data_1ATX # _entry.id 1ATX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ATX pdb_00001atx 10.2210/pdb1atx/pdb WWPDB D_1000171253 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ATX _pdbx_database_status.recvd_initial_deposition_date 1990-05-14 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Billeter, M.' 1 'Widmer, H.' 2 'Wuthrich, K.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Three-dimensional structure of the neurotoxin ATX Ia from Anemonia sulcata in aqueous solution determined by nuclear magnetic resonance spectroscopy. ; Proteins 6 357 371 1989 PSFGEY US 0887-3585 0867 ? 2576133 10.1002/prot.340060403 1 ;The Secondary Structure of the Toxin Atx Ia from Anemonia Sulcata in Aqueous Solution Determined on the Basis of Complete Sequence-Specific 1H-NMR Assignments ; Eur.J.Biochem. 171 177 ? 1988 EJBCAI IX 0014-2956 0262 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Widmer, H.' 1 ? primary 'Billeter, M.' 2 ? primary 'Wuthrich, K.' 3 ? 1 'Widmer, H.' 4 ? 1 'Wagner, G.' 5 ? 1 'Schweitz, H.' 6 ? 1 'Lazdunski, M.' 7 ? 1 'Wuthrich, K.' 8 ? # _cell.entry_id 1ATX _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ATX _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ATX IA' _entity.formula_weight 4818.481 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GAACLCKSDGPNTRGNSMSGTIWVFGCPSGWNNCEGRAIIGYCCKQ _entity_poly.pdbx_seq_one_letter_code_can GAACLCKSDGPNTRGNSMSGTIWVFGCPSGWNNCEGRAIIGYCCKQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 ALA n 1 4 CYS n 1 5 LEU n 1 6 CYS n 1 7 LYS n 1 8 SER n 1 9 ASP n 1 10 GLY n 1 11 PRO n 1 12 ASN n 1 13 THR n 1 14 ARG n 1 15 GLY n 1 16 ASN n 1 17 SER n 1 18 MET n 1 19 SER n 1 20 GLY n 1 21 THR n 1 22 ILE n 1 23 TRP n 1 24 VAL n 1 25 PHE n 1 26 GLY n 1 27 CYS n 1 28 PRO n 1 29 SER n 1 30 GLY n 1 31 TRP n 1 32 ASN n 1 33 ASN n 1 34 CYS n 1 35 GLU n 1 36 GLY n 1 37 ARG n 1 38 ALA n 1 39 ILE n 1 40 ILE n 1 41 GLY n 1 42 TYR n 1 43 CYS n 1 44 CYS n 1 45 LYS n 1 46 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'snake-locks sea anemone' _entity_src_gen.gene_src_genus Anemonia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Anemonia sulcata' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6108 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TXA1_ANESU _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01533 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code GAACLCKSDGPNTRGNSMSGTIWVFGCPSGWNNCEGRAIIGYCCKQ _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ATX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 46 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01533 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 46 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 46 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1ATX _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 8 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name Amber _pdbx_nmr_software.version ? _pdbx_nmr_software.authors PEARLMAN,CASE,CALDWELL,ROSS,CHEATHAM,FERGUSON,SEIBEL,SINGH,WEINER,KOLLMAN _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1ATX _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1ATX _struct.title ;THREE-DIMENSIONAL STRUCTURE OF THE NEUROTOXIN ATX IA FROM ANEMONIA SULCATA IN AQUEOUS SOLUTION DETERMINED BY NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ATX _struct_keywords.pdbx_keywords 'SEA ANEMONE TOXIN' _struct_keywords.text 'SEA ANEMONE TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 43 SG ? ? A CYS 4 A CYS 43 1_555 ? ? ? ? ? ? ? 