data_1AW5 # _entry.id 1AW5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1AW5 pdb_00001aw5 10.2210/pdb1aw5/pdb WWPDB D_1000171330 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1AW5 _pdbx_database_status.recvd_initial_deposition_date 1997-10-09 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Erskine, P.T.' 1 'Cooper, J.B.' 2 'Wood, S.P.' 3 # _citation.id primary _citation.title 'X-ray structure of 5-aminolaevulinate dehydratase, a hybrid aldolase.' _citation.journal_abbrev Nat.Struct.Biol. _citation.journal_volume 4 _citation.page_first 1025 _citation.page_last 1031 _citation.year 1997 _citation.journal_id_ASTM NSBIEW _citation.country US _citation.journal_id_ISSN 1072-8368 _citation.journal_id_CSD 2024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9406553 _citation.pdbx_database_id_DOI 10.1038/nsb1297-1025 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Erskine, P.T.' 1 ? primary 'Senior, N.' 2 ? primary 'Awan, S.' 3 ? primary 'Lambert, R.' 4 ? primary 'Lewis, G.' 5 ? primary 'Tickle, I.J.' 6 ? primary 'Sarwar, M.' 7 ? primary 'Spencer, P.' 8 ? primary 'Thomas, P.' 9 ? primary 'Warren, M.J.' 10 ? primary 'Shoolingin-Jordan, P.M.' 11 ? primary 'Wood, S.P.' 12 ? primary 'Cooper, J.B.' 13 ? # _cell.entry_id 1AW5 _cell.length_a 102.500 _cell.length_b 102.500 _cell.length_c 168.300 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1AW5 _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '5-AMINOLEVULINATE DEHYDRATASE' 37620.199 1 4.2.1.24 M272V ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 water nat water 18.015 307 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PORPHOBILINOGEN SYNTHASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)HTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKN(MSE)LIFPLFISDNPDDFTEIDSAPNINRIGVNRLK DYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIRFIREKFPELYIICDVCLCEYTSHGHCGVLYDDGTI NRERSVSRLAAVAVNYAKAGAHCVAPSD(MSE)IDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPARDAACSAPS NGDRKCYQLPPAGRGLARRALERD(MSE)SEGADGIIVKPSTFYLDIVRDASEICKDLPICAYHVSGEYA(MSE)LHAAA EKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDE ; _entity_poly.pdbx_seq_one_letter_code_can ;MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSAPNINRIGVNRLKDYLKPLVA KGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIRFIREKFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSR LAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPARDAACSAPSNGDRKCYQLPPA GRGLARRALERDMSEGADGIIVKPSTFYLDIVRDASEICKDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLR AGARLIITYLAPEFLDWLDE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 HIS n 1 3 THR n 1 4 ALA n 1 5 GLU n 1 6 PHE n 1 7 LEU n 1 8 GLU n 1 9 THR n 1 10 GLU n 1 11 PRO n 1 12 THR n 1 13 GLU n 1 14 ILE n 1 15 SER n 1 16 SER n 1 17 VAL n 1 18 LEU n 1 19 ALA n 1 20 GLY n 1 21 GLY n 1 22 TYR n 1 23 ASN n 1 24 HIS n 1 25 PRO n 1 26 LEU n 1 27 LEU n 1 28 ARG n 1 29 GLN n 1 30 TRP n 1 31 GLN n 1 32 SER n 1 33 GLU n 1 34 ARG n 1 35 GLN n 1 36 LEU n 1 37 THR n 1 38 LYS n 1 39 ASN n 1 40 MSE n 1 41 LEU n 1 42 ILE n 1 43 PHE n 1 44 PRO n 1 45 LEU n 1 46 PHE n 1 47 ILE n 1 48 SER n 1 49 ASP n 1 50 ASN n 1 51 PRO n 1 52 ASP n 1 53 ASP n 1 54 PHE n 1 55 THR n 1 56 GLU n 1 57 ILE n 1 58 ASP n 1 59 SER n 1 60 ALA n 1 61 PRO n 1 62 ASN n 1 63 ILE n 1 64 ASN n 1 65 ARG n 1 66 ILE n 1 67 GLY n 1 68 VAL n 1 69 ASN n 1 70 ARG n 1 71 LEU n 1 72 LYS n 1 73 ASP n 1 74 TYR n 1 75 LEU n 1 76 LYS n 1 77 PRO n 1 78 LEU n 1 79 VAL n 1 80 ALA n 1 81 LYS n 1 82 GLY n 1 83 LEU n 1 84 ARG n 1 85 SER n 1 86 VAL n 1 87 ILE n 1 88 LEU n 1 89 PHE n 1 90 GLY n 1 91 VAL n 1 92 PRO n 1 93 LEU n 1 94 ILE n 1 95 PRO n 1 96 GLY n 1 97 THR n 1 98 LYS n 1 99 ASP n 1 100 PRO n 1 101 VAL n 1 102 GLY n 1 103 THR n 1 104 ALA n 1 105 ALA n 1 106 ASP n 1 107 ASP n 1 108 PRO n 1 109 ALA n 1 110 GLY n 1 111 PRO n 1 112 VAL n 1 113 ILE n 1 114 GLN n 1 115 GLY n 1 116 ILE n 1 117 ARG n 1 118 PHE n 1 119 ILE n 1 120 ARG n 1 121 GLU n 1 122 LYS n 1 123 PHE n 1 124 PRO n 1 125 GLU n 1 126 LEU n 1 127 TYR n 1 128 ILE n 1 129 ILE n 1 130 CYS n 1 131 ASP n 1 132 VAL n 1 133 CYS n 1 134 LEU n 1 135 CYS n 1 136 GLU n 1 137 TYR n 1 138 THR n 1 139 SER n 1 140 HIS n 1 141 GLY n 1 142 HIS n 1 143 CYS n 1 144 GLY n 1 145 VAL n 1 146 LEU n 1 147 TYR n 1 148 ASP n 1 149 ASP n 1 150 GLY n 1 151 THR n 1 152 ILE n 1 153 ASN n 1 154 ARG n 1 155 GLU n 1 156 ARG n 1 157 SER n 1 158 VAL n 1 159 SER n 1 160 ARG n 1 161 LEU n 1 162 ALA n 1 163 ALA n 1 164 VAL n 1 165 ALA n 1 166 VAL n 1 167 ASN n 1 168 TYR n 1 169 ALA n 1 170 LYS n 1 171 ALA n 1 172 GLY n 1 173 ALA n 1 174 HIS n 1 175 CYS n 1 176 VAL n 1 177 ALA n 1 