ 20 1 Y 0 A LYS 139 ? CD ? A LYS 139 CD 21 1 Y 0 A LYS 139 ? CE ? A LYS 139 CE 22 1 Y 0 A LYS 139 ? NZ ? A LYS 139 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 153 ? A ASN 153 2 1 Y 1 A HIS 154 ? A HIS 154 3 1 Y 1 A HIS 155 ? A HIS 155 4 1 Y 1 A HIS 156 ? A HIS 156 5 1 Y 1 A HIS 157 ? A HIS 157 6 1 Y 1 A HIS 158 ? A HIS 158 7 1 Y 1 A HIS 159 ? A HIS 159 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHATE ION' PO4 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1ASS _pdbx_initial_refinement_model.details 'GLOBULAR DOMAIN PORTION OF CRYSTAL FORM A (PDB ENTRY 1ASS)' #