2.068 ? ? disulf2 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 6 A CYS 34 1_555 ? ? ? ? ? ? ? 2.106 ? ? disulf3 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 27 A CYS 44 1_555 ? ? ? ? ? ? ? 2.066 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S1 2 3 ? anti-parallel S1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 ALA A 2 ? LYS A 7 ? ALA A 2 LYS A 7 S1 2 SER A 19 ? VAL A 24 ? SER A 19 VAL A 24 S1 3 GLY A 41 ? GLN A 46 ? GLY A 41 GLN A 46 S1 4 TRP A 31 ? CYS A 34 ? TRP A 31 CYS A 34 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 O CYS A 4 ? O CYS A 4 N GLY A 20 ? N GLY A 20 S1 2 3 O THR A 21 ? O THR A 21 N CYS A 44 ? N CYS A 44 S1 3 4 O LYS A 45 ? O LYS A 45 N ASN A 32 ? N ASN A 32 # _database_PDB_matrix.entry_id 1ATX _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ATX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLN 46 46 46 GLN GLN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1991-04-15 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 CA A CYS 34 ? ? CB A CYS 34 ? ? SG A CYS 34 ? ? 120.90 114.20 6.70 1.10 N 2 3 CA A CYS 6 ? ? CB A CYS 6 ? ? SG A CYS 6 ? ? 121.49 114.20 7.29 1.10 N 3 4 CB A TYR 42 ? ? CG A TYR 42 ? ? CD2 A TYR 42 ? ? 117.21 121.00 -3.79 0.60 N 4 4 CA A CYS 44 ? ? CB A CYS 44 ? ? SG A CYS 44 ? ? 123.77 114.20 9.57 1.10 N 5 5 CA A CYS 4 ? ? CB A CYS 4 ? ? SG A CYS 4 ? ? 125.46 114.20 11.26 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 16 ? ? -121.13 -85.48 2 1 SER A 17 ? ? -77.09 25.28 3 1 SER A 19 ? ? -140.50 -2.58 4 1 VAL A 24 ? ? -71.36 -81.15 5 1 ALA A 38 ? ? 177.76 48.29 6 2 ASN A 12 ? ? -58.35 104.64 7 2 ASN A 16 ? ? -126.93 -91.81 8 2 VAL A 24 ? ? -97.68 -72.08 9 2 PHE A 25 ? ? -140.47 29.68 10 2 ASN A 33 ? ? 67.18 81.05 11 2 GLU A 35 ? ? -174.22 125.16 12 2 ARG A 37 ? ? -151.74 65.82 13 2 ALA A 38 ? ? -176.53 35.99 14 3 SER A 8 ? ? -84.30 30.60 15 3 PHE A 25 ? ? -122.54 -90.92 16 3 ALA A 38 ? ? -177.90 40.62 17 4 ASN A 12 ? ? -69.60 85.19 18 4 ASN A 16 ? ? -122.53 -55.71 19 4 SER A 19 ? ? -163.27 10.08 20 4 PHE A 25 ? ? -86.56 -89.35 21 4 ALA A 38 ? ? -178.51 41.76 22 4 ILE A 40 ? ? -90.05 -67.63 23 5 SER A 8 ? ? -172.22 86.43 24 5 ASN A 16 ? ? -122.10 -95.46 25 5 SER A 17 ? ? 60.46 -64.34 26 5 ARG A 37 ? ? -148.59 53.92 27 5 ILE A 40 ? ? -97.58 -64.59 28 6 THR A 13 ? ? 36.74 58.93 29 6 SER A 17 ? ? 163.21 -47.71 30 6 PHE A 25 ? ? -107.09 -68.07 31 6 ASN A 32 ? ? -172.16 141.82 32 6 ASN A 33 ? ? 89.76 80.49 33 6 ARG A 37 ? ? 69.77 157.14 34 7 SER A 8 ? ? -174.88 82.28 35 7 ASP A 9 ? ? -76.70 -149.74 36 7 ASN A 12 ? ? -151.96 -133.41 37 7 THR A 13 ? ? -61.13 -174.78 38 7 ASN A 16 ? ? -106.05 -148.68 39 7 PHE A 25 ? ? -132.06 -73.33 40 7 ARG A 37 ? ? -115.88 54.07 41 7 ALA A 38 ? ? -176.76 44.35 42 8 SER A 8 ? ? -76.79 30.38 43 8 ASN A 12 ? ? -63.51 81.73 44 8 SER A 17 ? ? 73.83 -32.92 45 8 SER A 19 ? ? -166.01 -23.19 46 8 PHE A 25 ? ? -85.55 -76.81 47 8 ARG A 37 ? ? -96.29 51.78 48 8 ALA A 38 ? ? -167.66 44.76 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 37 ? ? 0.155 'SIDE CHAIN' 2 2 ARG A 14 ? ? 0.089 'SIDE CHAIN' 3 3 ARG A 37 ? ? 0.134 'SIDE CHAIN' 4 3 TYR A 42 ? ? 0.076 'SIDE CHAIN' 5 4 ARG A 14 ? ? 0.099 'SIDE CHAIN' 6 4 TYR A 42 ? ? 0.143 'SIDE CHAIN' 7 5 TYR A 42 ? ? 0.080 'SIDE CHAIN' 8 6 TYR A 42 ? ? 0.072 'SIDE CHAIN' 9 8 ARG A 14 ? ? 0.102 'SIDE CHAIN' 10 8 ARG A 37 ? ? 0.098 'SIDE CHAIN' #