178 PRO n 1 179 SER n 1 180 ASP n 1 181 MSE n 1 182 ILE n 1 183 ASP n 1 184 GLY n 1 185 ARG n 1 186 ILE n 1 187 ARG n 1 188 ASP n 1 189 ILE n 1 190 LYS n 1 191 ARG n 1 192 GLY n 1 193 LEU n 1 194 ILE n 1 195 ASN n 1 196 ALA n 1 197 ASN n 1 198 LEU n 1 199 ALA n 1 200 HIS n 1 201 LYS n 1 202 THR n 1 203 PHE n 1 204 VAL n 1 205 LEU n 1 206 SER n 1 207 TYR n 1 208 ALA n 1 209 ALA n 1 210 LYS n 1 211 PHE n 1 212 SER n 1 213 GLY n 1 214 ASN n 1 215 LEU n 1 216 TYR n 1 217 GLY n 1 218 PRO n 1 219 ALA n 1 220 ARG n 1 221 ASP n 1 222 ALA n 1 223 ALA n 1 224 CYS n 1 225 SER n 1 226 ALA n 1 227 PRO n 1 228 SER n 1 229 ASN n 1 230 GLY n 1 231 ASP n 1 232 ARG n 1 233 LYS n 1 234 CYS n 1 235 TYR n 1 236 GLN n 1 237 LEU n 1 238 PRO n 1 239 PRO n 1 240 ALA n 1 241 GLY n 1 242 ARG n 1 243 GLY n 1 244 LEU n 1 245 ALA n 1 246 ARG n 1 247 ARG n 1 248 ALA n 1 249 LEU n 1 250 GLU n 1 251 ARG n 1 252 ASP n 1 253 MSE n 1 254 SER n 1 255 GLU n 1 256 GLY n 1 257 ALA n 1 258 ASP n 1 259 GLY n 1 260 ILE n 1 261 ILE n 1 262 VAL n 1 263 LYS n 1 264 PRO n 1 265 SER n 1 266 THR n 1 267 PHE n 1 268 TYR n 1 269 LEU n 1 270 ASP n 1 271 ILE n 1 272 VAL n 1 273 ARG n 1 274 ASP n 1 275 ALA n 1 276 SER n 1 277 GLU n 1 278 ILE n 1 279 CYS n 1 280 LYS n 1 281 ASP n 1 282 LEU n 1 283 PRO n 1 284 ILE n 1 285 CYS n 1 286 ALA n 1 287 TYR n 1 288 HIS n 1 289 VAL n 1 290 SER n 1 291 GLY n 1 292 GLU n 1 293 TYR n 1 294 ALA n 1 295 MSE n 1 296 LEU n 1 297 HIS n 1 298 ALA n 1 299 ALA n 1 300 ALA n 1 301 GLU n 1 302 LYS n 1 303 GLY n 1 304 VAL n 1 305 VAL n 1 306 ASP n 1 307 LEU n 1 308 LYS n 1 309 THR n 1 310 ILE n 1 311 ALA n 1 312 PHE n 1 313 GLU n 1 314 SER n 1 315 HIS n 1 316 GLN n 1 317 GLY n 1 318 PHE n 1 319 LEU n 1 320 ARG n 1 321 ALA n 1 322 GLY n 1 323 ALA n 1 324 ARG n 1 325 LEU n 1 326 ILE n 1 327 ILE n 1 328 THR n 1 329 TYR n 1 330 LEU n 1 331 ALA n 1 332 PRO n 1 333 GLU n 1 334 PHE n 1 335 LEU n 1 336 ASP n 1 337 TRP n 1 338 LEU n 1 339 ASP n 1 340 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene HEM2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line B834 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location CYTOSOL _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'B834 (DE3) PLYSS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PUC18 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HEM2_YEAST _struct_ref.pdbx_db_accession P05373 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1AW5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 340 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P05373 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 340 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 340 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1AW5 MSE A 40 ? UNP P05373 MET 40 'engineered mutation' 40 1 1 1AW5 ALA A 60 ? UNP P05373 LEU 60 conflict 60 2 1 1AW5 ARG A 117 ? UNP P05373 LYS 117 conflict 117 3 1 1AW5 LYS A 122 ? UNP P05373 TYR 122 conflict 122 4 1 1AW5 MSE A 181 ? UNP P05373 MET 181 'engineered mutation' 181 5 1 1AW5 ALA A 219 ? UNP P05373 PHE 219 conflict 219 6 1 1AW5 MSE A 253 ? UNP P05373 MET 253 'engineered mutation' 253 7 1 1AW5 VAL A 272 ? UNP P05373 MET 272 'engineered mutation' 272 8 1 1AW5 MSE A 295 ? UNP P05373 MET 295 'engineered mutation' 295 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1AW5 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 2 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.94 _exptl_crystal.density_percent_sol 59.0 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_pH_range 7.0-8.5 _exptl_crystal_grow.pdbx_details ;ENZYME CONCENTRATION 1 MG/ML, PH 7.0 - 8.5, BUFFER 0.2 M TRIS-HCL, PRECIPITANT PEG 6000 (<10%), 70 MICROMOLAR ZINC SULPHATE, 6 MM BETA-MERCAPTOETHANOL, HANGING DROPS., pH 8.0, vapor diffusion - hanging drop ; # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1996-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97913 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM14' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM14 _diffrn_source.pdbx_wavelength 0.97913 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1AW5 _reflns.observed_criterion_sigma_I 3.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 35.6 _reflns.d_resolution_high 2.3 _reflns.number_obs 459575 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.0880000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 6.6 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 16.8 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_CC_half ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_Rrim_I_all ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.38 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.1780000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.9 _reflns_shell.pdbx_redundancy 9.3 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? # _refine.entry_id 1AW5 _refine.ls_number_reflns_obs 19072 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 3.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6 _refine.ls_d_res_high 2.3 _refine.ls_percent_reflns_obs 99.9 _refine.ls_R_factor_obs 0.1980000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free 0.2700000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2527 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 307 _refine_hist.number_atoms_total 2836 _refine_hist.d_res_high 2.3 _refine_hist.d_res_low 6 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.011 ? ? ? 'X-RAY DIFFRACTION' ? p_angle_d 0.023 ? ? ? 'X-RAY DIFFRACTION' ? p_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_d ? ? ? ? 'X-RAY DIFFRACTION' ? p_hb_or_metal_coord ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_plane_restr ? ? ? ? 'X-RAY DIFFRACTION' ? p_chiral_restr ? ? ? ? 'X-RAY DIFFRACTION' ? p_singtor_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_multtor_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xhyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_staggered_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_orthonormal_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_transverse_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_special_tor ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1AW5 _struct.title '5-AMINOLEVULINATE DEHYDRATASE FROM SACCHAROMYCES CEREVISIAE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1AW5 _struct_keywords.pdbx_keywords DEHYDRATASE _struct_keywords.text 'DEHYDRATASE, TETRAPYRROLE BIOSYNTHESIS, ALDOLASE, TIM-BARREL OCTAMER' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 14 ? SER A 16 ? ILE A 14 SER A 16 5 ? 3 HELX_P HELX_P2 2 ALA A 19 ? GLY A 21 ? ALA A 19 GLY A 21 5 ? 3 HELX_P HELX_P3 3 PRO A 25 ? TRP A 30 ? PRO A 25 TRP A 30 5 ? 6 HELX_P HELX_P4 4 LYS A 38 ? MSE A 40 ? LYS A 38 MSE A 40 5 ? 3 HELX_P HELX_P5 5 LEU A 71 ? ALA A 80 ? LEU A 71 ALA A 80 1 ? 10 HELX_P HELX_P6 6 THR A 103 ? ASP A 106 ? THR A 103 ASP A 106 5 ? 4 HELX_P HELX_P7 7 PRO A 111 ? LYS A 122 ? PRO A 111 LYS A 122 1 ? 12 HELX_P HELX_P8 8 ARG A 154 ? ALA A 171 ? ARG A 154 ALA A 171 1 ? 18 HELX_P HELX_P9 9 ARG A 185 ? ASN A 195 ? ARG A 185 ASN A 195 1 ? 11 HELX_P HELX_P10 10 ARG A 242 ? SER A 254 ? ARG A 242 SER A 254 1 ? 13 HELX_P HELX_P11 11 THR A 266 ? ILE A 278 ? THR A 266 ILE A 278 5 ? 13 HELX_P HELX_P12 12 SER A 290 ? GLU A 301 ? SER A 290 GLU A 301 1 ? 12 HELX_P HELX_P13 13 LEU A 307 ? ALA A 321 ? LEU A 307 ALA A 321 1 ? 15 HELX_P HELX_P14 14 ALA A 331 ? TRP A 337 ? ALA A 331 TRP A 337 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 1 C ? ? ? 1_555 A HIS 2 N ? ? A MSE 1 A HIS 2 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? A ASN 39 C ? ? ? 1_555 A MSE 40 N ? ? A ASN 39 A MSE 40 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale3 covale both ? A MSE 40 C ? ? ? 1_555 A LEU 41 N ? ? A MSE 40 A LEU 41 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale4 covale both ? A ASP 180 C ? ? ? 1_555 A MSE 181 N ? ? A ASP 180 A MSE 181 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale5 covale both ? A MSE 181 C ? ? ? 1_555 A ILE 182 N ? ? A MSE 181 A ILE 182 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale6 covale both ? A ASP 252 C ? ? ? 1_555 A MSE 253 N ? ? A ASP 252 A MSE 253 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale7 covale both ? A MSE 253 C ? ? ? 1_555 A SER 254 N ? ? A MSE 253 A SER 254 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale8 covale both ? A ALA 294 C ? ? ? 1_555 A MSE 295 N ? ? A ALA 294 A MSE 295 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale9 covale both ? A MSE 295 C ? ? ? 1_555 A LEU 296 N ? ? A MSE 295 A LEU 296 1_555 ? ? ? ? ? ? ? 1.328 ? ? metalc1 metalc ? ? A CYS 133 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 133 A ZN 400 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc2 metalc ? ? A CYS 135 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 135 A ZN 400 1_555 ? ? ? ? ? ? ? 2.282 ? ? metalc3 metalc ? ? A CYS 143 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 143 A ZN 400 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc4 metalc ? ? A CYS 234 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 234 A ZN 401 1_555 ? ? ? ? ? ? ? 2.274 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 263 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 263 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 264 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 264 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.67 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel B 1 2 ? anti-parallel C 1 2 ? parallel C 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 43 ? SER A 48 ? PHE A 43 SER A 48 A 2 SER A 85 ? VAL A 91 ? SER A 85 VAL A 91 A 3 TYR A 127 ? VAL A 132 ? TYR A 127 VAL A 132 A 4 CYS A 175 ? PRO A 178 ? CYS A 175 PRO A 178 B 1 PHE A 54 ? GLU A 56 ? PHE A 54 GLU A 56 B 2 ASN A 64 ? ILE A 66 ? ASN A 64 ILE A 66 C 1 GLY A 259 ? VAL A 262 ? GLY A 259 VAL A 262 C 2 PRO A 283 ? TYR A 287 ? PRO A 283 TYR A 287 C 3 LEU A 325 ? ILE A 327 ? LEU A 325 ILE A 327 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 43 ? O PHE A 43 N ILE A 87 ? N ILE A 87 A 2 3 O VAL A 86 ? O VAL A 86 N TYR A 127 ? N TYR A 127 A 3 4 O CYS A 130 ? O CYS A 130 N CYS A 175 ? N CYS A 175 B 1 2 O THR A 55 ? O THR A 55 N ARG A 65 ? N ARG A 65 C 1 2 O ILE A 260 ? O ILE A 260 N PRO A 283 ? N PRO A 283 C 2 3 O ALA A 286 ? O ALA A 286 N LEU A 325 ? N LEU A 325 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details CAT Unknown ? ? ? ? 2 'LYS 263 FORMS SCHIFF BASE WITH SUBSTRATE. LYS 210 IS SPATIALLY ADJACENT AND IS ALSO IMPLICATED IN CATALYSIS.' AC1 Software A ZN 400 ? 3 'BINDING SITE FOR RESIDUE ZN A 400' AC2 Software A ZN 401 ? 2 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 CAT 2 LYS A 263 ? LYS A 263 . ? 1_555 ? 2 CAT 2 LYS A 210 ? LYS A 210 . ? 1_555 ? 3 AC1 3 CYS A 133 ? CYS A 133 . ? 1_555 ? 4 AC1 3 CYS A 135 ? CYS A 135 . ? 1_555 ? 5 AC1 3 CYS A 143 ? CYS A 143 . ? 1_555 ? 6 AC2 2 HIS A 142 ? HIS A 142 . ? 1_555 ? 7 AC2 2 CYS A 234 ? CYS A 234 . ? 1_555 ? # _database_PDB_matrix.entry_id 1AW5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1AW5 _atom_sites.fract_transf_matrix[1][1] 0.009756 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009756 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005942 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 HIS 2 2 2 HIS HIS A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 MSE 40 40 40 MSE MSE A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 CYS 133 133 133 CYS CYS A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 CYS 135 135 135 CYS CYS A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 CYS 143 143 143 CYS CYS A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 SER 159 159 159 SER SER A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 ASN 167 167 167 ASN ASN A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 HIS 174 174 174 HIS HIS A . n A 1 175 CYS 175 175 175 CYS CYS A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 PRO 178 178 178 PRO PRO A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 MSE 181 181 181 MSE MSE A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 ASP 183 183 183 ASP ASP A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 ARG 187 187 187 ARG ARG A . n A 1 188 ASP 188 188 188 ASP ASP A . n A 1 189 ILE 189 189 189 ILE ILE A . n A 1 190 LYS 190 190 190 LYS LYS A . n A 1 191 ARG 191 191 191 ARG ARG A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 ASN 195 195 195 ASN ASN A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 ASN 197 197 197 ASN ASN A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 HIS 200 200 200 HIS HIS A . n A 1 201 LYS 201 201 201 LYS LYS A . n A 1 202 THR 202 202 202 THR THR A . n A 1 203 PHE 203 203 203 PHE PHE A . n A 1 204 VAL 204 204 204 VAL VAL A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 SER 206 206 206 SER SER A . n A 1 207 TYR 207 207 207 TYR TYR A . n A 1 208 ALA 208 208 208 ALA ALA A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 PHE 211 211 211 PHE PHE A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 ASN 214 214 214 ASN ASN A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 TYR 216 216 216 TYR TYR A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 PRO 218 218 218 PRO PRO A . n A 1 219 ALA 219 219 219 ALA ALA A . n A 1 220 ARG 220 220 ? ? ? A . n A 1 221 ASP 221 221 ? ? ? A . n A 1 222 ALA 222 222 ? ? ? A . n A 1 223 ALA 223 223 ? ? ? A . n A 1 224 CYS 224 224 ? ? ? A . n A 1 225 SER 225 225 ? ? ? A . n A 1 226 ALA 226 226 ? ? ? A . n A 1 227 PRO 227 227 ? ? ? A . n A 1 228 SER 228 228 ? ? ? A . n A 1 229 ASN 229 229 ? ? ? A . n A 1 230 GLY 230 230 ? ? ? A . n A 1 231 ASP 231 231 ? ? ? A . n A 1 232 ARG 232 232 ? ? ? A . n A 1 233 LYS 233 233 ? ? ? A . n A 1 234 CYS 234 234 234 CYS CYS A . n A 1 235 TYR 235 235 235 TYR TYR A . n A 1 236 GLN 236 236 236 GLN GLN A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 PRO 238 238 238 PRO PRO A . n A 1 239 PRO 239 239 239 PRO PRO A . n A 1 240 ALA 240 240 240 ALA ALA A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 ARG 242 242 242 ARG ARG A . n A 1 243 GLY 243 243 243 GLY GLY A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 ALA 245 245 245 ALA ALA A . n A 1 246 ARG 246 246 246 ARG ARG A . n A 1 247 ARG 247 247 247 ARG ARG A . n A 1 248 ALA 248 248 248 ALA ALA A . n A 1 249 LEU 249 249 249 LEU LEU A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 ARG 251 251 251 ARG ARG A . n A 1 252 ASP 252 252 252 ASP ASP A . n A 1 253 MSE 253 253 253 MSE MSE A . n A 1 254 SER 254 254 254 SER SER A . n A 1 255 GLU 255 255 255 GLU GLU A . n A 1 256 GLY 256 256 256 GLY GLY A . n A 1 257 ALA 257 257 257 ALA ALA A . n A 1 258 ASP 258 258 258 ASP ASP A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 ILE 260 260 260 ILE ILE A . n A 1 261 ILE 261 261 261 ILE ILE A . n A 1 262 VAL 262 262 262 VAL VAL A . n A 1 263 LYS 263 263 263 LYS LYS A . n A 1 264 PRO 264 264 264 PRO PRO A . n A 1 265 SER 265 265 265 SER SER A . n A 1 266 THR 266 266 266 THR THR A . n A 1 267 PHE 267 267 267 PHE PHE A . n A 1 268 TYR 268 268 268 TYR TYR A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 ASP 270 270 270 ASP ASP A . n A 1 271 ILE 271 271 271 ILE ILE A . n A 1 272 VAL 272 272 272 VAL VAL A . n A 1 273 ARG 273 273 273 ARG ARG A . n A 1 274 ASP 274 274 274 ASP ASP A . n A 1 275 ALA 275 275 275 ALA ALA A . n A 1 276 SER 276 276 276 SER SER A . n A 1 277 GLU 277 277 277 GLU GLU A . n A 1 278 ILE 278 278 278 ILE ILE A . n A 1 279 CYS 279 279 279 CYS CYS A . n A 1 280 LYS 280 280 280 LYS LYS A . n A 1 281 ASP 281 281 281 ASP ASP A . n A 1 282 LEU 282 282 282 LEU LEU A . n A 1 283 PRO 283 283 283 PRO PRO A . n A 1 284 ILE 284 284 284 ILE ILE A . n A 1 285 CYS 285 285 285 CYS CYS A . n A 1 286 ALA 286 286 286 ALA ALA A . n A 1 287 TYR 287 287 287 TYR TYR A . n A 1 288 HIS 288 288 288 HIS HIS A . n A 1 289 VAL 289 289 289 VAL VAL A . n A 1 290 SER 290 290 290 SER SER A . n A 1 291 GLY 291 291 291 GLY GLY A . n A 1 292 GLU 292 292 292 GLU GLU A . n A 1 293 TYR 293 293 293 TYR TYR A . n A 1 294 ALA 294 294 294 ALA ALA A . n A 1 295 MSE 295 295 295 MSE MSE A . n A 1 296 LEU 296 296 296 LEU LEU A . n A 1 297 HIS 297 297 297 HIS HIS A . n A 1 298 ALA 298 298 298 ALA ALA A . n A 1 299 ALA 299 299 299 ALA ALA A . n A 1 300 ALA 300 300 300 ALA ALA A . n A 1 301 GLU 301 301 301 GLU GLU A . n A 1 302 LYS 302 302 302 LYS LYS A . n A 1 303 GLY 303 303 303 GLY GLY A . n A 1 304 VAL 304 304 304 VAL VAL A . n A 1 305 VAL 305 305 305 VAL VAL A . n A 1 306 ASP 306 306 306 ASP ASP A . n A 1 307 LEU 307 307 307 LEU LEU A . n A 1 308 LYS 308 308 308 LYS LYS A . n A 1 309 THR 309 309 309 THR THR A . n A 1 310 ILE 310 310 310 ILE ILE A . n A 1 311 ALA 311 311 311 ALA ALA A . n A 1 312 PHE 312 312 312 PHE PHE A . n A 1 313 GLU 313 313 313 GLU GLU A . n A 1 314 SER 314 314 314 SER SER A . n A 1 315 HIS 315 315 315 HIS HIS A . n A 1 316 GLN 316 316 316 GLN GLN A . n A 1 317 GLY 317 317 317 GLY GLY A . n A 1 318 PHE 318 318 318 PHE PHE A . n A 1 319 LEU 319 319 319 LEU LEU A . n A 1 320 ARG 320 320 320 ARG ARG A . n A 1 321 ALA 321 321 321 ALA ALA A . n A 1 322 GLY 322 322 322 GLY GLY A . n A 1 323 ALA 323 323 323 ALA ALA A . n A 1 324 ARG 324 324 324 ARG ARG A . n A 1 325 LEU 325 325 325 LEU LEU A . n A 1 326 ILE 326 326 326 ILE ILE A . n A 1 327 ILE 327 327 327 ILE ILE A . n A 1 328 THR 328 328 328 THR THR A . n A 1 329 TYR 329 329 329 TYR TYR A . n A 1 330 LEU 330 330 330 LEU LEU A . n A 1 331 ALA 331 331 331 ALA ALA A . n A 1 332 PRO 332 332 332 PRO PRO A . n A 1 333 GLU 333 333 333 GLU GLU A . n A 1 334 PHE 334 334 334 PHE PHE A . n A 1 335 LEU 335 335 335 LEU LEU A . n A 1 336 ASP 336 336 336 ASP ASP A . n A 1 337 TRP 337 337 337 TRP TRP A . n A 1 338 LEU 338 338 338 LEU LEU A . n A 1 339 ASP 339 339 339 ASP ASP A . n A 1 340 GLU 340 340 340 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 400 400 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . D 3 HOH 1 500 500 HOH HOH A . D 3 HOH 2 501 501 HOH HOH A . D 3 HOH 3 502 502 HOH HOH A . D 3 HOH 4 503 503 HOH HOH A . D 3 HOH 5 504 504 HOH HOH A . D 3 HOH 6 505 505 HOH HOH A . D 3 HOH 7 506 506 HOH HOH A . D 3 HOH 8 507 507 HOH HOH A . D 3 HOH 9 508 508 HOH HOH A . D 3 HOH 10 509 509 HOH HOH A . D 3 HOH 11 510 510 HOH HOH A . D 3 HOH 12 511 511 HOH HOH A . D 3 HOH 13 512 512 HOH HOH A . D 3 HOH 14 513 513 HOH HOH A . D 3 HOH 15 514 514 HOH HOH A . D 3 HOH 16 515 515 HOH HOH A . D 3 HOH 17 516 516 HOH HOH A . D 3 HOH 18 517 517 HOH HOH A . D 3 HOH 19 518 518 HOH HOH A . D 3 HOH 20 519 519 HOH HOH A . D 3 HOH 21 520 520 HOH HOH A . D 3 HOH 22 521 521 HOH HOH A . D 3 HOH 23 522 522 HOH HOH A . D 3 HOH 24 523 523 HOH HOH A . D 3 HOH 25 524 524 HOH HOH A . D 3 HOH 26 525 525 HOH HOH A . D 3 HOH 27 526 526 HOH HOH A . D 3 HOH 28 527 527 HOH HOH A . D 3 HOH 29 528 528 HOH HOH A . D 3 HOH 30 529 529 HOH HOH A . D 3 HOH 31 530 530 HOH HOH A . D 3 HOH 32 531 531 HOH HOH A . D 3 HOH 33 532 532 HOH HOH A . D 3 HOH 34 533 533 HOH HOH A . D 3 HOH 35 534 534 HOH HOH A . D 3 HOH 36 535 535 HOH HOH A . D 3 HOH 37 536 536 HOH HOH A . D 3 HOH 38 537 537 HOH HOH A . D 3 HOH 39 538 538 HOH HOH A . D 3 HOH 40 539 539 HOH HOH A . D 3 HOH 41 540 540 HOH HOH A . D 3 HOH 42 541 541 HOH HOH A . D 3 HOH 43 542 542 HOH HOH A . D 3 HOH 44 543 543 HOH HOH A . D 3 HOH 45 544 544 HOH HOH A . D 3 HOH 46 545 545 HOH HOH A . D 3 HOH 47 546 546 HOH HOH A . D 3 HOH 48 547 547 HOH HOH A . D 3 HOH 49 548 548 HOH HOH A . D 3 HOH 50 549 549 HOH HOH A . D 3 HOH 51 550 550 HOH HOH A . D 3 HOH 52 551 551 HOH HOH A . D 3 HOH 53 552 552 HOH HOH A . D 3 HOH 54 553 553 HOH HOH A . D 3 HOH 55 554 554 HOH HOH A . D 3 HOH 56 555 555 HOH HOH A . D 3 HOH 57 556 556 HOH HOH A . D 3 HOH 58 557 557 HOH HOH A . D 3 HOH 59 558 558 HOH HOH A . D 3 HOH 60 559 559 HOH HOH A . D 3 HOH 61 560 560 HOH HOH A . D 3 HOH 62 561 561 HOH HOH A . D 3 HOH 63 562 562 HOH HOH A . D 3 HOH 64 563 563 HOH HOH A . D 3 HOH 65 564 564 HOH HOH A . D 3 HOH 66 565 565 HOH HOH A . D 3 HOH 67 566 566 HOH HOH A . D 3 HOH 68 567 567 HOH HOH A . D 3 HOH 69 568 568 HOH HOH A . D 3 HOH 70 569 569 HOH HOH A . D 3 HOH 71 570 570 HOH HOH A . D 3 HOH 72 571 571 HOH HOH A . D 3 HOH 73 572 572 HOH HOH A . D 3 HOH 74 573 573 HOH HOH A . D 3 HOH 75 574 574 HOH HOH A . D 3 HOH 76 575 575 HOH HOH A . D 3 HOH 77 576 576 HOH HOH A . D 3 HOH 78 577 577 HOH HOH A . D 3 HOH 79 578 578 HOH HOH A . D 3 HOH 80 579 579 HOH HOH A . D 3 HOH 81 580 580 HOH HOH A . D 3 HOH 82 581 581 HOH HOH A . D 3 HOH 83 582 582 HOH HOH A . D 3 HOH 84 583 583 HOH HOH A . D 3 HOH 85 584 584 HOH HOH A . D 3 HOH 86 585 585 HOH HOH A . D 3 HOH 87 586 586 HOH HOH A . D 3 HOH 88 587 587 HOH HOH A . D 3 HOH 89 588 588 HOH HOH A . D 3 HOH 90 589 589 HOH HOH A . D 3 HOH 91 590 590 HOH HOH A . D 3 HOH 92 591 591 HOH HOH A . D 3 HOH 93 592 592 HOH HOH A . D 3 HOH 94 593 593 HOH HOH A . D 3 HOH 95 594 594 HOH HOH A . D 3 HOH 96 595 595 HOH HOH A . D 3 HOH 97 596 596 HOH HOH A . D 3 HOH 98 597 597 HOH HOH A . D 3 HOH 99 598 598 HOH HOH A . D 3 HOH 100 599 599 HOH HOH A . D 3 HOH 101 600 600 HOH HOH A . D 3 HOH 102 601 601 HOH HOH A . D 3 HOH 103 602 602 HOH HOH A . D 3 HOH 104 603 603 HOH HOH A . D 3 HOH 105 604 604 HOH HOH A . D 3 HOH 106 605 605 HOH HOH A . D 3 HOH 107 606 606 HOH HOH A . D 3 HOH 108 607 607 HOH HOH A . D 3 HOH 109 608 608 HOH HOH A . D 3 HOH 110 609 609 HOH HOH A . D 3 HOH 111 610 610 HOH HOH A . D 3 HOH 112 611 611 HOH HOH A . D 3 HOH 113 612 612 HOH HOH A . D 3 HOH 114 613 613 HOH HOH A . D 3 HOH 115 614 614 HOH HOH A . D 3 HOH 116 615 615 HOH HOH A . D 3 HOH 117 616 616 HOH HOH A . D 3 HOH 118 617 617 HOH HOH A . D 3 HOH 119 618 618 HOH HOH A . D 3 HOH 120 619 619 HOH HOH A . D 3 HOH 121 620 620 HOH HOH A . D 3 HOH 122 621 621 HOH HOH A . D 3 HOH 123 622 622 HOH HOH A . D 3 HOH 124 623 623 HOH HOH A . D 3 HOH 125 624 624 HOH HOH A . D 3 HOH 126 625 625 HOH HOH A . D 3 HOH 127 626 626 HOH HOH A . D 3 HOH 128 627 627 HOH HOH A . D 3 HOH 129 628 628 HOH HOH A . D 3 HOH 130 629 629 HOH HOH A . D 3 HOH 131 630 630 HOH HOH A . D 3 HOH 132 631 631 HOH HOH A . D 3 HOH 133 632 632 HOH HOH A . D 3 HOH 134 633 633 HOH HOH A . D 3 HOH 135 634 634 HOH HOH A . D 3 HOH 136 635 635 HOH HOH A . D 3 HOH 137 636 636 HOH HOH A . D 3 HOH 138 637 637 HOH HOH A . D 3 HOH 139 638 638 HOH HOH A . D 3 HOH 140 639 639 HOH HOH A . D 3 HOH 141 640 640 HOH HOH A . D 3 HOH 142 641 641 HOH HOH A . D 3 HOH 143 642 642 HOH HOH A . D 3 HOH 144 643 643 HOH HOH A . D 3 HOH 145 644 644 HOH HOH A . D 3 HOH 146 645 645 HOH HOH A . D 3 HOH 147 646 646 HOH HOH A . D 3 HOH 148 647 647 HOH HOH A . D 3 HOH 149 648 648 HOH HOH A . D 3 HOH 150 649 649 HOH HOH A . D 3 HOH 151 650 650 HOH HOH A . D 3 HOH 152 651 651 HOH HOH A . D 3 HOH 153 652 652 HOH HOH A . D 3 HOH 154 653 653 HOH HOH A . D 3 HOH 155 654 654 HOH HOH A . D 3 HOH 156 655 655 HOH HOH A . D 3 HOH 157 656 656 HOH HOH A . D 3 HOH 158 657 657 HOH HOH A . D 3 HOH 159 658 658 HOH HOH A . D 3 HOH 160 659 659 HOH HOH A . D 3 HOH 161 660 660 HOH HOH A . D 3 HOH 162 661 661 HOH HOH A . D 3 HOH 163 662 662 HOH HOH A . D 3 HOH 164 663 663 HOH HOH A . D 3 HOH 165 664 664 HOH HOH A . D 3 HOH 166 665 665 HOH HOH A . D 3 HOH 167 666 666 HOH HOH A . D 3 HOH 168 667 667 HOH HOH A . D 3 HOH 169 668 668 HOH HOH A . D 3 HOH 170 669 669 HOH HOH A . D 3 HOH 171 670 670 HOH HOH A . D 3 HOH 172 671 671 HOH HOH A . D 3 HOH 173 672 672 HOH HOH A . D 3 HOH 174 673 673 HOH HOH A . D 3 HOH 175 674 674 HOH HOH A . D 3 HOH 176 675 675 HOH HOH A . D 3 HOH 177 676 676 HOH HOH A . D 3 HOH 178 677 677 HOH HOH A . D 3 HOH 179 678 678 HOH HOH A . D 3 HOH 180 679 679 HOH HOH A . D 3 HOH 181 680 680 HOH HOH A . D 3 HOH 182 681 681 HOH HOH A . D 3 HOH 183 682 682 HOH HOH A . D 3 HOH 184 683 683 HOH HOH A . D 3 HOH 185 684 684 HOH HOH A . D 3 HOH 186 685 685 HOH HOH A . D 3 HOH 187 686 686 HOH HOH A . D 3 HOH 188 687 687 HOH HOH A . D 3 HOH 189 688 688 HOH HOH A . D 3 HOH 190 689 689 HOH HOH A . D 3 HOH 191 690 690 HOH HOH A . D 3 HOH 192 691 691 HOH HOH A . D 3 HOH 193 692 692 HOH HOH A . D 3 HOH 194 693 693 HOH HOH A . D 3 HOH 195 694 694 HOH HOH A . D 3 HOH 196 695 695 HOH HOH A . D 3 HOH 197 696 696 HOH HOH A . D 3 HOH 198 697 697 HOH HOH A . D 3 HOH 199 698 698 HOH HOH A . D 3 HOH 200 699 699 HOH HOH A . D 3 HOH 201 700 700 HOH HOH A . D 3 HOH 202 701 701 HOH HOH A . D 3 HOH 203 702 702 HOH HOH A . D 3 HOH 204 703 703 HOH HOH A . D 3 HOH 205 704 704 HOH HOH A . D 3 HOH 206 705 705 HOH HOH A . D 3 HOH 207 706 706 HOH HOH A . D 3 HOH 208 707 707 HOH HOH A . D 3 HOH 209 708 708 HOH HOH A . D 3 HOH 210 709 709 HOH HOH A . D 3 HOH 211 710 710 HOH HOH A . D 3 HOH 212 711 711 HOH HOH A . D 3 HOH 213 712 712 HOH HOH A . D 3 HOH 214 713 713 HOH HOH A . D 3 HOH 215 714 714 HOH HOH A . D 3 HOH 216 715 715 HOH HOH A . D 3 HOH 217 716 716 HOH HOH A . D 3 HOH 218 717 717 HOH HOH A . D 3 HOH 219 718 718 HOH HOH A . D 3 HOH 220 719 719 HOH HOH A . D 3 HOH 221 720 720 HOH HOH A . D 3 HOH 222 721 721 HOH HOH A . D 3 HOH 223 722 722 HOH HOH A . D 3 HOH 224 723 723 HOH HOH A . D 3 HOH 225 724 724 HOH HOH A . D 3 HOH 226 725 725 HOH HOH A . D 3 HOH 227 726 726 HOH HOH A . D 3 HOH 228 727 727 HOH HOH A . D 3 HOH 229 728 728 HOH HOH A . D 3 HOH 230 729 729 HOH HOH A . D 3 HOH 231 730 730 HOH HOH A . D 3 HOH 232 731 731 HOH HOH A . D 3 HOH 233 732 732 HOH HOH A . D 3 HOH 234 733 733 HOH HOH A . D 3 HOH 235 734 734 HOH HOH A . D 3 HOH 236 735 735 HOH HOH A . D 3 HOH 237 736 736 HOH HOH A . D 3 HOH 238 737 737 HOH HOH A . D 3 HOH 239 738 738 HOH HOH A . D 3 HOH 240 739 739 HOH HOH A . D 3 HOH 241 740 740 HOH HOH A . D 3 HOH 242 741 741 HOH HOH A . D 3 HOH 243 742 742 HOH HOH A . D 3 HOH 244 743 743 HOH HOH A . D 3 HOH 245 744 744 HOH HOH A . D 3 HOH 246 745 745 HOH HOH A . D 3 HOH 247 746 746 HOH HOH A . D 3 HOH 248 747 747 HOH HOH A . D 3 HOH 249 748 748 HOH HOH A . D 3 HOH 250 749 749 HOH HOH A . D 3 HOH 251 750 750 HOH HOH A . D 3 HOH 252 751 751 HOH HOH A . D 3 HOH 253 752 752 HOH HOH A . D 3 HOH 254 753 753 HOH HOH A . D 3 HOH 255 754 754 HOH HOH A . D 3 HOH 256 755 755 HOH HOH A . D 3 HOH 257 756 756 HOH HOH A . D 3 HOH 258 757 757 HOH HOH A . D 3 HOH 259 758 758 HOH HOH A . D 3 HOH 260 759 759 HOH HOH A . D 3 HOH 261 760 760 HOH HOH A . D 3 HOH 262 761 761 HOH HOH A . D 3 HOH 263 762 762 HOH HOH A . D 3 HOH 264 763 763 HOH HOH A . D 3 HOH 265 764 764 HOH HOH A . D 3 HOH 266 765 765 HOH HOH A . D 3 HOH 267 766 766 HOH HOH A . D 3 HOH 268 767 767 HOH HOH A . D 3 HOH 269 768 768 HOH HOH A . D 3 HOH 270 769 769 HOH HOH A . D 3 HOH 271 770 770 HOH HOH A . D 3 HOH 272 771 771 HOH HOH A . D 3 HOH 273 772 772 HOH HOH A . D 3 HOH 274 773 773 HOH HOH A . D 3 HOH 275 774 774 HOH HOH A . D 3 HOH 276 775 775 HOH HOH A . D 3 HOH 277 776 776 HOH HOH A . D 3 HOH 278 777 777 HOH HOH A . D 3 HOH 279 778 778 HOH HOH A . D 3 HOH 280 779 779 HOH HOH A . D 3 HOH 281 780 780 HOH HOH A . D 3 HOH 282 781 781 HOH HOH A . D 3 HOH 283 782 782 HOH HOH A . D 3 HOH 284 783 783 HOH HOH A . D 3 HOH 285 784 784 HOH HOH A . D 3 HOH 286 785 785 HOH HOH A . D 3 HOH 287 786 786 HOH HOH A . D 3 HOH 288 787 787 HOH HOH A . D 3 HOH 289 788 788 HOH HOH A . D 3 HOH 290 789 789 HOH HOH A . D 3 HOH 291 790 790 HOH HOH A . D 3 HOH 292 791 791 HOH HOH A . D 3 HOH 293 792 792 HOH HOH A . D 3 HOH 294 793 793 HOH HOH A . D 3 HOH 295 794 794 HOH HOH A . D 3 HOH 296 795 795 HOH HOH A . D 3 HOH 297 796 796 HOH HOH A . D 3 HOH 298 797 797 HOH HOH A . D 3 HOH 299 798 798 HOH HOH A . D 3 HOH 300 799 799 HOH HOH A . D 3 HOH 301 800 800 HOH HOH A . D 3 HOH 302 801 801 HOH HOH A . D 3 HOH 303 802 802 HOH HOH A . D 3 HOH 304 803 803 HOH HOH A . D 3 HOH 305 804 804 HOH HOH A . D 3 HOH 306 805 805 HOH HOH A . D 3 HOH 307 806 806 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 40 A MSE 40 ? MET SELENOMETHIONINE 3 A MSE 181 A MSE 181 ? MET SELENOMETHIONINE 4 A MSE 253 A MSE 253 ? MET SELENOMETHIONINE 5 A MSE 295 A MSE 295 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details octameric _pdbx_struct_assembly.oligomeric_count 8 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 53480 ? 1 MORE -721 ? 1 'SSA (A^2)' 79160 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 133 ? A CYS 133 ? 1_555 ZN ? B ZN . ? A ZN 400 ? 1_555 SG ? A CYS 135 ? A CYS 135 ? 1_555 117.8 ? 2 SG ? A CYS 133 ? A CYS 133 ? 1_555 ZN ? B ZN . ? A ZN 400 ? 1_555 SG ? A CYS 143 ? A CYS 143 ? 1_555 103.8 ? 3 SG ? A CYS 135 ? A CYS 135 ? 1_555 ZN ? B ZN . ? A ZN 400 ? 1_555 SG ? A CYS 143 ? A CYS 143 ? 1_555 121.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-10-21 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-09-13 5 'Structure model' 2 0 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' 5 5 'Structure model' 'Atomic model' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' refine 2 4 'Structure model' software 3 5 'Structure model' atom_site 4 5 'Structure model' database_2 5 5 'Structure model' struct_conn 6 5 'Structure model' struct_ref_seq_dif 7 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_refine.pdbx_ls_cross_valid_method' 2 4 'Structure model' '_refine.pdbx_method_to_determine_struct' 3 4 'Structure model' '_software.name' 4 5 'Structure model' '_atom_site.occupancy' 5 5 'Structure model' '_database_2.pdbx_DOI' 6 5 'Structure model' '_database_2.pdbx_database_accession' 7 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 8 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 9 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 10 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 11 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 12 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 13 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 14 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 15 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 16 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 17 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 18 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 19 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 20 5 'Structure model' '_struct_ref_seq_dif.details' 21 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 22 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 23 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DM 'model building' . ? 1 MLPHARE phasing . ? 2 VECSUM 'model building' . ? 3 RESTRAIN refinement . ? 4 MOSFLM 'data reduction' . ? 5 CCP4 'data scaling' '(AGROVATA' ? 6 ROTAVATA 'data scaling' . ? 7 DM phasing . ? 8 VECSUM phasing . ? 9 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 550 ? ? O A HOH 617 ? ? 1.98 2 1 O A HOH 568 ? ? O A HOH 663 ? ? 2.05 3 1 O A HOH 614 ? ? O A HOH 621 ? ? 2.17 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 797 ? ? 1_555 O A HOH 797 ? ? 6_555 0.37 2 1 O A HOH 726 ? ? 1_555 O A HOH 726 ? ? 16_555 0.94 3 1 O A HOH 675 ? ? 1_555 O A HOH 675 ? ? 5_555 1.52 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 34 ? ? CZ A ARG 34 ? ? NH1 A ARG 34 ? ? 117.26 120.30 -3.04 0.50 N 2 1 C A ILE 94 ? ? N A PRO 95 ? ? CA A PRO 95 ? ? 128.60 119.30 9.30 1.50 Y 3 1 CA A CYS 175 ? ? CB A CYS 175 ? ? SG A CYS 175 ? ? 123.69 114.20 9.49 1.10 N 4 1 CG A MSE 181 ? ? SE A MSE 181 ? ? CE A MSE 181 ? ? 112.27 98.90 13.37 2.20 N 5 1 NE A ARG 242 ? ? CZ A ARG 242 ? ? NH1 A ARG 242 ? ? 116.70 120.30 -3.60 0.50 N 6 1 CG1 A VAL 262 ? ? CB A VAL 262 ? ? CG2 A VAL 262 ? ? 100.54 110.90 -10.36 1.60 N 7 1 CA A CYS 285 ? ? CB A CYS 285 ? ? SG A CYS 285 ? ? 120.97 114.20 6.77 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 51 ? ? -49.59 -13.85 2 1 ASP A 53 ? ? -45.06 164.25 3 1 PHE A 54 ? ? 164.33 62.86 4 1 SER A 59 ? ? -165.29 -67.77 5 1 ALA A 60 ? ? -161.34 -2.47 6 1 ASN A 62 ? ? -142.32 18.98 7 1 PRO A 95 ? ? -38.56 -6.65 8 1 ASP A 107 ? ? -56.32 108.62 9 1 PRO A 108 ? ? -47.93 -16.12 10 1 PRO A 124 ? ? -64.16 10.10 11 1 ASP A 148 ? ? -55.56 105.41 12 1 MSE A 181 ? ? 84.24 7.00 13 1 PRO A 218 ? ? -42.87 156.72 14 1 GLN A 236 ? ? -161.36 118.62 15 1 PRO A 264 ? ? -66.89 -171.18 16 1 CYS A 279 ? ? -105.98 43.67 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 220 ? A ARG 220 2 1 Y 1 A ASP 221 ? A ASP 221 3 1 Y 1 A ALA 222 ? A ALA 222 4 1 Y 1 A ALA 223 ? A ALA 223 5 1 Y 1 A CYS 224 ? A CYS 224 6 1 Y 1 A SER 225 ? A SER 225 7 1 Y 1 A ALA 226 ? A ALA 226 8 1 Y 1 A PRO 227 ? A PRO 227 9 1 Y 1 A SER 228 ? A SER 228 10 1 Y 1 A ASN 229 ? A ASN 229 11 1 Y 1 A GLY 230 ? A GLY 230 12 1 Y 1 A ASP 231 ? A ASP 231 13 1 Y 1 A ARG 232 ? A ARG 232 14 1 Y 1 A LYS 233 ? A LYS 233 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH #